Dual specificity antibodies and methods of making and using
Abstract
This record has no abstract on file.
Term
Term ended
Expired 28 June 2021, 5.2 years ago.
- Priority
- Filed
- Granted
- Expired
- Today
41 claims: 1 independent, 40 dependent
- 1Sposób uzyskiwania przeciwciała o podwójnej specyficzności lub jego części wiążącej antygen, które specyficznie wiąże dwa różne, lecz strukturalnie pokrewne białka, znamienny tym, że:otrzymuje się antygen przez składanie ze sobą zachodzących na siebie części dwu różnych, lecz strukturalnie pokrewnych białek dla utworzenia peptydu hybrydowego, który to peptyd ma strukturę X-Y-Z, gdzie Y przedstawia region identyczny lub bardzo podobny dla obu pokrewnych białek, PL 208 069 B1 X przedstawia region z jednego z pokrewnych białek, a Z przedstawia region z drugiego z pokrewnych białek;wystawia się repertuar przeciwciał na działanie tego antygenu;i przeprowadza się selekcję repertuaru przeciwciał, które specyficznie wiążą te dwie różne, lecz strukturalnie pokrewne białka, w celu otrzymania przeciwciała o podwójnej specyficzności.
- 2Sposób według zastrz. 1, znamienny tym, że repertuar przeciwciał wystawia się na działanie antygenu in vivo poprzez immunizację nie będącego człowiekiem zwierzęcia tym antygenem.
- 3Sposób według zastrz. 2, znamienny tym, że obejmuje ponadto przygotowanie panelu hybrydom z limfocytów zwierzęcia i wybieranie hybrydomy wydzielającej przeciwciało specyficznie wiążące dwa różne, lecz strukturalnie pokrewne białka cząsteczki.
- 4Sposób według zastrz. 2, znamienny tym, że zwierzę wybiera się z grupy obejmującej myszy, szczury, króliki i kozy.
- 5Sposób według zastrz. 2, znamienny tym, że jako zwierzę stosuje się mysz z wyłączonym genem pozbawioną endogennej wersji antygenu.
- 6Sposób według zastrz. 2, znamienny tym, że stosuje się zwierzę będące myszą transgeniczna pod względem ludzkich genów immunoglobulin i wytwarzające w wyniku stymulacji antygenowej ludzkie przeciwciała.
- 7Sposób według zastrz. 2, znamienny tym, że stosuje się zwierzę będące myszą z ostrym złożonym zespołem braku odporności odbudowanej za pomocą ludzkich obwodowych komórek jednojądrzastych lub komórek limfoidalnych, lub ich prekursorów.
- 8Sposób według zastrz. 2, znamienny tym, że stosuje się zwierzę będące myszą poddaną naświetleniu śmiertelną dawką promieniowania, następnie poddaną ochronie radiologicznej przez przeszczep komórek szpiku kostnego od myszy z ostrym złożonym zespołem braku odporności, a następnie przeszczepieniu ludzkich, funkcjonalnych limfocytów.
- 9Sposób według zastrz. 1, znamienny tym, że repertuar przeciwciał wystawia się na działanie antygenu in vitro przez przeszukiwanie biblioteki rekombinowanych przeciwciał z wykorzystaniem tego antygenu.
- 10Sposób według zastrz. 9, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana na powierzchni bakteriofaga.
- 11Sposób według zastrz. 9, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana na powierzchni komórki drożdżowej.
- 12Sposób według zastrz. 9, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana na powierzchni komórki bakterii.
- 13Sposób według zastrz. 9, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana jako produkty fuzyjne RNA-białko.
- 14Sposób według zastrz. 9, znamienny tym, że biblioteka rekombinowanych przeciwciał jest biblioteką scFv lub biblioteką Fab.
- 15Sposób według zastrz. 1, znamienny tym, że repertuar przeciwciał jest wystawiany na działanie antygenu przez immunizację in vivo zwierzęcia tym antygenem, a następnie przeszukiwanie in vitro biblioteki rekombinowanych przeciwciał utworzonej z komórek limfoidalnych tego zwierzęcia z użyciem tego antygenu.
- 16Sposób według zastrz. 1, znamienny tym, że repertuar przeciwciał jest wystawiany na działanie antygenu in vivo poprzez immunizację zwierzęcia tym antygenem, a następnie dojrzewanie powinowactwa in vitro biblioteki rekombinowanych przeciwciał utworzonej z komórek limfoidalnych tego zwierzęcia.
- 17Sposób według zastrz. 1, znamienny tym, że repertuar przeciwciał jest wystawiany na działanie antygenu przez immunizację in vivo zwierzęcia tym antygenem, a następnie wybieranie pojedynczych komórek wydzielających przeciwciało wiążące antygen, i odzyskiwanie cDNA zmiennych regionów łańcucha lekkiego i ciężkiego z tych pojedynczych komórek.
- 18Sposób według zastrz. 1, znamienny tym, że uzyskuje się przeciwciało o podwójnej specyficzności będące w pełni ludzkim przeciwciałem.
- 19Sposób według zastrz. 1, znamienny tym, że uzyskuje się przeciwciało o podwójnej specyficzności będące przeciwciałem chimerycznym.
- 20Sposób według zastrz. 1, znamienny tym, że uzyskuje się przeciwciało o podwójnej specyficzności będące przeciwciałem z przeszczepionym CDR. PL 208 069 B1
- 21Sposób według zastrz. 1, znamienny tym, że dwoma różnymi, lecz strukturalnie pokrewnymi białkami są interleukina-1 α i interleukina-1 β.
- 22Sposób według zastrz. 21, znamienny tym, że jako antygen stosuje się antygen obejmujący sekwencję aminokwasową TKGGQDITDFQILENQ (Sek Id Nr 3).
- 23Sposób według zastrz. 21, znamienny tym, że repertuar przeciwciał wystawia się na działanie antygenu in vivo, poprzez immunizowanie nie będącego człowiekiem zwierzęcia tym antygenem.
- 24Sposób według zastrz. 23, znamienny tym, że ponadto przygotowuje panel hybrydom z limfocytów zwierzęcia i wybiera się hybrydomę wydzielającą przeciwciało specyficznie wiążące IL-1 α i IL-1 β.
- 25Sposób według zastrz. 23, znamienny tym, że stosuje się zwierzę wybrane się z grupy obejmującej mysz, szczura, królika i kozę.
- 26Sposób według zastrz. 23, znamienny tym, że stosuje się zwierzę będące myszą z wyłączonym genem, nie wytwarzającą IL-1a, IL-1 β lub IL-1a i IL-1 β.
- 27Sposób według zastrz. 23, znamienny tym, że stosuje się zwierzę będące myszą transgeniczna pod względem ludzkich genów immunoglobulin i wytwarzające w wyniku stymulacji antygenowej ludzkie przeciwciała.
- 28Sposób według zastrz. 23, znamienny tym, że stosuje się zwierzę będące myszą z ostrym złożonym zespołem braku odporności odbudowanej za pomocą ludzkich obwodowych komórek jednojądrzastych lub komórek limfoidalnych, lub ich prekursorów.
- 29Sposób według zastrz. 23, znamienny tym, że stosuje się zwierzę będące myszą poddaną naświetleniu śmiertelną dawką promieniowania, następnie poddaną ochronie radiologicznej przez przeszczep komórek szpiku kostnego od myszy z ostrym złożonym zespołem braku odporności, a następnie przeszczepieniu ludzkich, funkcjonalnych limfocytów lub ich prekursorów.
- 30Sposób według zastrz. 23, znamienny tym, że repertuar przeciwciał wystawia się na działanie antygenu in vitro przez przeszukiwanie biblioteki rekombinowanych przeciwciał z wykorzystaniem tego antygenu.
- 31Sposób według zastrz. 30, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana na powierzchni bakteriofaga.
- 32Sposób według zastrz. 30, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana na powierzchni komórki drożdżowej.
- 33Sposób według zastrz. 30, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana na powierzchni komórki bakterii.
- 34Sposób według zastrz. 30, znamienny tym, że biblioteka rekombinowanych przeciwciał jest eksprymowana jako produkty fuzyjne RNA-białko.
- 35Sposób według zastrz. 30, znamienny tym, że biblioteka rekombinowanych przeciwciał jest biblioteką scFv lub biblioteką Fab.
- 36Sposób według zastrz. 21, znamienny tym, że repertuar przeciwciał jest wystawiany na działanie antygenu przez immunizację in vivo nie będącego człowiekiem zwierzęcia tym antygenem, a następnie przeszukiwanie in vitro biblioteki rekombinowanych przeciwciał utworzonej z komórek limfoidalnych tego zwierzęcia z użyciem tego antygenu.
- 37Sposób według zastrz. 21, znamienny tym, że repertuar przeciwciał jest wystawiany na działanie antygenu in vivo poprzez immunizację nie będącego człowiekiem zwierzęcia tym antygenem, a następnie dojrzewanie powinowactwa in vitro biblioteki rekombinowanych przeciwciał utworzonej z komórek limfoidalnych tego zwierzęcia.
- 38Sposób według zastrz. 21, znamienny tym, że repertuar przeciwciał jest wystawiany na działanie antygenu przez immunizację in vivo nie będącego człowiekiem zwierzęcia tym antygenem, a następnie wybieranie pojedynczych komórek wydzielających przeciwciało wiążące antygen, i odzyskiwanie cDNA zmiennych regionów łańcucha lekkiego i ciężkiego z tych pojedynczych komórek.
- 39Sposób według zastrz. 21, znamienny tym, że uzyskuje się przeciwciało o podwójnej specyficzności będące w pełni ludzkim przeciwciałem.
- 40Sposób według zastrz. 21, znamienny tym, że uzyskuje się przeciwciało o podwójnej specyficzności będące przeciwciałem chimerycznym.
- 41Sposób według zastrz. 21, znamienny tym, że uzyskuje się przeciwciało o podwójnej specyficzności będące przeciwciałem z przeszczepionym CDR.
Independent claims41
216 paragraphs in 15 sections, as filed
Description of the invention
The invention relates to a method of obtaining a dual specificity antibody, or antigen-binding portion thereof, that specifically binds two different, but structurally related proteins.
The immune system of mammals consists of B lymphocytes, which produce an antibody repertoire consisting of hundreds of billions of different antibody specificities. A correct immune response to a particular antigen involves selecting one or more specific antigen-binding antibodies from said antibody repertoire, and the success of the immune response is based, at least in part, on the ability of said antibodies to specifically recognize (and ultimately eliminate) the stimulating antigen and "ignore" others. molecules from the vicinity of said antibodies.
The utility of antibodies specifically recognizing one particular target antigen has led to the development of monoclonal antibody technology. Standard hybridoma technology now allows the production of antibodies with a single specificity for a particular antigen. Recently, a technique for producing recombinant antibodies, such as in vitro antibody library screening, has been developed. These techniques allow the production of antibodies with a single specificity for a particular antigen.
Antibodies specific for a single target antigen may, at least under certain conditions, exhibit unfavorable cross-reactivity or non-specific ("background") binding to other antigens. Said cross-reactivity or non-specific binding, however, is unpredictable (ie it cannot be predicted with which antigen a particular antibody will cross-react). Furthermore, this binding is usually distinguishable from specific antigen binding by an antibody as it represents only a small fraction of the antigen-binding capacity of the antibody (e.g., 1% or less of the total antibody binding strength), and is typically observed at high antibody concentrations (e.g., 1000 fold). or higher than the concentration necessary to observe the specific antigen binding phenomenon). Although there are individual antigens that may belong to a structurally related family of proteins, the response of said antibody to a particular family member is highly specific. In addition, there are a number of examples of members belonging to a particular protein family (e.g. members of the IL-1 and TNF families) that bind to the same receptor, receptor component, or structurally related receptors, but monoclonal antibodies raised against one family member do not show high cross-reactivity to other family members. There may be several reasons for the lack of cross-reactivity of monoclonal antibodies to different family members. First, the standard hybridoma procedure looks for only a few antibodies with high specificity / affinity for the target antigen and checks for cross-reactivity or non-specific binding of a few selected antibodies. Second, although the proteins within the family are structurally related, they may have only non-overlapping immunodominant epitopes. Thus, monoclonal antibodies produced using a full-length protein need not be cross-reactive with other structurally related proteins.
There are known examples of monoclonal antibodies raised against an antigen from one species that bind specifically to a functionally same antigen from another species. For example, an anti-mouse X antibody can readily react with the human X antigen. This is because these antigens share significant sequence and structural similarities, even though they are not identical. However, said species cross-reactivity of antibodies does not constitute "dual specificity" of the antibodies as they exhibit specificity for the same antigen from different species of organism.
Thus, there is a need for monoclonal antibodies having predictable dual or multiple specificity, that is, antibodies having true specificity for two or more antigens.
Summary of the invention
The invention relates to a method of obtaining a dual specificity antibody or antigen-binding portion thereof that specifically binds two different but structurally related proteins, characterized in that the antigen is obtained by assembling the overlapping portions of two different but structurally related proteins to form hybrid peptide, which peptide has the XYZ structure, where Y represents a region identical or very similar to both related proteins, X represents a region from one of the related proteins, and Z represents a region from the other related proteins; the antibody repertoire is exposed to this antigen; and selecting an antibody repertoire that specifically binds the two different but structurally related proteins to obtain an antibody with dual specificity.
Preferably, the antibody repertoire is exposed to the antigen in vivo by immunizing a non-human animal with that antigen.
More preferably, the method further comprises preparing a panel of hybridomas from the animal's lymphocytes, and selecting an antibody secreting hybridoma that specifically binds two different but structurally related protein molecules.
Preferably the animal is selected from the group consisting of mice, rats, rabbits and goats.
Preferably, the animal used is a gene knockout mouse lacking the endogenous version of the antigen.
Preferably, an animal is used that is a mouse that is transgenic for human immunoglobulin genes and produces human antibodies by antigenic stimulation.
Preferably a mouse animal with acute complex immunodeficiency syndrome restored with human peripheral mononuclear cells or lymphoid cells or their precursors is used.
Preferably, an animal is used that is a mouse that has been irradiated with a lethal dose of radiation followed by radiation protection by transplantation of bone marrow cells from mice with acute complex immunodeficiency syndrome followed by transplantation of human functional lymphocytes.
In a preferred embodiment, the antibody repertoire is exposed to the antigen in vitro by screening a recombinant antibody library using the antigen.
More preferably, the recombinant antibody library is expressed on the surface of the bacteriophage.
Also more preferably, the recombinant antibody library is expressed on the surface of a yeast cell.
Also more preferably, the recombinant antibody library is expressed on the surface of the bacterial cell.
More preferably, the recombinant antibody library is expressed as RNA-protein fusion products.
Also more preferably, the recombinant antibody library is an scFv library or a Fab library.
In a preferred embodiment, the antibody repertoire is exposed to an antigen by immunizing an animal with that antigen in vivo and then screening an in vitro recombinant antibody library made from that animal's lymphoid cells with that antigen.
In another preferred embodiment, the antibody repertoire is exposed to an antigen in vivo by immunizing an animal with that antigen, followed by in vitro affinity maturation of a recombinant antibody library made from the animal's lymphoid cells.
In a further preferred embodiment, the antibody repertoire is exposed to an antigen by immunizing the animal in vivo with the antigen, then selecting antigen-binding antibody secreting single cells, and recovering light and heavy chain variable region cDNAs from these individual cells.
Preferably, a dual specificity antibody is obtained which is a fully human antibody.
Also preferably, a dual specificity antibody is obtained which is a chimeric antibody.
Preferably, a dual specificity antibody is obtained which is a CDR-grafted antibody.
In a preferred embodiment, two different but structurally related proteins are interleukin-1a and interleukin-1β.
More preferably, an antigen comprising the amino acid sequence TKGGQDITDFQILENQ (SEQ ID No. 3) is used as the antigen.
Also more preferably, the antibody repertoire is exposed to the antigen in vivo by immunizing a non-human animal with that antigen.
More preferably, further, a panel of hybridomas is prepared from the animal's lymphocytes, and a hybridoma secreting an antibody that specifically binds IL-1a and IL-1β is selected.
PL 208 069 B1
More preferably, an animal selected from the group consisting of mouse, rat, rabbit and goat is used.
Also more preferably, an animal that is a gene knockout, non-producing mouse is used
IL-Ια, IL-1 β or IL-Ια and IL-1 β.
More preferably, an animal is used that is a mouse that is transgenic for human immunoglobulin genes and produces human antibodies by antigenic stimulation.
More preferably, a mouse animal with acute complex immunodeficiency syndrome restored with human peripheral mononuclear cells or lymphoid cells or their precursors is used.
Also more preferably, an animal is used which is a mouse exposed to a lethal dose of radiation followed by radiation protection by bone marrow transplantation from mice with acute complex immunodeficiency syndrome followed by transplantation of human functional lymphocytes or their precursors.
In a preferred embodiment, the antibody repertoire is exposed to the antigen in vitro by screening a recombinant antibody library using the antigen.
More preferably, the recombinant antibody library is expressed on the surface of the bacteriophage.
More preferably, the recombinant antibody library is expressed on the surface of a yeast cell.
More preferably, the recombinant antibody library is expressed on the surface of the bacterial cell.
More preferably, the recombinant antibody library is expressed as RNA-protein fusion products.
More preferably, the recombinant antibody library is an scFv library or a Fab library.
In a preferred method, the antibody repertoire is exposed to an antigen by in vivo immunization of a non-human animal with that antigen, and then in vitro screening of a recombinant antibody library made from that animal's lymphoid cells with that antigen.
In another preferred method, the antibody repertoire is exposed to an antigen in vivo by immunizing a non-human animal with that antigen, followed by in vitro affinity maturation of a recombinant antibody library made from the animal's lymphoid cells.
In a further preferred method, the antibody repertoire is exposed to an antigen by in vivo immunization of a non-human animal with that antigen, then selecting individual antigen-binding antibody secreting cells, and recovering light and heavy chain variable region cDNAs from these individual cells.
Preferably, a dual specificity antibody is obtained which is a fully human antibody.
Preferably, the dual specificity antibody is a chimeric antibody.
Preferably, a dual specificity antibody is obtained which is a CDR-grafted antibody.
In a clinical setting, individual members of the same protein family may contribute to the onset of various symptoms of the disease process. Thus, a dual specificity antibody may be used to bind members of the same protein family to block the function of more than one family member, which may be beneficial in relieving disease symptoms or terminating the disease process itself. In addition, the dual specificity antibodies of the invention can be used to detect structurally related antigens, purify structurally related antigens, and in diagnostic assays involving structurally related antigens.
An antigen can be designed based on a topologically common area of identity between two different but structurally related molecules. For example, two different but structurally related molecules can be proteins and the antigen can be a peptide comprising the amino acid sequence of a topologically common area of identity between the two proteins.
The antigen can also be designed based on the structural mimicking of the loop of the common folding region of two different but structurally related molecules. For example, an antigen
PL 208 069 B1 may be a cyclic peptide mimicking the loop structure of the common area of topological identity of two different but structurally related proteins.
An antigen can also be designed based on the joined, alternating, or overlapping portions of two different but structurally related molecules to produce a hybrid molecule. For example, an antigen may be a hybrid peptide produced by combining alternating or overlapping amino acid sequences of two different but structurally related proteins.
The antibody repertoire may be exposed to a particular antigen in vivo or in vitro. For example, exposing an antibody repertoire to an antigen includes immunizing the animal in vivo with the antigen. Said in vivo method may further comprise obtaining a set of hybridomas from the animal's lymphocytes and selecting for hybridomas that secrete an antibody that specifically binds two different but structurally related molecules. The immunized animal may be, for example, a mouse, rat, rabbit or goat, or a transgenic version of said animals, such as a human immunoglobulin gene transgene mouse such that said mouse produces human antibodies in response to antigenic stimulation. Other types of animals may also be immunized, including a transgenic SCID mouse generated using human peripheral mononuclear cells (hu-PBMC-SCID chimeric mouse) or lymphoid cells or their precursors, and a mouse exposed to a lethal dose of ionizing radiation, then treated with mouse bone marrow cells. SCID and then treated with human lymphocytes (Trimer system). Another type of animal to be immunized may include, e.g., a knockout mouse, e.g. by homologous recombination with an endogenous gene or genes encoding an antigen or antigens of the invention, wherein upon immunization with the antigen or antigens of the invention, the knockout animal recognizes the antigen or antigens as foreign.
The antibody repertoire can be exposed to an antigen in vitro by screening a recombinant antibody library with the antigen. Said recombinant antibody library can, for example, be expressed in a bacteriophage or in yeast cells or in bacterial cells. For example, the recombinant antibody library is an scFv library or a Fab library. Antibody libraries can be expressed as RNA-protein fusion molecules.
It is also possible to combine said methods in vivo and in vitro, such as exposing the antibody repertoire to an antigen by immunizing the animal in vivo with said antigen, and then screening in vitro a recombinant antibody library obtained from the lymphoid cells of said animal with the antigen. It is possible to expose the antibody repertoire to an antigen by in vivo immunization of the animal with the antigen, followed by selection of a single antibody-producing cell, then obtaining light and heavy chain variable region cDNA from selected cells (e.g. by PCR) and expression of the variable regions of the light and heavy chain in mammalian host cells in vitro (referred to as a method of obtaining an antibody from selected lymphocyte antibody method, SLAM), thereby allowing further selection and manipulation of the selected gene sequence encoding the antibody. Another method of selecting monoclonal antibodies may involve expressing the antibody heavy and light chain genes in mammalian cells and selecting cells that express and secrete the antibody with the desired specificity.
The methods of the invention allow the preparation of many different types of dual specificity antibodies, including fully human antibodies, chimeric antibodies and chimeric antibodies-CDRs, and antigen-binding fragments. A dual specificity antibody can be used in methods for detecting IL-Ια or IL-1 β which involve contacting IL-Ια or IL-1 β with a dual specificity antibody, or antigen-binding portion of said antibody, such that IL-Ια can be detected or IL-1 β. A dual specificity neutralizing antibody may also be used in a method of inhibiting the activity of IL-1a or IL-1β by contacting IL-1a or β-1β with the dual specificity antibody or antigen-binding portion of said antibody such that it inhibits the activity of IL-1a. -1a or IL-1 β. Said dual specificity antibodies can also be used in methods of treating an interleukin 1 pathology disease comprising administering to the subject a dual specificity antibody or antigen-binding portion of said antibody.
PL 208 069 B1
Detailed Description of the Invention
The invention relates to the design and use of antigens for the production of dual specificity antibodies, that is, antibodies specific for at least two different but structurally related molecules, and also provides a method of producing dual specificity antibodies. Structural relatedness of antigens may include the entire antigen molecule (e.g., proteins) or only certain structurally related regions. The invention provides a method of obtaining dual specificity antibodies that specifically bind two different but structurally related molecules, including:
providing an antigen encompassing the common structural features of two different but structurally related molecules exposing an antibody repertoire to an antigen selecting from an antibody repertoire that specifically binds two different but structurally related molecules to obtain a dual specificity antibody.
It should be noted that while the invention is set forth herein in terms describing the recognition of two different but related antigens, the term "dual specificity antibody" is intended to include antibodies specifically recognizing even more than two different but related antigens, such as an antibody that recognizes three, four, five, or more structurally related but different antigens. Furthermore, the term "different but structurally related antigens" is intended to include antigens (eg, proteins) whose general structures are related, as well as antigens (eg, proteins) that share one or more structurally related regions that are not otherwise related. Thus, "different but structurally related" antigens may be, for example, two proteins belonging to the same protein family having a common overall structure, or they may be, for example, two proteins whose overall structure is not similar (not related) but both have related structurally domains.
Various types of antigens and various methods of preparing the antibodies can be used to produce the antibodies of the invention to obtain dual specificity antibodies as discussed in more detail below.
I. Dual specificity antibodies
To produce the dual specificity antibodies of the invention, antibodies are produced against an antigen capable of producing dual specificity antibodies. Such antigens are hereinafter generally referred to as dual specificity antigens. Various types of dual specificity antigens can be used and the design of the various types of dual specificity antigens is outlined below.
A. Adjacent topological areas of identity
In a particular embodiment, a dual specificity antigen comprises a contiguous topological region of identity and / or similarity between two different but structurally related molecules for which a dual specificity antibody arises. Preferably said antigen comprises the largest (e.g. longest) contiguous topological area of identity and / or similarity between two different but structurally related molecules. Preferably, said two different but structurally related molecules are proteins and the dual specificity antigen comprises a linear peptide corresponding to the largest (e.g. longest) contiguous topological region of identity and / or similarity for both of said proteins. A useful region of identity / similarity is preferably a receptor or ligand binding region, although other regions of identity / similarity may also be used.
In order to determine contiguous topological regions of identity between two molecules (e.g., proteins), the two molecules are compared (e.g., by homologous modeling, comparing structural information, or sequence alignment), and identical or similar regions are thus identified. For proteins, a comparison algorithm can be used to create an optimal alignment and identify the largest (e.g. longest) contiguous topological region of identity and / or similarity between two proteins. A preferred, non-limiting example of a mathematical algorithm used to compare two sequences is that given by Karlin and Altschul (1990) PNAS 87: 2264-68, as modified by Karlin and Altschul (1993) PNAS 90: 5873-77. Such an algorithm is part of the NBLAST and XBLAST programs of Altschula et al (1990) J Mol Biol 215: 403-10. To align sequences with gaps for comparison purposes, the Gapped BLAST program can be used as described by Altschul et al (1997) NAR 25 (17): 3389-3402. When BLAST programs are used
And Gapped BLAST can be used with the default parameters of the respective programs (e.g., XBLAST and NBLAST). See: http://www.ncbi.nml.nih.gov. An alternative mathematical algorithm that can be used for the same purpose is the ALIGN program reported by Myers and Miller (1988) Comput Appl Biosci 4: 11-17.
Once a useful region of identity / similarity is selected, a dual specificity antigen corresponding to the selected region can then be chemically synthesized. For example, in the case of peptide antigens, the peptide may be synthesized by standard peptide synthesis methods. The peptide antigen may include L amino acids. In another embodiment, the peptide antigen may consist of all or part of D amino acids. An example of designing a dual specificity antigen based on the contiguous topological region of identity and / or similarity between two different but structurally related proteins is described in detail in Example 1.
B. Cyclic peptides that mimic the structural loop
The dual specificity antigen of the invention may comprise a cyclic molecule, preferably a cyclic peptide, mimicking a structurally key loop of the folding region of two different but structurally related molecules (e.g., proteins) for which a specific antibody is produced. In order to obtain the said antigen, the structures of two related molecules are compared and the structurally identical folding loop present in both molecules is searched for. Standard modeling and crystallographic analysis techniques can be used to identify said loops and structurally common fold regions. Identical or similar regions (e.g., amino acid sequences common to both molecules) can be identified, and then a consensus sequence can be derived for similar but not identical regions. Linear molecule (e.g. linear peptide) is designed based on the detected similarities and identical regions, and then said linear molecule can be cyclized, in a manner known to chemists, to become an antigen mimicking this key loop. For example, proline and glycine may be added to the end of a linear peptide to allow for cyclization of the peptide. Example 2 provides an example of designing a dual specificity antigen in the form of a cyclic peptide that mimics a loop that is structurally common to both different but related proteins.
C. Hybrid molecules
A dual specificity antibody of the invention may also include a hybrid molecule, preferably a hybrid peptide, comprising alternating or overlapping portions of two different but structurally related molecules (e.g., proteins) for which dual specificity antibodies are produced. In order to produce this type of antigen, the structures of the two molecules are first compared, and overlapping regions (regions of identity) as well as regions not identical to both molecules are identified. Next, a hybrid molecule (e.g. a hybrid peptide where both molecules are proteins) is prepared, preferably comprising alternating regions (e.g. amino acid sequences) from each of the two molecules, as well as overlapping regions common to both molecules. Schematically, said hybrid molecule can be represented as follows: XYZ, where Y represents a region of identity or great similarity for both related molecules (overlap region), X represents a region from one of said molecules, and Z represents a region from the other molecule. An example of designing a dual specificity antigen based on a hybrid peptide comprising the sequences of two different but structurally related proteins is detailed in Example 3.
Another type of hybrid molecule is a molecule in which the peptide has been incorporated into a full-length protein (hereinafter referred to as the target protein). The peptides are selected to correspond to the functional regions of two different but structurally related proteins, for example, receptor interacting regions. Such peptides are hereinafter referred to as functional peptides. A functional peptide from one of the related proteins may then be incorporated into another full-length related protein, or alternatively, into an unrelated protein. For example, the IL-Ια peptide corresponding to the IL-1a receptor interacting region is identified, and this functional peptide
IL-1α is incorporated into the full-length IL-1β protein to create the IL-1a / IL-1e hybrid protein. Similarly, an IL-1β peptide corresponding to the IL-1β receptor interacting region is identified, and this functional IL-1e peptide is inserted into full length IL-1a protein to create the IL-1a / IL-1e hybrid protein. Said introduction of a functional peptide into a full-length related protein restricts the functional peptide at both ends and maintains the folding structure of the functional peptide.
PL 208 069 B1
In the case of the hybrid molecule IL-1α / IL-1β, the functional peptide is introduced (replaces natural amino acids) in the target region corresponding to the common spatial structure of IL-1α and IL-1 (<These structures can be found along the entire length of the protein (e.g. in the N-terminal region, in the middle and C-terminal region). Moreover, functional peptides corresponding to the common spatial structure of IL-WIL-1 can be incorporated into other proteins as well, such as albumin and some other naturally occurring proteins. In such a case, the preferred point for introducing the peptide is the region which allows the introduced peptide to maintain the correct three-dimensional structure. Thus, the peptide insertion sites may be the N-terminal region, the middle region or the C-terminal region of the protein. The site of introduction of said peptides onto the naturally occurring target protein is chosen so as to mimic the natural structural constraints inherent in the natural protein from which said peptides are derived. While the functional peptide may simply be introduced into the target protein such that amino acids of the functional peptide are added to the target protein, preferably the amino acids of the functional peptide replace a portion of the target protein into which it is introduced.
The hybrid molecule is used as a dual specificity antigen to generate a dual specificity antibody for IL-1a and IL-1β, it can be constructed such that a functional peptide corresponding to a specific structural element either IL-1a or IL-1β is introduced to full-length IL-1β or IL-1a at an equivalent structural position. The selected hybrid molecule replaces IL-1 β residues 160-176 with IL-1a residues 168-184. The resulting molecule has the following amino acid sequence in which the substituted IL-1a sequence (residues 168-184) is underlined: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMGAYKSSKD DAKITVILGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYI STSQAENMPVFLGGTKGGQDITDFTMQFVSS (SEQ ID NO: 4)
Said molecule can be produced by standard molecular biology methods (e.g. cloning, PCR technique), using publicly available IL-1a and IL-1β cDNA sequences, and using recombinant protein expression techniques. A hybrid cDNA can be obtained by introducing the cDNA into a useful expression vector and then expressing the polypeptide by introducing an expression vector into a useful host cell.
D. Peptides based on the technique of hydrophobicity plotting
The dual specificity antigen may be selected based on the hydrophobicity plotting technique and the selection of presumably highly antigenic peptides. For example, the antigenicity index of the peptides can be calculated using the program prepared by Jameson and Wolf (CABIOS 4 (1): 181-186, 1988). Regions useful for binding the antibodies can be selected thereby maximizing the likelihood of antigenicity.
E. Immunization with antigen-transfected cells
The dual specificity antibody may be obtained by immunization with antigen-transfected cells (i.e., the dual specificity antigens of the invention may be antigen-transfected cells). A cell line that stably expresses two different but structurally related antigens, or a hybrid molecule can be created. For example, cell lines that stably express IL-1a or IL-1β or the IL-1α / IL-1β hybrid molecule (e.g. SEQ ID No. 4). The desired molecules can be secreted from said cells (in the case of soluble proteins) or they can be expressed on the surface of the cells (in the case of receptors or enzymes). Delivery of the gene into the host cell to allow expression of the antigen by the host cell can be accomplished in a number of ways, including, but not limited to, transfection, electroporation, cell fusion, lipofection, particle bombardment, microinjection, or viral infection. Cell lines that stably express the antigen can be transplanted in a variety of ways (intraperitoneal, subcutaneous, intramuscular, or the like) into the desired animal to produce antibodies. Cells can provide a slowly released antigen. Preferably, the cells express the full-length protein. However, antigenic fragments can also be expressed. In the case of soluble proteins, the proteins are preferably secreted from the cells. In order to generate dual specificity antibodies for the extracellular domains of two closely related receptors, the receptors should be preferentially expressed on the cell surface.
PL 208 069 B1
F. Immunization with one of the structurally related molecules
A dual specificity antigen may simply be one of two different but structurally related molecules for which dual specificity antibodies are produced. One of the two related molecules is used as the immunizing agent, and the antibody repertoire generated is then screened for antibodies that bind, and more preferably neutralize, both of the two different but structurally related molecules. For example, one can immunize either IL-1a or IL-1β and then screen for α / β binding antibodies, and more preferably, α / β neutralizing antibodies. The term "immunization" as used herein means the exposure of an antibody repertoire to an antigen, such as IL-1a or IL-1β, in vivo or in vitro. Thus, this form comprises immunizing the animal with either IL-1a or IL-1β and screening for the resulting antibodies to select for antibodies binding to both IL-1a and IL-1β, as well as screening an in vitro recombinant antibody library with IL-1a or IL-1a. -1β and then selecting for recombinant antibodies that bind to both IL-1a and IL-1β.
II. Methods for Generating Dual Specificity Antibodies
To produce the dual specificity antibody of the invention, the antibody repertoire (in vivo or in vitro) is exposed to the dual specificity antigen obtained as above, and a useful dual specificity antibody is selected from said repertoire. Antigen recognition consists of two components: structural recognition and affinity maturation based on specific molecular interactions. During a natural immune response, low affinity antibodies recognizing structural motifs (e.g., antigen recognition by receptors that recognize certain structural patterns) are readily formed and early in the immune response, followed by an increase in the affinity of some clones by somatic mutations. A variety of in vivo and in vitro processes have been designed to mimic this natural phenomenon. Dual specificity, low affinity antibodies can be generated both in vivo and in vitro by the methods described above, and dual specificity, high affinity monoclonal antibodies can be obtained by somatic mutagenesis described herein. In addition, the structures of co-crystallized monoclonal antibodies with useful antigens can be analyzed to optimize monoclonal antibodies with dual, high specificity / dual specificity, and high affinity. The resulting structural information can then be used to enhance the affinity by altering (mutating) the residues of the monoclonal antibodies specifically interacting with the antigen to enhance the specific interactions of the molecules as described.
Methods for making dual specificity antibodies using in vivo, in vitro, or a combination of both methods are described below.
A. In vivo methods
Standard in vivo methods for the preparation of antibodies include immunizing a useful animal with an antigen, thereby exposing the antibody repertoire in vivo to the antigen, and then recovering the specific antibody or antibodies from the animal. Such a method can be adapted to obtain dual specificity antibodies by using a dual specificity antigen and then selecting the antibodies for specific recognition of structurally related molecules. Dual specificity antibodies can be obtained by immunizing a useful animal (e.g. a mouse, rabbit or goat or other mammal, including transgenic or knockout mammals) with an immunogenic dual specificity antigen composition. A useful immunogenic composition can include, for example, a chemically synthesized or recombinantly expressed dual specificity antigen. The composition may further include an adjuvant such as Freund's complete or incomplete adjuvant, or a similar immunostimulatory component. Furthermore, the dual specificity antigen of the invention is used alone or more preferably as a conjugate with a carrier protein for the production of antibodies, in particular by an in vivo immunization technique. Such a method used to increase the immune response is well known to those skilled in the art. Examples of useful carrier proteins to which a dual specificity antigen can be linked include KLH haemocyanin and albumin.
Antibody-producing cells can be obtained from an animal and then used to obtain monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975, Nature, 256: 495-497) (see also Brown et al.
PL 208 069 B1 (1981) J Immunol 127: 539-46; Brown et al (1980) J Biol Chem 255: 4980-83; Yeh et al (1976) PNAS 76: 2927-31; Yeh et al (1982) Int J Cancer 29: 269-75). The technology of producing monoclonal antibodies using hybridomas is well known (see RH Kenneth, Monoclonal antibodies: A new dimension in biological analyzes, Plenum Publ Corp, NY (1980); EA Lerner (1981) Yale J Biol Med 54: 387-402; ML Grefter (1977) Somatic Cell Genet 3: 231-36). Briefly: an immortalized cell line (usually myeloma cells) is fused to lymphocytes (thymic or lymph node or peripheral) from an animal immunized with a dual specificity antigen as described above, and then the cell culture supernatant of the produced hybridomas is screened for the presence of dual specificity antibodies to two different but structurally related molecules in order to detect the hybridomas producing them. Any experimental protocol that results in the generation of hybridomas producing monoclonal antibodies with dual specificity can be used to assemble lymphocytes and an immortalized cell line (see, e.g., G Galfre et al (1977) Nature 266: 550-52; Gefter et al. Somatic Cell Genet, loc. Cit .; Lerner Yale J Biol Med op. Cit .; Kenneth, Monoclonal Antibodies, loc. Cit.). Moreover, those skilled in the art are familiar with useful variations of the methods described above. Typically, the immortalized cell line (e.g., myeloma cell line) is derived from the same type of animal from which the lymphocytes are derived. For example, mouse hybridomas can be generated by fusing lymphocytes from mice immunized with a composition of the invention with an immortalized mouse cell line. A preferred immortalized murine cell line is murine myeloma cells that are sensitive to the presence of hypoxanthine, aminopterin, and thymidine in the culture medium (HAT medium). Any myeloma cell line may be used in the fusion process using standard methods (e.g., using the P3-NS1 / 1-Ag4-1, P3-x63-Ag8.653 or Sp2 / O-Ag14 lineage). Said myeloma cell lines can be obtained from the American Type Culture Collection (ATCC) Rockville, MD. Typically, murine myeloma cells sensitive to HAT are fused to murine thymic cells using polyethylene glycol (PEG). The resulting hybridomas are selected on the HAT medium, in which cells that do not combine or are inappropriately attached to myeloma die (thymus cells die after a few days because they have not been transformed). Hybridoma cells producing monoclonal antibodies specifically recognizing two structurally related molecules of interest of the invention can be identified by screening the hybridoma cell culture supernatant for the production of such antibodies using, e.g., a standard ELISA assay to select for antibodies specifically binding the two related molecules.
Various animal organisms may be used for in vivo immunization depending on the type of antibody desired. An animal organism that by itself produces an endogenous version of the desired antigen (s) or, alternatively, the host may be unable to produce an endogenous version of the desired antigen (s). For example, it has been shown that mice that do not produce certain endogenous proteins (knockout mice, e.g. as a result of homologous recombination to quench the activity of an endogenous gene), they develop humoral immunity to the mentioned, after immunization with the said protein, and can therefore be used for the production of high affinity monoclonal antibodies directed against the said protein (cf. e.g. Roes J et al (1995) J Immunol Methods 183, 231-237; Lunn MP et al (2000) J Neurochem 75, 404-412).
For the production of non-human antibodies (e.g., against a dual specificity human antigen), a wide variety of non-human mammalian organisms may be used as useful hosts for producing the antibody, including, but not limited to, mice, rats, rabbits and goats (or knockout versions of said organisms), although mice are the organisms of choice for hybridoma production. In addition, most animals that express the human antibody repertoire, including transgenic animals (e.g., mice) transgenized with human immunoglobulin, huPBMC-SCID chimeric mice, and human-mouse radiation chimeras, can be used to produce fully human antibodies to a dual specificity human antigen. as will be discussed below.
Thus, in one embodiment, the animal immunized with a dual specificity antigen is preferably a mouse that is transgenic for the gene encoding a human immunoglobulin such that it produces human antibodies upon antigen stimulation. In such an animal, human genes encoding light and heavy chains of immunoglobulins in a fetal configuration are usually introduced, wherein the endogenous loci of that animal encoding the light and heavy chains of immunoglobulins are inactive. After
Antibodies derived from said human immunoglobulin sequences (i.e. human antibodies) are produced after stimulation with an antigen (e.g., human antigen), and human monoclonal antibodies can be obtained from lymphocytes of such an animal by standard hybridoma production techniques. A further description of the human immunoglobulin transgene transgenic mouse and the use of said animal for the production of human antibodies can be found e.g. US Patent No. 5,939,598, PCT Publication No. WO 96/33735, PCT Publication No. WO 96/34096, PCT Publication No. WO 98/24893, PCT Publication No. WO 99/53049 Abgenix Inc; U.S. Patent No. 5,545,806, No. 5,569,825, No. 5,625,126, No. 5,633,425, No. 5,661,016, No. 5,770,429, No. 5,814,318, No. 5,877,397 and PCT Publication No. WO 99/45962 Genopharm Inc, and MacQuitty JJ, Kay RM (1992) Science 257: 1188; Taylor LD et al (1992) NAR 20: 6287-95; Lonberg N et al (1994) Nature 368: 856-59; Lonberg N and Huszar D (1995) Int Rev Immunol 13: 65-93; Harding FA and Lonberg N (1995) Ann NY Acad Sci 764: 536-46; Fishwild DM et al (1996) Nature Biotechnol 14: 845-51; Mendez MJ et al (1997) Nature Genet 15: 146-156; Green LL and Jakobovits A (1998) J Exp Med 188: 483-95; Green LL (1999) J Immunol Methods 231: 11-23; Yang XD et al (1999) J Leukoc Biol 66: 401-410; Galio ML et al (2000) Eur J Immunol 30: 543-40,
The animal immunized with the dual specificity antigen may be a SCID mouse, reconstituted with human peripheral mononuclear cells or lymphoid cells or their precursors. Said chimeric mouse, abbreviated hu-PBMC-SCID, produces human immunoglobulins in response to antigen stimulation. For a further description of said mouse and the production of the antibody, see e.g. Leader KA et al (1992) Immunology 76: 229-234; Bombil F et al (1996) Immunobiol 195: 360-75; Murphy WJ et al (1996) Semin Immunol 8: 233-41; Herz U et al (1997) Int Arch Allergy Immunol 113: 150-152; Albert SE et al. (1997) J Immunol 159: 1393-1403; Nguyen H et al (1997) Microbiol Immunol 41: 901-907; Arai K et al (1998) J Immunol Methods 217: 79-85; Yoshinari K and Arai K (1998) Hybridoma 17: 41-45; Hutchins WA et al (1999) Hybridoma 18: 121-129; Murphy WJ et al (1999) Clin Immunol 90: 22-27; Smithson SL et al (1999) Mol Immunol 36: 113-124; Charmat S et al (1999) J Infect Diseases 180: 268-277; Heard C et al (1999) Molec Med 5: 35-45.
The animal immunized with the dual specificity antigen can be a mouse treated with a lethal dose of radiation followed by transplantation of SCID mouse bone marrow cells followed by transplantation of functional human lymphocytes. This type of chimeric animal, referred to as the Trimer System, is used to produce human monoclonal antibodies by immunizing said mouse with the desired antigen and then obtaining the monoclonal antibodies using standard hybridoma techniques. Further details can be found e.g. in: Eren R et al (1998) Immunol 93: 154-161; Reisner Y and Dagan S (1998) Trends Biotechnol 16: 242-246; Ilan E et al (1999) Hepatology 29: 553-562; Bocher WO et al (1999) Immunology 96: 634-641.
B. In vitro methods
An alternative to generating dual specificity antibodies by in vivo immunization and selection is to screen recombinant combinatorial immunoglobulin libraries (e.g., phage antibody libraries) with a dual specificity antigen to isolate library members that specifically bind two different but structurally related molecules of interest. . Reagent kits for creating and screening phage libraries are commercially available (e.g., Recombinant Phage Antibody System, Pharmacia Cat # 27-9400-01; SurfZAP (tm) Phage Display Kit, Stratagene Cat # 240612). In various embodiments, the phage library is an scFv or Fab library. The phage display technique for screening recombinant antibody libraries is fully described in the literature. Examples of methods and compounds particularly useful for generating and screening antibody libraries can be found, e.g. : McCafferty et al. International Publication No. WO 92/01047, US Patent No. 5,969,108 and EP 589,877 (in particular for scFv libraries), Landner et al. US Patent No. 5,223,409, No. 5,403,484, No. 5,571,698, No. 5,837,500 and EP 436,597 (for example for fusions FpIII); Dower et al. International Publication No. WO 91/17271, US Patent No. 5,427,908, US Patent No. 5,580,717 and EP 527,839 (particularly for Fab); Winter et al. International Publication WO 92/20791 and EP 368,684 (particularly disclosure of immunoglobulin variable region cloning); Griffith et al. US Patent No. 5,885,793 and EP 589,877 (describing in particular the isolation of human antibodies against human antigens using recombinant libraries); Garrard et al. International Publication No. WO 92/09690 (describing in particular phage expression techniques); Knappik et al. International Publication No. WO
PL 208 069 B1
97/08320 (describing a library of human recombinant HuCal antibodies); Salfeld et al. Publication
International No. WO 97/29131 (preparation of a recombinant human anti-human antibody (human TNFα) as well as the in vitro maturation of recombinant antibody affinity) and Salfeld et al. US Provisional Application No. 60 / 126,603 (also describing the production of a human recombinant anti-human antibody). antigen (human IL-12) as well as in vitro maturation of recombinant antibody affinity).
Other descriptions of screening a recombinant antibody library can be found in scientific publications such as: Fuch et al (1991) Bio / Technology 9: 1370-72; Hay et al (1992) Hum Antibod Hybridomas 3: 81-85; Huse et al (1992) Science 246: 1275-1281; Griffith et al (1993) EMBO J 12: 725-734; Hawkins et al (1992) J Mol Biol 226: 889-896; Clarkson et al (1991) Nature 352: 624628; Gram et al (1992) PNAS 89: 3576-3580; Garrad et al (1991) Bio / Technology 9: 1373-1377; Hoogenboom et al (1991) NAR 19: 4133-4137; Barbas et al (1991) PNAS 88: 7978-7982; McCafferty et al (1990) Nature 348: 552-554; Knappik et al (2000) J Mol Biol 296, 57-86.
An alternative to the bacteriophage system is to express a library of recombinant antibodies on the surface of a yeast or bacterial cell. Methods for obtaining and screening antibody libraries expressed on the surface of a yeast cell are described in PCT Publication WO 99/36569. Methods for obtaining and screening antibody libraries expressed on the surface of a bacterial cell are described in PCT Publication WO 98/49286.
Once the desired antibody has been identified within a combinatorial library, DNA encoding the antibody light and heavy chains is isolated by standard molecular biology techniques, such as PCR amplification from a selected library site (e.g., phage). The nucleotide sequences of the light and heavy chain genes into which PCR primers can be generated are known to those skilled in the art. For example, many such sequences are disclosed in: Kabat EA et al (1991) Sequences of proteins of immunological interest, Vth Ed US Dept of Health & Human Services, NIH Publ No. 91-3242, and the Vbase database of human fetal sequences.
The antibody, or antibody portion, of the invention can be obtained by expressing recombinant genes encoding the light and heavy chains of an immunoglobulin in a host cell. To recombinantly express an antibody, a host cell is transfected with one or more recombinant expression vectors carrying DNA fragments encoding the antibody light and heavy chains such that the light and heavy chains are expressed in the host cell, preferably, are secreted into the culture medium in which it grows. a host cell from which medium the antibody can be recovered. Standard recombinant DNA techniques such as those set out in Sambrook, Fritsch, and Maniatis (ed.) Molecular cloning: a laboratory manual can be used to obtain genes encoding the light and heavy chain of antibodies, to integrate the genes into an expression vector, and to introduce said vectors into a host cell. CSH 2nd ed., NY (1989), Ausubel FM (ed.) Current protocols in molecular biology, Greene Publ Ass (1989) and US Patent No. 4,816,397 (Bross et al).
Once the DNA fragments encoding the VH and VL segments of the desired antibody are obtained, said DNA fragments can be further manipulated using standard recombinant DNA techniques, for example by converting the variable region of the genes into full-length antibody chain genes, into a Fab fragment, or into a scFv gene. In these manipulations, DNA fragments encoding VL and VH are operably linked to other DNA fragments encoding another protein, such as an antibody constant region or linker. The term "operably linked" as used herein indicates that two DNA fragments are joined in such a way that the amino acid sequences encoded by said two DNA fragments form the reading frame.
The isolated DNA encoding the VH region can be converted into a full-length heavy chain gene by operably linking the DNA encoding the VH region with another DNA molecule encoding heavy chain constant regions (CH1, CH2, and CH3). The sequences of the genes encoding human heavy chain constant regions are known to those of skill in the art (see e.g. Kabat EA (1991) Sequences of proteins of immunological interest, Vth Ed US Dept of Health & Human Services, NIH Publ No. 91-3242) and DNA fragments covering said regions can be obtained using standard PCR technique. The heavy chain constant region can be derived from an IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM, or IgD constant region, but makes use of an IgG1 or IgG4 constant region. In the case of a heavy chain Fab fragment, the DNA encoding the VH may be operably linked to another DNA molecule encoding the heavy chain CH1 constant region.
PL 208 069 B1
The isolated DNA encoding the VL region can be converted to a full length gene encoding a light chain (as well as a light chain Fab fragment gene) by operably linking the VL encoding DNA fragment to another DNA molecule encoding the light chain CL constant region. The light chain constant region gene sequences are known to those of skill in the art (e.g., Kabat EA (1991) Sequences of proteins of immunological interest, ed. 5, US Dept of Health & Human Services, NIH Publ No. 91-3242) and DNA fragments including said regions can be obtained using standard amplification (PCR) techniques. The light chain constant regions can be kappa or lambda constant regions, but preferably a kappa constant region.
In order to construct the scFv gene, the DNA fragments encoding VH and VL are operably linked to another fragment encoding a mobile linker, e.g. encoding an amino acid sequence (Gly4-Ser) 3, such that the VH and VL sequences can be expressed as contiguous. single chain protein, with VL and VH regions connected by a mobile linker (see e.g. Bird et al (1988) Science 242: 423-426; Suston et al (1988) PNAS 85, 5879-5883; McCafferty et al (1990) Nature 348, 552-554).
In order to express the recombinant antibodies or antibody portions of the invention, DNA encoding a portion of the sequence or the full length heavy and light chain obtained as outlined above may be inserted into an expression vector such that the genes are operably linked to regulatory sequences specific to the processes. transcription and translation. In this context, the term "operably linked" means that the antibody gene is linked to a vector sequence such that the transcriptional and translational regulatory sequences from the vector serve as the transcriptional and translational regulatory sequences of the inserted gene. The expression vector and said regulatory sequences have been chosen to be compatible with the host cell. The antibody light chain gene and the antibody heavy chain gene may be inserted into separate vectors, or, most often, both are inserted into the same expression vector. The antibody genes are inserted into the expression vector by standard methods (e.g., by ligation using the complementary restriction sites of the vector and the antibody gene, or by blunt end ligation in the absence of useful restriction sites). Prior to introducing the heavy and light chain sequences, the expression vector may carry an antibody constant region encoding sequence. For example, one way to convert VH and VL sequences into full-length antibody genes is to insert the sequences into an expression vector encoding the heavy chain constant region and the light chain constant region, respectively, such that the VH segments are operably linked to the segment ( -ami) CH within the vector, and the VL segment is operably linked to the CL segment within the vector. Additionally or alternatively, the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell. The antibody chain gene may be cloned into the vector such that the signal peptide is linked in-frame to the N-terminus of the antibody chain gene. The signal peptide may be an immunoglobulin specific signal peptide or a heterologous signal peptide (ie, a signal peptide from a non-immunoglobulin protein).
In addition to the antibody chain genes, the recombinant expression vectors of the invention can carry regulatory sequences that control the expression of the antibody chain genes in the host cells. The term "regulatory sequences" includes promoters, enhancers, and other regulatory elements that control expression (eg, polyadenylation signals) that control the transcription or translation of the antibody chain genes. These regulatory sequences are described, for example, in Goeddel, Gene expression technology: Methods Enzymol 185, Acad Press, San Diego (1990). Those skilled in the art know that the design of an expression vector comprising regulatory sequences may depend on factors such as the choice of the host cell, the level of expression of the desired protein, etc. Preferred regulatory sequences inherent in mammalian cells include viral sequences which increase the level of protein expression in mammalian cells, such as CMV-derived promoters and / or enhancers (such as the CMV promoter / enhancer), SV40 (such as the SV40 promoter / enhancer), adenovirus (e.g. AdMLP late promoter) and polyoma virus. For a further description of the regulatory elements derived from viruses and their sequences, see e.g. U.S. Patent No. 5,168,062, Stinski; U.S. Patent No. 4,510,245, Bell et al; U.S. Patent No. 4,968,615 Schaffner et al.
In addition to the antibody chain genes and regulatory sequences, the recombinant expression vector of the invention may have additional sequences, such as
To regulate the replication of the vector in the host cell (e.g., ori) and selectable marker genes. Selectable marker genes enable the selection of host cells into which said vector has been introduced (cf. e.g. US Patent No. 4,399,216; 4,634,665; 5,179,017 Axel et al). For example, genes conferring on a host cell into which the vector has been introduced resistance to drugs of the type G418, hygromycin, or methotrexate are typical selectable markers. Preferred selectable marker genomes include the DHFR (folate reductase) gene (used in dhfr cells).<sup>-</sup> for methotrexate selection / amplification) and the neo gene (for G418 selection).
For expression of the light and heavy chains, an expression vector (s) encoding the light and heavy chains is transfected into a host cell by standard techniques. The term "transfection" encompasses a wide variety of techniques commonly used to introduce exogenous DNA into prokaryotic or eukaryotic host cells, e.g., electroporation, the calcium method, the use of DEAE-dextran, and similar methods. While it is theoretically possible to express an antibody of the invention in both a prokaryotic and a eukaryotic cell, it is preferable to express said antibody in a eukaryotic cell, most preferably in a mammalian cell, since it is more likely to be expressed in specific eukaryotic cells compared to a eukaryotic cell. prokaryotic is the proper folding and secretion of the protein in a biologically active form. Expression of the antibody encoding genes in a prokaryotic cell may be ineffective when large amounts of active antibody are required (Boss MA and Wood CR (1985) Immunol Today 6: 12-13).
Preferred mammalian cells useful for expressing the recombinant antibodies of the invention are CHO cells (including CHO dhfr cells).<sup>-</sup>, described by Urlaub and Chasin (1980) PNAS 77: 4216-20, using the DHFR selection marker e.g. as described in the article by RJ Kaufman and PA Sharp (1982) Mol Biol 159: 601-621), NS0 cells, COS cells , SP2 cells. When a recombinant expression vector comprising the antibody genes is introduced into a mammalian host cell, antibodies are produced by culturing the host cells for a time long enough for the antibody to be expressed in the host cell, or more preferably for secretion of the antibody into the culture medium in which the host cells grow. Antibodies can be recovered from the culture medium using standard protein purification methods.
The host cell can also be used to produce portions of a whole antibody, such as a Fab fragment or an scFv molecule. It is understood that variations on the above-described procedure may be used within the scope of the invention. For example, it may be desirable to transfect a host cell with DNA encoding either the light chain or the heavy chain (but not both) of an antibody of the invention. Recombinant DNA technology can also be used to remove some or all of the DNA encoding either the light or heavy chain that is not necessary for binding the desired antigen. Protein molecules expressed based on such hull DNA molecules are also antibodies of the invention. In addition, by conjugating an antibody of the invention to a second antibody using standard chemical conjugation techniques, dual function antibodies can be produced in which one light chain or one heavy chain specifically recognizes an antigen other than the desired antigen.
A preferred system for the recombinant expression of an antibody or antigen-binding portion of an antibody of the invention is a recombinant expression vector encoding both the light chain and the heavy chain of an antibody, introduced into dhfr CHO cells.<sup>-</sup> by calcium transfection. Within the recombinant expression vector, the genes encoding the light and heavy chains of the antibody are operably linked to the CMV enhancer / AdMLP promoter in order to obtain high transcription efficiency of the genes mentioned. The recombinant expression vector may also include the DHFR gene which enables the selection and amplification of vector-transfected CHO cells using methotrexate. Selected transfectants are grown to ensure the expression of the antibody light and heavy chains, and to recover the whole antibody from the culture medium. Standard molecular biology techniques are used to create the recombinant expression vector, transfect the host cells, select transfectants, culture the host cells, and recover the antibody from the culture medium. The invention further provides a method of synthesizing a recombinant antibody according to the invention by culturing a host cell according to the invention in a suitable culture medium until the antibody according to the invention is produced. The method further comprises isolating the recombinant antibody from the culture medium.
PL 208 069 B1
In addition to screening recombinant antibody phage libraries, other methods known to those skilled in the art can be used to screen large combinatorial libraries to identify dual specificity antibodies of the invention. One type of alternative expression system is a system in which a recombinant antibody library is produced by expressing RNA-protein fusants as described in PCT Publication No. WO 98/31700 Szostak and Roberts, and Roberts RW and Szostak JW (1997) PNAS 94: 12297-12302. Said system creates a covalent fusant of the 3 'end of the mRNA and a peptide or protein resulting from the in vitro translation of a synthetic mRNA encoding puromycin, an antibiotic that binds to a peptidyl site. In this way, it is possible to enrich the mRNA library with specific fractions (e.g. from a combinatorial library) based on the properties of the encoded protein or peptide (e.g. antibody, portions thereof), such as binding of the antibody or portions thereof to a dual specificity antigen. Nucleotide sequences encoding the antibody, or a portion thereof, can be recovered by screening said libraries and expressed by recombinant means as set forth above (e.g. in mammalian host cells) and furthermore may be subjected to further affinity maturation by an additional round of mRNA-peptidyl fusant screening which introduces additional mutations to the originally selected sequences or by using other in vitro recombinant antibody affinity maturation methods as described above.
C. Combined methods
Dual specificity antibodies can be obtained using a combination of in vivo and in vitro methods, such as methods in which a dual specificity antigen interacts with an in vivo antibody repertoire in a host animal to stimulate the production of dual specificity antigen binding antibodies. but where the further steps of selecting and / or maturation of the antibody (ie, improving the specificity) are accomplished using one or more in vitro techniques.
Said combination of methods may include the initial immunization of the animal organism (e.g. mouse, rabbit, rat, goat or the transgenic version of said organisms or chimeric mice) using a dual specificity antigen to induce the stimulation of an immune response against said antigen, and then obtaining and searching for a phage library using immunoglobulin sequences from lymphocytes stimulated in vivo by exposure to a dual specificity antigen. The first step of said combined process may be performed as set out in IIA above, and the second step of said combined process may be performed as set out in IIB above. Preferred methods for hyperimmunizing animals and screening in vitro phage libraries obtained from stimulated lymphocytes include the method given by BioSite Inc, e.g., PCT Publication WO 98/47343, PCT Publication WO 91/17271, US Patent No. 5,427,908 and US Patent No. 5,580,717.
The combined method may involve the initial immunization of an animal organism (e.g., a mouse, rabbit, rat, goat, or a knockout and / or transgenic version of said organisms, or a chimeric mouse) with a dual specificity antigen to induce a stimulation of an immune response against said antigen, followed by selecting lymphocytes to produce antibodies with the desired dual specificity (e.g. by viewing hybridomas obtained from an immunized animal). The rearranged antibody genes from the selected clones are then isolated using standard molecular biology methods such as RT-PCR and subjected to in vitro affinity maturation to increase the binding capacity of the selected antibody or antibodies. The first step of said procedure can be performed as described in IIA above, while the second step can be performed as described in IIB above, in particular using the in vitro affinity maturation method described e.g. in PCT Publication WO 97/29131 and PCT Publication WO 00/56772.
In another method, recombinant antibodies are prepared from single, isolated lymphocytes using a procedure referred to in the literature as the "selected lymphocyte antibody method" (SLAM), as described in US Patent No. 5,627,052, PCT Publication WO 92/02551 and Babcock JS and et al (1996) PNAS 93: 7843-7848. In this method, when applied to the dual specificity antibodies of the invention, an animal (e.g. a mouse, rat, rabbit, goat or a transgenic version of said animals or a chimeric mouse) is first immunized in vivo with a dual specificity antigen to elicit an immune response against said antigen and then selecting for single fire secreting cells16
A given antibody, e.g., specific for a dual specificity antigen in an antigen-dependent platelet haemolysis assay (e.g., a dual specificity antigen or structurally related molecules of interest are coupled to sheep erythrocytes using a linker such as biotin, which allows identification. in a platelet haemolysis test, a single cell secreting antibodies with a defined specificity). Once the cells secreting the desired antibody have been identified, cDNA encoding the variable regions of the light and heavy chains is obtained from the cells by RT-PCR, and said variable regions are then expressed in association with appropriate immunoglobulin constant regions (e.g., human constant regions) in such mammalian cells. like COS or CHO. Host cells transfected with amplified immunoglobulin sequences derived from selected in vivo lymphocytes can be further analyzed and selected in vitro, for example by isolating cells expressing dual specificity antibodies from the transfectants using antigen-coated plates. The amplified immunoglobulin sequences may be further manipulated in vitro, such as the in vitro affinity maturation described above.
The combined method of producing a dual specificity antibody may also include the following steps. First, the animal is immunized to elicit an immune response, the first antigen, and the second animal is immunized with a second, different antigen, preferably the second antigen is structurally similar to the first antigen. A recombinant heavy chain library and a recombinant light chain library are then constructed using antibody genes obtained from the first animal and the second animal as described in IIB. A heavy chain library from said first antigen immunized animal is combined with a light chain library obtained from said second animal immunized with second antigen to form an X antigen library. Similarly, a heavy chain library from said animal immunized with a second antigen is combined with a light chain library obtained from said first animal immunized with a first antigen to form a Y antigen library. Additionally, the X and Y libraries can be linked to form an XY library. Dual specificity antibodies that bind to both first and second antigens can be identified and isolated from X, Y and / or XY libraries.
III. Characterization of dual specificity antibodies
The invention provides a method of obtaining dual specificity antibodies as well as portions of said antibodies. The antibodies or portions thereof may be isolated antibodies. The antibodies or portions thereof may be neutralizing antibodies. The antibodies can include monoclonal and recombinant antibodies and parts thereof. The antibodies or portions thereof can include amino acid sequences derived entirely from a single species, such as a fully human or all-murine antibody, or parts thereof. The antibody or portion thereof may also be a chimeric antibody or chimeric antibody-CDR or other form of a humanized antibody.
The term "antibody" as used herein means immunoglobulin molecules consisting of four polypeptide chains, two heavy (H) chains, and two light (L) chains interconnected by disulfide bonds. Each heavy chain consists of a heavy chain variable region (HCVR or VH) and a heavy chain constant region. The heavy chain constant region is composed of the three domains CH1, CH2, and CH3. Each light chain consists of a light chain variable region (LCVR or VL) and a light chain constant region. The light chain constant region consists of one CL domain. The VH and VL regions can be subdivided into supernatant regions, also referred to as complementarity determining regions (CDRs), scattered among more conserved regions, referred to as framework regions (FR). Each VH and VL region consists of three CDRs and four FRs arranged from the N terminus to the C terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
The term "antigen-binding portion" of an antibody (or "antibody portion") denotes one or more dual specificity antibody fragments that retain the ability to specifically bind two different but structurally related antigens. It has been shown that the antigen-binding function of the antibody can be performed by full-length antibody fragments. Examples of binding fragments encompassed by the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a single-binding fragment consisting of the VL, VH, CL, and CH domains; (ii) a F (ab ') 2 fragment which is a binder fragment consisting of two Fab fragments linked by a disulfide bridge at the hinge region; (iii) the Fd fragment consisting of the VH and CH1 domains; (iv) fragment Fv
PL 208 069 B1 comprising the VL and VH domains of a single arm of an antibody; (v) a dAb fragment consisting of VH domains (Ward et al (1989) Nature 341, 544-546); (vi) an isolated complementarity determining region (CDR). Moreover, although the two domains of the Fv fragment (VL and VH) are encoded by separate genes, they can be linked by recombinant DNA techniques using a synthetic linker whereby they form a single polypeptide chain in which the said VH and VL regions form a single-linking molecule. (single chain FV, scFv; see: Bird et al (1988) Science 242, 423-426, Huston et al (1988) PNAS 85, 5879-5883). Such single chain antibodies also include the aforementioned term "antigen-binding portion" of an antibody. The term mentioned also includes other types of single chain antibodies such as "diabodies". Dipantibodies are bi-binding, bispecific antibodies in which the VH and VL domains are expressed as a single chain, using a linker that is too short, however, to pair the two domains of the same chain, forcing the complementary domains of another chain to pair and thereby create two sites antigen binding (see Holliger P et al. (1993) PNAS 90, 6444-6448; Poljak RJ et al (1994) Structure 2: 1121-1123).
Further, the antibody or antibody binding portion can be part of a larger immunoadhesive molecule that is formed by covalently or non-covalently joining the antibody or antibody portion with one or more proteins or peptides. Examples of said immunoadhesive molecules include the use of the streptavidin core region to obtain an scFv tetramer molecule (Kipriyanow SM et al (1995) Human Antibodies and Hybridomas 6: 93-101) and the use of cystine residues, a marker peptide and a histidine tag at the C-terminus to obtain bibonders. and biotinylated scFv molecules (Kipriyanow SM et al (1994) Mol Immunol 31, 1047-1058). Antibody portions such as Fab and F (ab ') 2 portions can be obtained from whole antibodies using conventional techniques such as papain or pepsin digestion of whole antibodies. In addition, antibodies, antibody portions, and immunoadhesive molecules can be obtained by standard recombinant DNA techniques.
The term "dual specificity isolated antibody" herein means an antibody with dual specificity substantially free of other antibodies having specificity for other antigens (e.g., an isolated antibody that specifically binds two different but structurally related antigens or a structurally related region of otherwise unrelated antigens that is substantially free of antibodies that specifically bind to other, unrelated antigens). Moreover, an isolated dual specificity antibody may be substantially free of other cellular substances and / or chemicals.
The term "neutralizing antibody" as used herein means an antibody whose association with a particular antigen results in the inhibition of the biological activity of the antigen. Inhibition of the biological activity of an antigen can be assessed by measuring one or more indicators of the biological activity of the antigen using a useful in vivo or in vitro assay.
The term "monoclonal antibody": herein means an antibody derived from a hybridoma (eg, an antibody secreted by hybridoma obtained by hybridoma technology such as standard Kohler-Milstein hybridoma production technique). Thus, an antibody of the invention having dual specificity obtained from a hybridoma is referred to as a monoclonal antibody, although it recognizes more than one single antigen.
The term "recombinant antibody" means antibodies obtained, expressed, generated, or isolated by recombinant techniques, such as an antibody expression system using an expression vector transfected into a host cell, antibodies isolated from a recombinant antibody combinatorial library, antibodies isolated from a transgenic animal (e.g., mouse) for human immunoglobulin genes (see e.g. Taylor LD et al (1992) NAR 20: 6287-95) or antibodies obtained, expressed, or produced by other methods involving the splicing of specific immunoglobulin genes (such as human immunoglobulin gene sequences) with other DNA sequences. Examples of recombinant antibodies include chimeric antibodies, CDR chimeras, and humanized antibodies.
The term "human antibody" means antibodies having constant and variable regions corresponding to or derived from human fetal immunoglobulin sequences as described, e.g., in Kabat et al (see Kabat et al (1991) Sequences of Proteins of Immunological Interests, Vth Ed. US Dept of Health and Human Services, NIH Publ. No. 91-3242). Human antibodies of the invention can also include amino acid residues not present in human fetal immunoglobulin gene sequences (e.g. in the form of mutations introduced into random sites or
By means of in vitro directed mutagenesis or in vivo somatic mutations), for example in the CDR regions or in particular in the CDR3 region.
The recombinant human antibodies of the invention have variable regions and may further include constant regions derived from human fetal immunoglobulin sequences (see: Kabat et al. (1991) Sequences of Proteins of Immunological Interests, Vth Ed. US Dept of Health and Human Services, NIH Publ. no. 91-3242). Recombinant human antibodies can be mutagenized in vitro (or, when an animal transgenic for human Ig sequences is used, somatic mutagenesis in vivo) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences derived from human fetal VH and VL sequences which they may not naturally occur in the in vitro fetal repertoire of human antibodies. In specific embodiments, said recombinant alpha antibodies are produced by selective mutagenesis, reverse mutagenesis, or both.
The term "backmutation" refers to the process by which some or all of the amino acids of somatically mutated human antibodies are replaced with appropriate residues from the homologous fetal antibody sequence. The human antibody light and heavy chain sequences of the invention are aligned with fetal sequences present in the VBASE database to identify the sequences with the highest homology. The differences in the sequence of the human antibody of the invention are then mutated to return to the fetal sequence by mutating the specific nucleotide positions corresponding to said amino acid residues. The role played in direct or indirect binding of the antigen by individual amino acid residues identified as candidate reverse mutagenesis residues should be determined and amino acid residues known to affect said binding should not be mutagenized. In order to reduce the number of reverse mutagenesis amino acid residues, it is necessary to identify as the target of mutagenesis those amino acid residues which are found to be different when compared to the closest fetal sequence, but identical to the corresponding amino acid residues in the second fetal sequence, assuming that the second fetal sequence is identical or collinear. with a human antibody sequence according to the invention over at least 10, preferably 12, amino acids, on both sides of the tested amino acid. Back-mutations can be made at any stage of antibody optimization.
The term "chimeric antibody" means an antibody comprising antibody light and heavy variable region sequences from one species and constant region sequences from another species, such as having mouse light and heavy chain variable regions fused to a human constant region.
The term "chimeric antibody-CDR" refers to antibodies comprising light and heavy chain variable region sequences from one species in which the sequences of one or more VH and / or VL CDRs have been replaced with CDR sequences from another species, such as antibodies having murine variable chain regions. light and heavy, in which one or more murine CDRs (e.g., CDR3) have been replaced with human CDR sequences.
The term "humanized antibody" refers to antibodies comprising light and heavy chain variable region sequences derived from an animal (e.g., a mouse) in which at least a portion of the VH and / or VL sequences have been altered to resemble human sequences, i.e., to more closely resemble human sequences. fetal variable regions. One type of humanized antibodies are chimeric antibodies-CDRs in which the human CDR sequences have been inserted within the animal VH and VL sequences to replace the animal CDR sequences.
One way to measure binding kinetics is to measure surface plasmon resonance. The term "surface plasmon resonance" as used herein refers to an optical phenomenon that allows real-time analysis of biospecific interactions by detecting changes in protein concentration within the biosensor matrix, for example using the BIAcore system (Pharmacia Biosensors AB). For further details see: Jonsson U et al (1993) Ann Biol Clin 51: 19-26; Jonsson U et al (1991) Biotechniques 11: 620-627; Johnsson B et al (1995) J Mol Recogn 8: 125-131, Johnsson B et al (1991) Anal Biochem 198: 268-277.
The term "Koff" as used below denotes the dissociation rate constant of the antibody from the antigen / antibody complex.
The term "Kd" as used below denotes the dissociation constant of the particular antigen-antibody complex.
PL 208 069 B1
The dual specificity antibodies obtained by the method of the invention are obtained by any of the methods described for obtaining the antibodies set forth in subsection II above. Dual specificity antibodies can be directed against essentially any structurally related antigens, although the dual specificity antibodies of the invention specifically bind IL-1a and IL-1β, and can be obtained using a dual specificity antigen as described in Examples 1 -4. Other structurally related antigens, including members of the caspase family, the cytokine family such as members of the IL-1 family (e.g. IL-1 / IL-18), members of the TNF family (e.g. TNFα / TNFβ), IL-6 family members, interferons, TGFβ family members, EGF family members, FGF family members, PDGF family members, VEGF family members, angiopoietin family members, members of the bone morphogenic protein family, extracellular proteinases (metalloproteinases), and members of the cytokine receptor family such as members of the IL-1 receptor family, members of the TNF receptor family, members of the TGFβ receptor family, members of the EGF receptor family, members of the FGF receptor family. members of the PDGF receptor family, members of the VEGF receptor family, members of the angiopoietin receptor family.
The dual specificity antibodies obtained by the method of the invention may have the same binding capacity for two different but structurally related antigens, the dual specificity antibodies obtained by the method of the invention may bind preferentially to one of the two aforementioned antigens, and still have dual specificity for structurally related antigens in compared with non-related antigens. The binding activity of said dual specificity antibodies to said structurally related antigens, as well as other non-structurally related antigens, can be measured in a standard in vitro assay such as ELISA or BIAcore. Preferably, the ratio of the Kd value of the antibody for structurally unrelated antigens to the Kd value of the antibody against structurally related antigens should be at least 3, more preferably at least 5, more preferably 10, even more preferably the ratio should be at least 50, 100, 200, 300. , 400, 500, 600, 700, 800, 900 or 1000.
The difference between nonspecific (background) binding and specific binding is in level or degree. For example, nonspecific binding is at a low level, e.g., when less than 5%, more preferably less than 3%, even more preferably about 0.1-1%, while specific cross-reactivity or dual specificity is at a higher level, e.g. greater than 1%, more preferably greater than 3%, even more preferably greater than 5%, and most preferably greater than 10%. Furthermore, the IC50 value of an antibody with dual specificity for a target antigen preferably approximates the ED50 value of the antigens in a given biotest.
The dual specificity antibody or antigen binding portion thereof obtained by the method of the invention is preferably selected such that it has favorable binding kinetic values (e.g. high affinity, low dissociation, low Koff value, high neutralizing capacity) for one or preferably both of said antigens with which is related specifically. For example, a dual specificity antibody or portion thereof may bind one or more preferably both structurally related antigens with a Koff constant of 0.1 sec.<sup>-1</sup> or less, more preferably a Koff constant of 1x10<sup>-2</sup> s<sup>-1</sup> or less, more preferably with a Koff constant of 1x10<sup>-3</sup> s<sup>-1</sup> or lower, even more preferably with a Koff constant of 1x10<sup>-4</sup> s<sup>-1</sup> or lower, most preferably with a Koff constant of 1x10<sup>-5</sup> s<sup>-1</sup> or lower, determined by the surface plasmon resonance measurement method. Alternatively or additionally, a dual specificity antibody or portion thereof may inhibit the activity of one or preferably both of said structurally related antigens with an IC50 constant of 1x10<sup>-6</sup>M or less, more preferably with an IC50 constant of 1x10<sup>-7</sup>M or less, even more preferably with an IC50 constant of 1x10<sup>-8</sup>M or less, more preferably with an IC50 constant of 1x10<sup>-9</sup>M or less, even more preferably with an IC50 constant of 1x10<sup>-10</sup>M or less, most preferably with an IC50 constant of 1x10<sup>-11</sup>M or less. Preferably the IC50 constant should be measured using a sensitive bioassay in which the constant IC50 value should be close to the ED50 value for the antigen used in said assay.
Pharmaceutical compositions comprising a dual specificity antibody or antigen-binding portion of said antibody can be formulated in a pharmaceutically usable carrier. The pharmaceutical composition may further comprise at least one additional therapeutic agent, e.g., one or more therapeutic agents for the treatment of a disease in which the use of a dual specificity antibody is preferred. For example, where a dual specificity antibody specifically binds IL-1a and IL-1β, the pharmaceutical composition may further include one or more therapeutic agents for treating a disease in which IL-1 activity is pathogenic.
PL 208 069 B1
The said antibody and the antigen-binding portion of the antibody obtainable by the method of the invention may be a component of a pharmaceutical composition useful for administration to a patient. Typically, the pharmaceutical composition comprises an antibody or antibody portion of the invention and a pharmaceutically usable carrier. The term "pharmaceutically usable carrier" includes any and all solvents, dispersion media, coating agents, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like that are physiologically compatible. Examples of pharmaceutically acceptable carriers include water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like or combinations thereof. In many cases, it is preferable to include an isotonic agent in the composition, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride. Pharmaceutically acceptable carriers can also include minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives or buffers, to increase the shelf life or effectiveness of the antibody or antibody portion.
The said antibodies or antibody portions obtainable by the method of the invention may form part of a pharmaceutical composition useful for parenteral administration. The antibody or antibody portion is prepared as an injection solution comprising 0.1-250 mg / ml of the antibody. The solution for injection can include either a liquid or lyophilized dosage form in a flint or amber glass vial, ampoule, or syringe. The buffer may be L-histidine buffer (1-50 mM), preferably 5-10 mM, with a pH of 5.0-7.0 (preferably 6.0). Other useful buffers include, but are not limited to, sodium succinate, sodium citrate, sodium phosphate, or potassium phosphate. Sodium Chloride can be used to modify the toxicity of the solution at concentrations of 0-300 mM (preferably 150 mM for a liquid dosage form). Cryoprotectants may be added to the lyophilized dosage form, generally 0-10% sucrose (preferably 0.5-1.0%). Other useful cryoprotectants include trehalose and lactose. Fillers that may be included in the lyophilized dosage forms are generally 1-10% mannitol (preferably 2-4%). Stabilizers can be used for both liquid and lyophilized dosage forms, generally 1-50 mM L-methionine (preferably 5-10 mM). Other useful fillers include glycine, arginine (0-0.5%), polysorbate-80 (preferably 0.005-0.01%). Additionally, surfactants may be added, including but not limited to polysorbate and BRIJ.
The composition may take many forms. These include, for example, liquid, semi-solid, or solid dosage forms, such as liquid solutions (e.g., infusion and injection solutions), suspensions or dispersions, tablets, pills, powders, liposomes, and suppositories. The preferred form depends on the mode of administration and therapeutic application. Typical compositions are solutions for injection or infusion, such as compositions similar to those used in passive immunization of humans with other antibodies. The preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular). The antibody may be administered by intravenous injection or infusion. The antibody can also be administered by intramuscular or subcutaneous injection.
Therapeutic compositions must be sterile and stable under the conditions in which they are manufactured and stored. The compositions can take the form of a solution, microemulsion, dispersion, liposome, or other ordered structure useful to achieve high drug concentration. Sterile injectable solutions can be prepared by incorporating the active ingredient (e.g. Antibody or antibody portions) in a useful amount in an appropriate solvent with one or more of the accessory ingredients enumerated above, if desired, followed by filtered sterilization. Generally, dispersed solutions are prepared by incorporating the active ingredient into a sterile vehicle that contains a basic dispersion medium and useful additional ingredients selected from those enumerated above. In the case of sterile, lyophilized powders for the preparation of sterile injectable solutions, vacuum drying and spray drying are possible to obtain a powder of the active ingredient and the desired adjunct ingredients from the filtered sterile solutions. The correct fluidity of the solution can be obtained, for example, by adding a substance of the lecithin type, by obtaining the correct particle size in the case of dispersion, and by using surfactants. Prolonged absorption of the injectable composition can be brought about, for example, by the addition of an ingredient delaying absorption, for example, monostearate salts and gelatin.
Said antibody and antibody portion according to the invention can be administered in many ways known to those skilled in the art depending on the specific therapeutic application, the preferred route of administration is subcutaneous injection, intravenous injection or infusion. It is known to those skilled in the art that the particular route and / or mode of administration will vary depending on the desired results. Said active ingredient may be prepared with a carrier which protects the active ingredient against rapid release in a controlled release formulation which may include implants, transdermal patches and microcapsules. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods of preparing such forms are patented and known to those skilled in the art (see, e.g., Sustained and controlled release drug delivery systems, JR Robinson, Marcel Dekker Inc, NY 1978).
The antibody or antibody portion obtained by the method of the invention may be administered orally, for example, in an inert diluent or in an digestible, edible carrier. Said ingredient (and other additives if necessary) may be contained in soft or hard gelatine capsules, compressed into tablets, or incorporated directly into the patient's diet. For oral administration, said component can be combined with excipients and used in the form of tablets, buccal tablets, lozenges / troches, capsules, elixirs, suspensions, syrups, wafers and the like. In order to administer a component of the invention by other means than enteral, it may be necessary to coat said component or administer said component together with a material to prevent inactivation of said component.
Supplementary active ingredients can also be incorporated into the compositions. In certain embodiments, an antibody or antibody portion of the invention is formulated and / or co-administered with one or more additional therapeutic agents useful in the treatment of a condition related to pathogenic IL-1 activity. For example, the dual specificity anti-IL-1? / LL-1 β antibodies or antibody portions of the invention may be part of a formulation and / or co-administered with one or more additional antibodies binding to another target (e.g., antibodies that bind to other cytokines). or binds to molecules located on the cell surface). In addition, one or more antibodies of the invention may be used in combination with two or more of the therapeutic agents listed. Said combination therapy can use effectively low doses of the administered therapeutic agents, thus avoiding possible toxic effects or complications associated with different types of single component treatments.
IV. The use of dual specificity antibodies
Due to the ability to bind two different but structurally related antigens, the dual specificity antibodies or parts thereof obtained by the method of the invention can be used to detect one or both of these antigens (e.g. in a sample of biological material such as plasma or serum) in a conventional an immunoassay such as an ELISA and a Radioimmunoassay (RIA) or by immunohistochemical techniques. A method of detecting an antigen in a sample of biological material is possible, comprising contacting the sample of the biological material with a dual specificity antibody or antibody portion of the invention, which antibody recognizes said antigen and detects either an antibody (or antibody portion) bound to the antigen or an unbound antibody (or a portion of the antibody). antibodies), and thereby detects said antigen in said sample of biological material. Said antibody is labeled directly or indirectly with a substance by which bound or unbound antibody can be detected. Useful detection substances include a variety of enzymes, prosthetic groups, fluorescent materials, luminescent materials, and radioactive materials. Examples of useful enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; examples of useful prosthetic groups include the streptavidin / biotin and avidin / biotin complex; examples of useful fluorescent materials include umbeliferon, fluorescein, fluorescein isocyanate, rhodamine, dichlorotriazinylaminofluorescein, dansyl chloride or phycoerythrin; examples of luminescent materials include luminol and examples of radioactive materials include <sup>125</sup>AND, <sup>131</sup>AND, <sup>35</sup>Wedding <sup>3</sup>H.
An alternative to labeling the antibody is a method in which said antigen (s) can be detected in biological fluids in a competitive radioimmunoassay using antigen standards labeled with detectable substances and an unlabeled dual specificity specific for said antigen (s). In said test, a sample of biological material, said labeled antigen standard and a dual specificity antibody are mixed, and then the amount of labeled
Of an antigen standard associated with said unlabeled antibody. The amount of antigen in a sample of biological material is inversely proportional to the amount of labeled antigen standard associated with the unlabeled antibody.
A dual specificity antibody can specifically recognize IL-1α and IL-1β, and the above methods can be used to detect IL-1a and / or IL-1β. It is possible to detect IL-1a or IL-1 β in a sample of biological material or tissue by contacting the sample of biological material or tissue which may contain IL-1a or IL-1 β with a dual specificity antibody or antigen-binding portion of said antibody. obtained by the method of the invention and detecting IL-1a or IL-1β in a sample of biological material or tissue. A sample of biological material can be e.g. the in vitro sample, such as a sample of cells, tissues or body fluids (e.g. blood, plasma, urine, saliva, etc.) furthermore, the tissue may be an in vivo tissue e.g. tissue visualized by using in vivo visualization techniques of said tissue (e.g. using labeled antibodies).
The dual specificity antibodies obtained by the method of the invention can be used for diagnostic purposes. The antibody of the invention may be used in an in vitro diagnostic test, such as a laboratory test to detect the desired antigen (s) or a general use test to detect the desired antigen (s). Examples of well-known in vitro tests include ELISA, RIA, Western blot and the like. An antibody obtained by the method of the invention may be used in an in vivo diagnostic assay, such as an in vivo imaging assay. For example, said antibody can be labeled with a detectable substance detectable in vivo, then the labeled antibody is administered to the patient, and the labeled antibody detected in an in vivo assay, thereby enabling in vivo imaging.
The dual specificity antibodies obtained by the method of the invention that specifically recognize IL-1a and IL-1β can be used in diagnostic assays for the detection of IL-1a and / or IL-1β for diagnostic purposes, for example for the diagnosis of inflammatory diseases, as well as in the case of spontaneous miscarriages. Due to the particular type of disease, the IL-1a / IL-1β dual specificity antibodies of the invention may be used for diagnostic purposes in any of the types of disease described above due to the therapeutic use of said antibodies (see below), such as conditions in which the activity of IL-1 is a pathogenic agent as discussed below.
Dual specificity antibodies or antibody portions preferably are capable of neutralizing, both in vitro and in vivo, the activity of said antigens to which they bind. Said antibodies and antibody portions can be used to inhibit the activity of said antigens, e.g. in a cell culture comprising said antigens, or in a patient or animal organism having said antigens with which said dual specificity antibodies according to the invention can interact. It is possible to inhibit the activity of an antigen by contacting said antigen with a dual specificity antibody or part of an antibody according to the invention which results in inhibition of the activity of the antigen. The dual specificity antibody binds IL-1a and IL-1β, and it is possible to inhibit the activity of IL-1a and / or IL-1β by contacting IL-1a and / or IL-1β with the dual specificity antibody or portion thereof. For example, the activity of IL-1a and / or IL-1β can be inhibited in vitro. For example, to a cell culture containing or presuming to contain IL-1a and / or IL-1β, an antibody or antibody portion of the invention can be added to inhibit the activity of IL-1α and / or IL-1β in said culture. Alternatively, the activity of IL-1a and / or IL-1β can be inhibited in vivo in the patient.
It is possible to inhibit the activity of an antigen in the body of a patient suffering from a disease in which the activity of said antigen is pathogenic. It is possible to inhibit the activity of an antigen in the body of a patient suffering from such a disease, comprising administering to the patient a dual specificity antibody or portion thereof such that the activity of the antigen in the patient's body is inhibited. Preferably said antigen is a human antigen and the patient is a human person. The antibody can be administered to a patient for therapeutic purposes. Moreover, the antibody obtained by the method of the invention can be administered to an animal expressing an antigen to which said antibody binds for veterinary purposes or in the case of using animals as models of human diseases. In the latter case, such animals can be used to evaluate the effects of therapy using the antibodies of the invention (e.g., for testing dose, method and timing of administration).
PL 208 069 B1
The dual specificity antibody binds IL-1a and IL-1β, and it is possible to inhibit IL-1 activity in a patient, for example a patient suffering from a condition in which the IL-1 activity is pathogenic. The term "condition in which IL-1 activity is pathogenic" as used herein refers to conditions and other disabilities in which the presence of IL-1 (including IL-1α and IL-1β) in the body of a patient suffering from the disease is or is suspected. is believed to be either responsible for the pathophysiology of the disease or a contributing factor to the exacerbation of the disease. Accordingly, a disease in which IL-1 activity is pathogenic is a disease in which inhibition of IL-1 activity (i.e., IL-1a and IL-1β, either separately or together) is expected to alleviate the symptoms and / or progression of said disease. Said diseases can manifest as, for example, an increase in the concentration of IL-1 in the body fluids of the patient suffering from said disease (e.g. an increased concentration of IL-1 in plasma, serum, synovial fluid, etc. patient), which concentrations can be detected, for example, using the anti-IL-1 antibody described above.
Interleukin I plays a key role in the pathology associated with many diseases including the inflammatory and immune response of the body. These diseases include rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, Lyme disease arthritis, psoriatic arthritis, Reiter's syndrome, spinal arthritis, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammation colon / inflammatory bowel disease, insulin-dependent diabetes mellitus, thyroiditis, asthma, allergic diseases, psoriasis, inflammation and scleroderma, Graft anti-host reactions, graft rejection, acute or chronic immune disease associated with organ transplantation, atherosclerosis, sarcoidosis, disseminated intravascular coagulation, Kawasaki disease, Grave's disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, -Schoenlein, microscopic nephritis, chronic active hepatitis, uveitis, septic shock, toxic shock syndrome, sepsis syndrome, cachexia, infectious diseases, parasitic diseases, acquired immune deficiency syndrome, acute transverse myelitis, Huntington's chorea, Pakinson's disease, Alzheimer's disease, stroke, primary biliary cirrhosis, hemolytic anemia, malignancy, heart failure, infarction myocardium, Addison's disease, sporadic polyglandular hypothyroidism type I and II, Schmidt's syndrome, adult (acute) respiratory distress syndrome, alopecia, alopecia areata, serous negative arthropathy, arthropathy, Reiter's disease, psoriatic arthritis, ulcerative intestinal arthritis, enteropathic synovitis, arthropathies associated with chlamydia, yersinia and salmonella infections, spine arthropathy, pemphigus vulgaris, atopic dermatitis deciduous, pemphigoid, linear IgA disease, autoimmune hemolytic anemia, hemolytic anemia with Coombs' test, acquired malignant anemia, juvenile malignant anemia, myalgia encephalitis, transient mucosal and skin candidiasis, giant cell temporal arteritis, primary sclerosing hepatitis, cryptogenic autoimmune hepatitis, acquired immune deficiency syndrome, diseases accompanying acquired hepatitis C, immunodeficiency common variable immunodeficiency (common variable blood gamma globulin deficiency), dilated cardiomyopathy, female infertility, ovarian failure, premature ovarian failure, fibrosing lung disease, cryptogenic fibrosing alveolitis, post-inflammatory interstitial lung disease, interstitial pneumonia, interstitial lung disease associated with mixed connective tissue disease, interstitial lung disease associated with systemic sclerosis, lung disease associated with rheumatoid arthritis, lupus erythematosus, dermatomyositis / polymyositis, Sjogren's disease, ankylosing spondylitis, diffuse pulmonary disease related to vasculitis, haemosiderosis related lung disease, drug reaction related interstitial lung disease, radiation-induced fibrosis, bronchiolitis obliterating, chronic eosinophilic pneumonia, lymphocytic lung disease post-infectious interstitial lung disease, acute gouty arthritis, autoimmune hepatitis (type I - classic autoimmune or lupus hepatitis and type II - hepatitis with anti-LKM antibodies), autoimmune hypoglycemia, insulin resistance type B with actinic keratosis, hypoparathyroidism, acute post-transplant complications, rheumatism, sclerosing inflammation biliary tract, autoimmune neutropenia, psoriasis types 1 and 2, idiopathic leukopenia, autoimmune neutropenia, NOS kidney disease, glomerulonephritis
Nephritis, microscopic renal vasculitis, Lyme disease, disc lupus erythematosus, male infertility (idiopathic, NOS), sperm autoimmunity, multiple sclerosis of all subtypes, sympathetic uveitis, pulmonary hypertension secondary to connective tissue disease, Goodpasture's syndrome a, polyarteritis nodosa (pulmonary symptoms), acute rheumatoid fever, vertebral degeneration, Still's disease, Sjogren's syndrome, Takayashu's disease / arteritis, autoimmune and idiopathic thrombocytopenia, autoimmune thyroid disease, hyperthyroidism, autoimmune hypothyroidism with goiter (Hashimoto's disease), atrophic autoimmune hypothyroidism, primary myxoedema, cataract uveitis, primary neuritis, vitiligo, vasculitis (e.g. depression, schizophrenia, Alzheimer's Parkinson's disease, etc.), acute and chronic pain, lipid metabolism disorders. The human antibodies and antibody portions of the invention can be used to treat patients suffering from autoimmune diseases, in particular those associated with inflammation, rheumatoid spondylitis, allergies, autoimmune diabetes and autoimmune uveitis.
Preferably, the dual specificity anti-IL-1a / IL-1 β antibodies obtained by the method of the invention or antigen-binding portions of said antibodies can be used in the treatment of rheumatoid arthritis, Crohn's disease, multiple sclerosis, insulin-dependent diabetes mellitus, psoriasis.
The IL-1α / IL-1β dual specificity antibodies of the invention, or the antigen binding portions of said antibodies, can be administered with one or more therapeutic agents useful in the treatment of autoimmune and inflammatory diseases.
The antibodies of the invention or the antigen binding portion of the antibodies may be used alone or in a composition for the treatment of the aforementioned diseases. It is understood that the antibodies of the invention or the antigen binding portion of said antibodies may be used alone or in combination with additional agents, e.g., a therapeutic agent, e.g. an additional agent selected by one of ordinary skill in the art for the purpose intended. For example, the additional agent may be a therapeutic agent known to be useful in treating the disease or feature undergoing treatment by administering an antibody of the invention. The additional agent can also be an agent that conveys a beneficial effect to the therapeutic composition, e.g.
The aforementioned compositions may comprise the aforementioned antibodies obtained by the method of the invention and at least one additional agent, e.g. two or three additional agents.
The compositions may include non-steroidal anti-inflammatory drugs (NSAIDS) which include drugs such as ibuprofen and Cox-2 inhibitors. Other combinations include corticosteroids including prednisolone; the well-known side effects of steroids can be reduced or even eliminated by reducing the dose of steroid required to treat patients when using the anti-IL-1 antibody compositions of the invention. Examples of therapeutic agents for use in rheumatoid arthritis with which the antibody of the invention or the antigen-binding portion of the antibody can be combined include: anti-inflammatory drugs that inhibit cytokines (CSAIDs), antibodies or antagonists of other human cytokines or growth factors, for example: TNF, LT, IL-2, IL-6, IL-7, IL-8, IL-12, IL-15, IL-16, IL-18, GM-CSF, FGF and PDGF. The antibodies obtained by the method of the invention or the antigen-binding portion of said antibodies can be combined with antibodies recognizing molecules located on the surface of cells, such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80 (B7.1 ), CD86 (B7.2), CD90, and ligands thereof, including CD154 (gp39 or CD40L).
Useful combinations of therapeutic agents can disrupt at various points the autoimmune and inflammatory cascades: preferred examples include TNF agonists such as chimeric, humanized or human anti-TNF antibodies, D2E7 (PCT Publication No. WO 97/29131), CA2 (Remicade ™), CDP 571, CDP 870, Thalidamide and the soluble p55 or p75 TNF receptors, derivatives thereof (p75TNRF1gG (Enbrel ™) or p55TNFR1gG (Lenercept), and also TNF? Converting enzyme inhibitors (TACE); similarly, IL-1 inhibitors (IL-1 converting enzyme inhibitors, IL-1RA etc) which may be useful for the same reasons. Other useful combinations include interleukin 11. Further useful combinations include agents that play a significant role in the autoimmune response, which agents may act in parallel with, depending on, or in concert with IL-1 function; IL-12 and / or IL-18 antagonists including antibodies are particularly preferred
PL 208 069 B1
IL-12 and / or IL-18 or soluble IL-12 and / or IL-18 receptors, or IL-12 and / or IL-18 binding proteins. IL-12 and IL-18 have been shown to have overlapping but different functions, and a combination of different antagonists may be most effective. Another useful combination includes non-depleting anti-CD4 inhibitors. Another useful use is antagonists of the CD80 (B7.1) or CD86 (B7.2) costimulation pathway, including antibodies, soluble receptors or antagonist ligands.
The antibodies obtained by the method of the invention, or the antigen-binding portion of said antibodies, may be in combination with agents such as methotrexate, 6-MP, azathioprine, sulfasalazine, mesalazine, chloroquine / olsalazine hydroxychloroquine, penicillamine, aurothiomalate (intramuscularly or orally administered), azathioprine corticosteroids (given by mouth, inhalation, and local injection), beta-2-adrenergic agonists (salbutamol, terbutaline, salmeteral), xanthines (theophylline, aminophylline), cromoglycan, nedocromil, ketotifen, ipratropium, oxitropium, cyclosporin, FK506, rapamycin, mycophenolate mofetil, leflunomide, various NSAIDs, e.g. anticoagulants, complement inhibitors, adrenergic agents, Agents that impair the pathway of inflammatory signaling by pro-inflammatory cytokines such as TNFα or IL-1 (e.g. inhibitors of IRAK, NIK, IKK, p38 or MAP), inhibitors of IL-1β converting enzyme, inhibitors of TNFα converting enzyme (TACE) , T cell signaling inhibitors such as kinase inhibitors, metalloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptoputine, angiotensin converting enzyme inhibitor, soluble cytokine receptors and derivatives thereof (e.g. soluble TNF receptors p55 or p75 and their derivatives p75TNRF1gG (Enbrel ™) or p55TNFR1gG (Lenercept), sIL-1RI, sIL-1RII, sIL-6R, and anti-inflammatory cytokines (e.g. IL-4, IL-10, IL-11, IL-13 and TGFe). Preferred combinations include methotrexate or leflunomide, and in the case of moderate to severe rheumatoid arthritis, cyclosporin.
Examples of inflammatory bowel medicaments with which the antibody of the invention, or the antigen binding portion, may be in combination include: budenoside, EGF, corticosteroids, cyclosporin, sulfasalazine, aminosalicylates, 6-mercaptopurine, azathioprine, metronidazole, lipoxygenase inhibitors, mesalamine, olsalazine, balsalazide, antioxidants, inhibitors of thromboxane, anti-IL-1-β antibodies, IL-1 receptor antagonists monoclonal anti-IL-6, growth factors, elastase inhibitors, pyridinyl-imidazole compounds, antibodies directed against or antagonists of other human cytokines or growth factors, e.g. TNF, LT, IL-2, IL-6, IL-7, IL-8, IL-12, IL-16, IL-18, EMAP-II , GMCSF, FGF and PDGF. The antibodies of the invention can be combined with antibodies to surface molecules such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD90 and their ligands. The antibodies obtained by the method of the invention, or the antigen-binding portion of said antibodies, can also be combined with agents such as methotrexate, cyclosporin, FK506, rapamycin, mycophenolate mofetil, leflunomide, NSAID compounds, e.g. , anticoagulants, complement inhibitors, adrenergics, agents that interfere with proinflammatory cytokine signaling, such as TNFa or IL-1 (e.g. IRAK, NIK, IKK, p38 or MAP kinase inhibitors), IL-1β converting enzyme inhibitors, TNFa converting enzyme inhibitors, T cell signaling inhibitors such as kinase inhibitors, meteloproteinase inhibitors, sulfasalazine, azathioprine, 6-mercaptopurine, angiotensin converting enzyme inhibitors, soluble cytokine receptors and derivatives thereof (e.g. soluble TNF p55 or p75 receptors, sIL-1R1, sIL-1RII, sIL-6R) and anti-inflammatory cytokines (e.g. IL-4, IL-10, IL-11, IL-13 and TGFe).
Useful examples of therapeutic agents for Crohn's disease to which the antibody or antigen binding portion of the antibody can be combined include: TNF antagonists, for example anti-TNF antibodies, D2E7 (PCT Publication No. WO 97/29131), CA2 (Remicade ™), CDP 571 , TNFR-Ig constructs, (p75TNFRIgG (Enbrel ™) and p55TNFRIgG Lenercept) inhibitors and PDE4 inhibitors. The antibodies or antigen-binding portion of said antibodies of the invention can be combined with corticosteroids, for example budenoside and dexamethasone. The antibodies of the invention or the antigen-binding portion of the antibody can be combined with agents such as sulfasalazine, 5-aminosalicylic acid, and olsalazine, and agents that interfere with the synthesis or function of proinflammatory cytokines such as IL-1, for example with IL-1 converting inhibitors. 1e and IL-1ra. The antibodies obtained by the method of the invention or the antigen binding portion can also be used to inhibit the signaling pathway of T cells, for example using kinase inhibitors.
Of tyrosine (6-mercaptopurine). The antibodies of the invention or the antigen-binding portion of the antibodies can be fused to IL-11.
Useful examples of therapeutic agents for multiple sclerosis with which the antibody of the invention or the antigen-binding portion of the antibody can be combined include: corticosteroids, prednisolone, methylprednisolone, azathioprine, cyclophosphamide, cyclosporin, methotrexate, 4-aminopyridine, tizanidine-beta, interferon-beta Avonex; Biogen), interferon-eib (Betasteron; Chiron / Berlex), Copolymer 1 (Cop-1; Copaxone, Teva Pharmac Industries Inc); oxygen under increased pressure, intravenous immunoglobulins, clabridin, antibodies against or antagonists of human cytokines or growth factors, for example TNF, LT, IL-2, IL-6, IL-7, IL-8, IL-12, IL- 15, IL-16, IL-18, EMAP-II, GMCSF, FGF and PDGF.
The antibodies obtained by the method of the invention or the antigen-binding portion of said antibodies can be combined with antibodies against cell surface molecules, such as CD2, CD3, CD4, CD8, CD25, CD28, CD30, CD40, CD45, CD69, CD80, CD86, CD90 or a ligand thereof. Said antibodies obtained by the method of the invention, or antigen binding portions of said antibodies, can also be combined with agents such as methotrexate, cyclosporin, FK506, rapamycin, mycophenolate mofetil, lefulunomide, NSAID compounds for example ibuprofen, Cox-2 inhibitors, corticosteroids such as prednisolone phosphodiesterases, adenosine agonists, anticoagulants, complement inhibitors, adrenergics, agents that disrupt the signaling pathway of proinflammatory cytokines such as TNFα or IL-1 (e.g. inhibitors of IRAK, NIK, IKK, p38 or MAP kinases), IL-1β converting enzyme inhibitors, TACE inhibitors, inhibitors of T cell signaling pathways such as kinase inhibitors, inhibitors metalloproteinases, sulfasalazine, azathioprine, 6-mercaptopurine, angiotensin converting enzyme inhibitors, soluble cytokine receptors and their derivatives (e.g. soluble p55 or p75 TNF receptors, sIL-1RI, sIL-1RII, sIL-6R) and anti-inflammatory cytokines (e.g. IL-4, IL-10, IL-13 and TGFe).
Preferred examples of therapeutic agents for the treatment of multiple sclerosis comprising said antibody or antigen-binding portion of said antibody can be combined with agents comprising interferon β, for example INFe1a and INFe1b, copaxone, corticosteroids, IL-1 inhibitors, TNF inhibitors and anti-CD40 ligand antibodies and CD80.
The pharmaceutical compositions may comprise a "therapeutically effective dose" or a "prophylactically effective dose" of said antibody or antigen binding portion of an antibody obtained by a method of the invention. The term "therapeutically effective dose" means an amount effective at a dose and applied for as long as necessary to achieve the desired therapeutically effect. A therapeutically effective amount of the antibody or antibody portion may vary depending on factors such as the severity of the disease, age, sex and weight of the patient, and depending on the ability of the antibody or portion thereof to elicit the desired response in the patient. A therapeutically effective amount is that dose at which the adverse toxic or harmful effect of the dose of said antibody or antibody portion is less than the beneficial therapeutic effect. The term "prophylactically effective dose" means an amount effective at a dose and applied for the period necessary to achieve the desired prophylactic effect. Typically, a prophylactic dose is administered to patients prior to disease development or in the early stages of disease development, the prophylactically effective dose being less than the therapeutically effective dose.
The dosage regimen can be optimized to achieve the optimal therapeutic response (e.g., prophylactic or therapeutic response). For example, a single dose of drug may be administered, several divided doses of drug may be administered over a period of time, or the dose may be proportionally reduced or increased as indicated by the particular therapeutic situation. It is especially advantageous to formulate parenteral compositions in unit dose form of the drug which are easy to handle and allow for uniform administration. Drug doses herein are physical portions used as unit doses for patients or model animals that are or are to be treated; each unit (dose) contains a predetermined quantity of active agent calculated to achieve the desired therapeutic effect in association with a pharmaceutically useful carrier. The precise determination of the form of a therapeutic dosage according to the invention is aimed at and directly depends on the characteristic properties of the active ingredient and the therapeutic or prophylactic effect to be achieved and on the constraints inherent in the compounds such as the active compound in the treatment.
Examples of therapeutically or prophylactically effective amounts of the antibody or portion thereof obtained by the method of the invention include 0.1-20 mg / kg, more preferably 1-10 mg / kg. The dose depends on the nature and severity of the symptoms of the disease being treated. There is also
It is understood that, for each patient, specific dosages should be established depending on their medical condition and clinical judgment by one of ordinary skill in the art.
Example 1: Design of an Antigen with Dual Specificity Based on Topologically Adjacent Area of Identity.
In this example, the greatest common area of identity between two different but structurally related proteins, IL-1a and IL-1 β is determined in order to design a dual specificity antigen to generate specific antibodies recognizing IL-1a and IL-1 β. In order to compare the two proteins, the BLAST algorithm was used to measure the tendency to replace a particular amino acid residue with another in structurally or functionally similar regions. Said analysis makes it possible to identify the longest contiguous regions of topological identity between IL-1a and IL-1 β so that it is possible to create a linear peptide as a dual specificity antigen. The aforementioned peptide which best meets the abovementioned features has the following amino acid sequence:
NEAQNITDF (SEQ ID No. 1) * *****
An asterisk (*) indicates residues that are identical in both proteins and the other residues are highly similar according to the BLAST algorithm. For example, lysine often substitutes for arginine in homologous proteins, but does not replace phenylalanine. The peptide of SEQ ID No. 1 is a hybrid with the sequence taken from two different structural fragments running in opposite directions, so another possible representation of said epitope is as follows:
dNdEdAdQNITDF where "d" is an amino acid residue in the form D. Both the L amino acid versions of said peptide and the partially substituted D amino acid versions can be synthesized by standard methods. The peptide is then conjugated to a carrier protein (e.g. KLH or albumin) and such conjugated peptide is used to select antibodies in vitro or in vivo.
Example 2: Design of a dual specificity antigen mimicking a common structural loop
In this example, a cyclic peptide mimicking the structurally key loop of the folding region of two different but structurally related proteins IL-1a and IL-1β was produced to be used as a dual specificity antigen to generate dual specificity IL-1a and IL-1 antibodies. 1 β. The selected loop spans IL-1a residues 168-184 and IL-1β residues 160-176. The consensus sequence is as follows:
cyclo-MAFLRANQNNGKISVAL (PG) (Seq Id No. 2) cbcccccccc ** c * b
An asterisk (*) indicates residues identical to IL-1a and IL-1 β, c indicates consensus residues, i.e. residues similar to IL-1a and IL-1β but not present at a specific site in any of the proteins mentioned, b indicates that there is no clear consensus for a particular residue between IL-1a and IL-1β. Said linear peptide is synthesized by standard methods of chemical synthesis. To cyclize the peptide, proline and glycine residues are added. Said cyclic peptide can be synthesized using standard coupling conditions with high concentrations of N, N-dimethylformamide (1 mg / ml). Reactions are carried out at room temperature using an excess of a coupling reagent such as benzotriazol-1-yloxotrispyrrolidine phosphonium hexafluorophosphate (PyBOP, 2 eq.) And sodium bicarbonate (10 eq.). The peptide is then coupled to a carrier protein (e.g. KLH or albumin) and said conjugated peptide is used for the selection of antibodies in vitro or in vivo.
Example 3: Design of a dual specificity antigen based on a hybrid peptide
In this example, a hybrid peptide comprising the alternating or overlapping portions of two different but structurally related proteins, IL-1a and IL-1β, was constructed to be used as a dual specificity antigen to generate dual specificity antibodies recognizing IL-1a and ^ -1β. To produce said hybrid peptide, alternating or overlapping amino acid sequences of IL-1a and IL-1 β are identified and joined to form the following peptide:
TKGGQDITDFQILENQ (Seq Id No.3) bbbbbbbbbb aaaaaaaaaa
PL 208 069 B1
In the above peptide, a and b indicate from which proteins the amino acid residues are derived (a = IL-1α and b = IL-1β). The ITDF motif (SEQ ID No. 4) is common to both proteins and was incorporated into the hybrid peptide. In addition, the hybrid peptide is based on C-terminal sequences from both proteins known to be antigenic with respect to neutralizing antibodies to both proteins. The hybrid peptide is synthesized by standard chemical synthesis techniques and then coupled to a carrier protein (e.g. KLH or albumin) and the conjugated peptide is used to select antibodies in vitro or in vivo.
Example 4: Production of antibodies with dual specificity for IL-1a and IL-1 β NEAQNITDF (SEQ ID No. 1) cyclo-MAFLRANQNNGKISVAL (PG) (SEQ ID No. 2)
TKGGQDITDFQILENQ (SEQ ID No. 3)
The peptides designated with SEQ ID Nos. 1, 2 and 3 were coupled to KLH and individual rabbits were immunized with them. Sera obtained from rabbits immunized with the individual three peptides showed a good immune response against the said peptides. However, only serum obtained from a rabbit immunized with the peptide of SEQ ID No. 3 was able to bind both the IL-1a protein and the IL-1β protein.
Five mice (BA119-BA123) were immunized by subcutaneously injecting the peptide SEQ ID No. 3 conjugated to KLH and supplemented with Freund's Incomplete Adjuvant (FIA) once every three weeks for a total of three times, and then twice intravenously with the peptide SEQ ID No. 3 conjugated from KLH. Blood was drawn from each mouse 10 days after each immunization, and the antibody titer was determined by ELISA. Thymus cells from BA119 and BA123 mice were fused with myeloma cells of the P3X36Ag8.653 line as described in IIA and the resulting fusants were plated one cell per well in a 96-well plate using the dilution method. Growing hybridoma clones were tested for IgG and IgM production by a standard ELISA to select antibody producing clones. 945 clones were recovered from the BA123 mouse fusants. Supernatants from 355 clones tested by ELISA showed binding activity to IL-1a, IL-1β, or both IL-1a and IL-1β.
<td># clones</td><td>antigen specificity (against full length IL-1a and / or IL-1 β)</td><td>isotype</td>
<td> 249</td><td>only IL-1 a</td><td>IgG</td>
<td> 19</td><td>only IL-1a</td><td>IgM</td>
<td> 15</td><td>only IL-1P</td><td>IgG</td>
<td> 2</td><td>only IL-1P</td><td>IgM</td>
<td> 57</td><td>IL-1a and IL-1P</td><td>IgG</td>
<td> 13</td><td>IL-1a and IL-1P</td><td>IgM</td>
Sequence list
NEAQNITDF (SEQ ID No. 1) cyclo-MAFLRANQNNGKISVAL (PG) (SEQ ID No. 2)
TKGGQDITDFQILENQ (SEQ ID No. 3)
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMGAYKSSKDDAKITVILGLKEKNL
YLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLG
GTKGGQDITDFTMQFVSS
Contents15
58 members in 25 offices
Priority claims7
| Document | Office | Kind | Date |
|---|---|---|---|
| 21537900 | United States of America | P | |
| 21537900 | United States of America | P | |
| 0120755 | United States of America | W | |
| 0120755 | United States of America | W | |
| 60215379 | – | – | – |
| US20000215379P | – | – | – |
| WO2001US20755 | – | – | – |
Members58
| Document | Office | Kind | |
|---|---|---|---|
| CA2411374A1 | Canada | A1 | |
| WO0202773A2 | World Intellectual Property Organization (WIPO) | A2 | |
| AU7163601A | Australia | A | |
| UY26807A1 | Uruguay | A1 | |
| WO0202773A3 | World Intellectual Property Organization (WIPO) | A3 | |
| NO20026239D0 | Norway | D0 | |
| KR20030014288A | Republic of Korea | A | |
| NO20026239L | Norway | L | |
| US2003040083A1 | United States of America | A1 | |
| EP1297142A2 | European Patent Office (EPO) | A2 | |
| CZ2003291A3 | Czechia | A3 | |
| BR0112026A | Brazil | A | |
| SK1152003A3 | Slovakia | A3 | |
| IL153567A0 | Israel | A0 | |
| HU0301002A2 | Hungary | A2 | |
| HUP0301002A2 | Hungary | A2 | |
| MXPA02012867A | Mexico | A | |
| BG107483A | Bulgaria | A | |
| CN1451043A | China | A | |
| HK1055316A | Hong Kong, China | A | |
| HK1055316A1 | Hong Kong, China | A1 | |
| JP2004502428A | Japan | A | |
| ZA200210109B | South Africa | B | |
| PL359995A1 | Poland | A1 | |
| NZ523080A | New Zealand | A | |
| TW200516083A | Taiwan Province of China | A | |
| HU0301002A3 | Hungary | A3 | |
| HUP0301002A3 | Hungary | A3 | |
| KR20080074231A | Republic of Korea | A | |
| EP1297142B1 | European Patent Office (EPO) | B1 | |
| AT420958T | Austria | T | |
| ATE420958T1 | Austria | T1 | |
| US7491516B2 | United States of America | B2 | |
| DE60137421D1 | Germany | D1 | |
| TWI307716B | Taiwan Province of China | B | |
| EP2042518A2 | European Patent Office (EPO) | A2 | |
| EP2042518A3 | European Patent Office (EPO) | A3 | |
| ES2319866T3 | Spain | T3 | |
| CN101525384A | China | A | |
| US2009232736A1 | United States of America | A1 | |
| KR100919593B1 | Republic of Korea | B1 | |
| IL153567A | Israel | A | |
| PL208069B1This record | Poland | B1 | |
| CN102120773A | China | A | |
| IL203955A | Israel | A | |
| EP2386575A2 | European Patent Office (EPO) | A2 | |
| EP2386575A3 | European Patent Office (EPO) | A3 | |
| JP2012031178A | Japan | A | |
| BG66209B1 | Bulgaria | B1 | |
| JP4955185B2 | Japan | B2 | |
| CA2411374C | Canada | C | |
| US8475766B2 | United States of America | B2 | |
| CN102120773B | China | B | |
| US2014155579A1 | United States of America | A1 | |
| US2014378666A1 | United States of America | A1 | |
| US2015175694A1 | United States of America | A1 | |
| EP2899210A2 | European Patent Office (EPO) | A2 | |
| EP2899210A3 | European Patent Office (EPO) | A3 |
3 legal events, as the office reported them to INPADOC
Over the term
Point at a mark for the eventEvents
| Event | Code | |
|---|---|---|
| Decisions on the lapse of the protection rightsLapsedLAPS | LAPS | |
| Invalidation of derivated patent or utility modelVDSO | VDSO | |
| Rectifications of patent specificationRECP | RECP |
Numbers
- Publication
- 208069
- Publication, DOCDB
- 208069
- Publication, EPODOC
- PL208069B
- Application
- 359995
- Application, DOCDB
- 35999501
- Application, EPODOC
- PL20010359995
Titles2
- English
- DUAL SPECIFICITY ANTIBODIES AND METHODS OF MAKING AND USING
- Polish
- Sposób uzyskiwania przeciwciała o podwójnej specyficzności lub jego części wiążącej antygen
Classification
- CPC, 19
- C07K16/245
- C07K16/24
- A61K2039/505
- C07K14/545
- C07K16/46
- C07K2317/31
- C07K2317/33
- C07K2317/34
- G01N33/6869
- C07K16/468
- A61K47/6845
- A61P1/04
- A61P17/06
- A61P25/00
- A61P29/00
- A61P37/06
- C07K2317/76
- C07K2317/10
- C07K2317/56
- IPC, 21
- C12N15 13
- A61K39 395
- G01N33 50
- A61K47 48
- A61K49 00
- A61K51 10
- A61P1 04
- A61P17 06
- A61P25 00
- A61P29 00
- A61P37 06
- C07K16 24
- C12N1 15
- C12N1 19
- C12N1 21
- C12N5 10
- C12N15 09
- C12P21 08
- G01N33 15
- G01N33 53
- G01N33 68