Untitled record

Full description of the invention

The high rate of transmission relates to novel, non-pathogenic and multiple gene linkage combinations.

Marek's disease multivalent recombinant non-pathogenic valence

Disease virus is encoded and expressed for Infectious Laryngotracheitis Virus and protein antigens specific to Newcastle Disease virus, and a way to use these formulations in chicken vaccines . poultry vaccines

10

15

Ferxclies of the nurses do not stop, so the ingredient of a chicken, but it is to be a supply of the chicken in the stones Take a way that is not all in the manner of the use of the use of the values A small picture in many different spaces_YWhat happened to the justice? If you find it in the right places, it will often be a very useful tool for where to use the vaccines. Despite the fact that the poultry vaccines available to you, the drugs that kill you are still very effective In the field of the decor industry, it has been done in recent years A large amount of resources has been spent on inventing new genes that consist of making viral combinations resulting from a genetic linkage complex in which_YThese Karayan formulations contain protein antigens and pathogenic viremia. It's a problem_nHowever, he lost

B_YThere have been numerous outbreaks of vaccines resulting from the genetic linkage complex of Marek's disease virus (rMDVnp), which are stable, effective, multivalent, and non-pathogenic._YKaryan expressed the presence of allergy genes from multiple viral pathogens. Polyvalent timers are completely polyvalent

20

If you do the work to estimate the number of parking lots covered by your contract in this way, you can evaluate the agreement as

٤٢٤٣

5

-٣-

10

15

20

Hardening the labor of the cape in a fair manner is a cost, and in this way rejects the costs of labor and dependence. Informed, the exhausted installations are the renovation of the exhausted, the exhaustion, the exhaustion, the exhaustion, the reinforcement, the formation of the exhaustion. The result of the result of the genetic link, as the minimum levels, RMDVNP, as a result of a window and the purpose of the bodies, the general, insteadⁿDTL is largely from a viral pathogen such as hand only. If all of these alternative parameters are assumed to be caused by none of the rMDVnp rMDVnp combinations being able to decode^AndTherefore, these low-valent formulations rMDVnp are highly effective in inducing a significant immune response. It is hard work, and it is hard work despite the effort.

In the past, a large number of multivalent palm leaves were produced as a result of the genetic link between the Marek's disease virus rMDVnp is stable and effective_YAcross the country, there are many common allergic genes for various viral pathogens that have caused this country.

It was made with peas.

And the same purpose as the one who left the land of the Al-Dhidakah Al-Dhimhi._YIt is difficult to control his condition using methods of treatment and it is Marek's Disease. Marek's Disease is a viral pathogen that afflicts chickens and affects the characteristics of chickens, among many other feed species. Y_YMarek's Disease occurred in Las Vegas, the last lake chicken that comes to life between 2 and 5 pounds. Clinical disease: progressive paralysis of one or more of the extremities, incoordination due to paralysis of legs, drooping of the limb due to injury to the wing limb due to wing involvement, lowered head due to injury to the quadriceps muscle

position due to involvement of the neck muscles. Inevitably, severe depression results. Bursal and thymic atrophy must occur.

٤٢٤٣

-٤-

The causative agent of Marek's Disease is serotype 1 of the Marek's disease virus serotype 1 (MDV1), and it is a recombinant virus associated with the DNA genome MDV1 and FX_H5 lymphotropic avian alphaherpesviruses that both belong to the avian alphaherpesviruses group._YCal MF: 1) Ralia B

Immune system, which should lead to cytolysis, 2)_YT-immune infection, edema_YHow much does it cost?_YLymphocytosis occurred in T-religion. Marek's disease virus serotype 2 (MDV2), serotype 2 (MDV2),_YPreviously known as Virus Arbus

<p dir="rtl">10 Gallid herpes virus 3, which is a term for the MDV strain of the Marek's Disease virus, known as^AndIt is natural that it is good for Neha to have the ability of an earthly mother that is rejected by you.</p>

Petherbridge et al., J. It is impossible to create ground foundations in chickens.

Virological Methods 158:11-17 (2009)

If Sfalala 1-SB and in the phrase Aaf Sfalala Nakaniyaf Maf Alf Al-Masamiyya Pattern 2 for Fiferx Maf Purpose: 15 MDV2, which is a ancestor of the species, can be useful in producing antibodies against the subspecies MDV1.

For Money, 547-553 (26) Murthy and Calnek, infection and immunity (1979)].

The number of tests for HIV infection is the serotype 3 of Marek's disease virus serotype 3 (MDV3)._YHe knew Lakar

<p dir="rtl">20 From the name of the Kassam domain in Ferex and RBS_YHerpesvirus of turkeys (HVT)_YI used the cleaned rocks to clean my work for the sake of the money,</p>

Kingham et al., J. of General Virology 82:1123-1135 (2001).

The two most commonly used strains of Virus Virus (HVT) are strain PB1 and strain FC126. If there is a wound on the chicken, it is not harmful to chickens, unless they are dead.

<p dir="rtl">25 Y_YA prolonged visceral immune response occurs in chickens against Mariev's disease serotype MDV1.</p>

٤٢٤٣

5

-٥-

Marek's Disease. In addition, the use of HVT has been lost in poultry factories.

vaccines against MDV1 Marek's Disease serotype for many years,^AndIn contrast to the SB-1 design, which is similar to the old Caravan Fireworks HVT, but is_YIt is considered a matter of reason_nUpon return. K Bdal_nTherefore, when chickens are exposed to the harmful strains of MDV1 bullets, the HVT strain is_YMKV of the RESPV vaccine. Respv vaccine is an isolated strain resulting from the co-infected MDV1 strain, which is genetically generated by the bacterium. The Risbenn breed thus maintains some involvement in the field of recently developed chicken breeds.

Afonso et al., J. It is cost-effective to stop HVT from the entire Virvix genome.

10 (2001) 971-978:(2)75 Virology], as most

alphaherpesviruses, HVT has a large number of complementary equipment that are not essential to the operation of a financially sound business 5187087; 5830745;

5834305 ; 5853733; 5928648; 5961982; 6121043; 6299882[. liver

It turns out that the HVT can be used to modify the curry, so it has been used as a cross-linking cable.

15 04463/87 [. As a result of the genetic linkage knot, HVT is the result of HVT._YKarayan expressed the genetics that they developed_YNDV (Newcastle Disease)

Sondermeijer et al., Vaccine, 11:349-358 (1993); Reddy et al., Vaccine

(1996) 14:469-477, IBDV (Darteil et al.,

Virology, 211:481-490 (1995); Tsukamoto et al., J. of Virology 20

(2002) 5637-5645:(11)76]. ــــــــــــــــــــــــــــــــــــــم

Johnson et al., Avian Disease, (ILTV) Laryngotracheitis Virus

2010) 1259-1251:(4)54[. If the cost of reconciliation); WO 92/03554; 6875856

GenBank acc. nr: to provide knowledge of the complete MDV2 genotype of the separator pattern

The genetic arrangement of the matrix pattern [Petherbridge et al., supra AB049735.1, 25].

٤٢٤٣

5

-٦-

MDV2 would be highly compatible with the HVT virion arrangement, as the US region is in a stacked manner, completely identical to its HVT virex counterpart [see Kingham et al., supra].

10

15

20

25

In addition, a virus resulting from a genetic linkage complex, known as the novel virus virus virus (NAHV), has been transmitted to the virus in which the N. The HVT virus is to be replaced by the corresponding regions in the genome of the HIV haplotype MDV1. The NAHV virus appears to be used to express the expression of the karya genes that contain_YThe number of anti-clide chelates available to US CDC for perhaps 5,965,138 6,913,751 [. The MDV, in the MDV, is also in a Yngotracheitis virus) and Ferrix and Irbis for my vilification_YChicken breast, in

Fuchs et al., Veterinary Research 38:261-279 (2007)

Y_YCaused by ILTV, there are two respiratory illnesses in the chicken, the condition is characterized by decreased breathing, diarrhea, and vomiting.

Efarazt Damknia. Viral replication is the key to the operation of the respiratory tract, while viral infection of the trachea causes erosion and hemorrhage of tissue.

Newcastle disease, which is associated with^AndD to neutralize its components_nFor chickens. It is the causative agent of Newcastle Disease and it is the virus of Newcastle Disease.

Newcastle Disease Virus (NDV).

Newcastle Disease includes Paramyxoviridae. T_YHe knew his name

Genome is an expression of the overflow of your soul, a non-generated R.L., like the new generation, with the expression karafi jini sibi. NDV viruses should be categorized in terms of the conflict or ground level as a loss to the degree of its vulnerability. Infection of the glands by non-toxic substances that are not naturally “non-pathogenic” to Vivirix (NDV) costs a lot of damage The factory of Kibbeh, Baaa, is a land. He also made the opposite of the opposite, so in the threads (such as the simplification of

(a large number of land) and equipped species and pest control (nurse) for NDV control._YBecause of two illnesses, they are complete as a result of the separation that is supposed to be sick. T_YMost types of NDV infect your respiratory system.

Nervous system, K.Y_Ymkv lv t_YIt leads to the Math as the text_Yes(stiffness of the groin muscles).

٤٢٤٣

-٧-

Infectious Bursal Disease Virus (IBDV), caused by_nGumboro disease is caused by the virus, which is the causative agent of immunodeficiency syndrome. in order to_YIBDV will be used as a treatment for a high-risk drug This is the same as the whole food, which is the same as whole chicken Gas Al-Munjafaa'i Assaffi Lamtiif Faker: Jafafaaarab

<p dir="rtl">5 Fabricius. The number of illnesses in villages exposed to high morbidity, with poor population loss, and efficiency rates range from moderate to high. It is not possible to enter the file date_YI died from the accident due to the destruction of Fabricius's cellar (but I passed it on). This leaves me vulnerable to injury again.</p>

IBDV is a member of the family Birnaviridae. The ferrexes are included in this floating genome.

<p dir="rtl">10 It consists of two segments (kb) in new double-stranded RNA. There are two serotypes of IBDV, serotype 1 and serotype 2, which can be distinguished by the novel A variant vian herpesvirus (NAHV). In winding the standard pattern 2 j_YCaused by an infestation that occurs only in turkeys. As a standard manufacturer, the IBDV Firefrix consists of 1 series type coil and only one type of disk with only one thousand IBD Firefrix devices.</p>

<p dir="rtl">15 “I want.” In recent years, so-called “mysterious” IBDV strains have emerged. Alternative and exotic strains of IBDV can be identified and differentiated by equation matching using each of the antigenic antibodies, provided by Wu et al., Avian Diseases, 51:515-526 (2007) [RT-PCR]. Old, well-known IBVD strains_nThis is the work of D78 and 52/70 Faragher and STC, with 89/03 in the phrase “Afn”, a confusing breed known as “Jeef”._nDa. There are many IBVD serums available to you and there is no one else.</p>

<p dir="rtl">20 The oil is available to many merchants_nYes, work for the sake of money, serum in money NOBILISR Gumboro D78</p>

(MSD Animal Health).

As effective as it is possible to achieve benefits, in Viverx HVT it is possible to do the work of all^AndA large amount of food is given to the child against Marek's Disease, which acts as a powerful poison Genetic ghat, it is j_YElian will serve as the Nable system for these multivalent timers using Innovax®-ILT (which

<p dir="rtl">25 T_YA commercial commodity such as a vacuum cleaner (Merck Animal Health).</p>

٤٢٤٣

5

-٨-

10

15

20

(laryngotracheitis virus (ILTV); Innovax®-ND-SB)_YCommercially sold by Merck Animal Health) as Vectormune® HVT-NDV (which_YA commercial sale in Kassatta

Ceva(,k^Andٿ Mnemḥa y_YKafr Mayyeh against NDV. However, there is currently no multivalent HVT vaccine available, and it is likely to be effective._nThe action of antibodies resulting from a genetic linkage complex derived from any pathogen._YThe whole community was able to build it stable and effective, even though the times seemed to be_YI came back more than 10 years ago to look for money, an American divorce, maybe 5,965,138. In the Cape, Innovax®-ILT consists of a proven genetic compound, HVT, which completes the work of genetics Reggae, meaning pl, ILTV gD or ILTV gI, the one who is the one_YBecause it can be compassionate, effective, and stable. However, both menstrual genes have the same pathogen as their cause._nDoing so, how can you manage to lose yourself?^AndNaturally, it is necessary for the different opinions to not be expressed in order to allow a valid wish against the ILTV virus.

As a result of this, your work is filled with huge losses due to the low costs of the compound Scythoma, LVEF

Non-pathogenic MDVnp resulting from a genetic linkage complex_YHow much is a roll?_Yvia karayan pfk^AndThe effectiveness of derived allergic antigens for each of the common pathogens, as well as the large number of compounds used in the description of the formulations, is Now, there is no such thing as a usual composition for a wrapper.

She couldn't wait to appear in Brisbane. Because of this, there is an additional necessity to support the mass production of pepper in the decaf industry, through the production of napkins, a new, stable, non-pathogenic Marek's Disease virus (MD). Vnp products resulting from the genetic linkage complex._YHow much does it cost?_YSaughter_YesIn multivalent areas, as a single oil to protect water from the common viral pathogens of Medicin R. MDV1 virus genotype.

If he takes advantage of the mother of Marj in this situation, he does not bark when his work is interpreted because he intends to poison me with semen, without that.

Al-Marj is a “previous palm” in relation to the desire of God.

25 General description of the invention

٤٢٤٣

5

-٩-

As a result of this, Y_YReceive the highest prices for new, stable, effective tablets for the non-pathogenic Marek's Disease ViviRex (rMDVnp). Resulting from genetic linkage to retrieve as a means of expression for typical allergic genes from multiple viral pathogens. In the first half of the models, the unwanted classifier type rMDVnp is almost certainly the same as the fodder for ferrets and cockroaches Genetic condition (rHVT). In alternative embodiments, the nonpathogenic Marek's Disease virus serotype rMDVnp is serotype 2 of the Marek's Disease virus genotype 2 (rMDV2)._Ymkf lf y_YIt will sometimes react against pathogenic decaf virus.

<p dir="rtl">10 In standard embodiments, the designed type rMDVnp comprises an embedded agent in an agent facility.</p>

Non-sense in the genome of the rMDVnp type The nucleotide sequence includes each of the nucleotide sequences that_YLaryngotracheitis Virus (ILTV) gD) and the cost of nicotinamides

<p dir="rtl">15 nucleotide sequence sequence_YIt provides protection against the common tracheal laryngotracheitis Virus (ILTV) type (ILTV). The second nucleotide consists of the nucleotide sequence._YIt contains the following types: Newcastle Disease (NDV). In examples of this type, the mixture contains the following: We also work out the cost of nucleotide sequences with a cost of 16 km.</p>

<p dir="rtl">20 The second nucleotide consists of a nucleotide sequence with a large ligand 15. In a combination embodiment, the rMDVnp haplotype and the rHVT virus are the product of a single gene linkage complex. In the alternative model, the genotype rMDVnp and rMDV2 are the result of a product of the genetic linkage complex.</p>

In some embodiments, the component is a non-core component of the rMDVnp designed pattern, such as a US2 component,

<p dir="rtl">25 While the audio file is non-primary and the non-primary volume for the rMDVnp mode is not specified</p>

٤٢٤٣

-١٠-

Rafael, the US2. The domain of the same is the piston, the piston is not the case. The Pistress is the Packet, the Sett, the Sasir In two models for two adders, the cost is a different base tire for the design type rMDVnp and the US2 dump is non-standard It's not a pattern

<p dir="rtl">5 The downloader is rMDVnp and the package is US10. In the Rachel model, the location is a non-essential location for the rMDVnp design type, and the US2 location is a non-essential location for the rMDVnp design type The volume is 54.5 UL. In half of the models, the rMDVnp and rHVT serotype represent the results of the gene binding complex GFY. In the alternative model, the rMDVnp genotype and the rMDV2 virus are the result of a product of the genetic linkage complex.</p>

<p dir="rtl">10 In LRL models, the non-core file is an agent and is itself the secondary non-core file for the filter type rMDVnp. There are half examples of this type, consisting of the same type of type, and the other type in the same type is made of the same DNA molecule, which constitutes a type Daryl is a non-legal codec for the designed pattern rMDVnp. If it is part of your money, D.L.L. of money and this_YLet's not be the set of Caray's expression_YLaryngotracheitis Virus</p>

<p dir="rtl">15 From the species ILTV (gD), the infection is caused by the virus (ILTV) gI, and the virus is Newcastle Disease (NDV) from the species F. In the agglutinin models of this species, the DNA molecule is composed of a nucleotide sequence 17. In basic embodiments, the genotype is rMDVnp and the rHVT virus results from the genetic linkage node.</p>

20 The rMDV2 virus is a virus resulting from a genetic linkage complex.

As a cost, in the above-mentioned models, the cost is only the original cost This is not standard for the rMDVnp design type and the US2 directory. In RL models, the unit is a non-essential unit and is a non-essential unit for the class mode rMDVnp and is a UL54.5 unit. In this example, the cost of paying a non-fundamental employee is as follows: Style

25 The standard rMDVnp is UL7/8. In the following models, the cost of adding money can be completely different.

٤٢٤٣

-١١-

Standard as the local site Non-standard for the rMDVnp design pattern and the US10 site. In seminal models, rMDVnp and rHVT are products of genetic linkage. In early models, the rMDVnp haplotype is a viral product resulting from the genetic linkage complex.

5 nucleotide sequence encoding ILTV gD, ILTV gD

gI, NDV F J_YIt may be that your business is an operation under the control of a foreign national, in other words, a foreign-controlled operation that exists under your control.^AndIt is normal in the viral class type MDVnp. In some embodiments, the costs of the various nucleotides and thus the cost of your operation are subject to greater control, in other words The nucleotide sequence mechanism of the lambrequin

10 The ILTV gD virus worldwide is controlled by an agent, and is dependent on nucleotides.

The ILTV gI program is controlled at the international level, and the control of the ILTV gI is independent.

Nycmicectides encoding the virex reactive factor NDV F at the practical level under the control of the third factor,

The first point of the word, the second point of view, and the third point are all related to each other. In the conventional models, the hidden factor is sufficient_YesD for nucleotide sequence

15 Which T_YFvr Lambrektive ILTV gD and the drama factory ILTV gD. In some embodiments, the masking agent suffices_YesD for the sequence of nucleotides encoding ILTV gI and the dermal antigen ILTV gI. In the above-mentioned model of this type, it is enough for the ruler to win_YesBlood cost of the nucleotide sequence encoding the lambrequin ILTV gD and the location of the dermal antigen ILTV gD_YesD. The nucleotide sequence encoded by ILTV gI.

20 And your drama channel ILTV gI. In some examples, the rMDVnp genotype and the rHVT virus are the products of fodder resulting from genetic cross-linking. In the alternative model, the rMDVnp serotype and the rMDV2 virus are the result of a product of the genetic linkage complex.

In some cases, your work would have been the same as the one related to the document.^AndThe cost of nucleotides encodes the ILTV gD protein, the ILTV gI protein, and the NDV F protein. It contains 25 ml of the double-stranded M5 virus Early human cytomegalovirus

٤٢٤٣

-١٢-

(immediate early (hCMV IE). In the first half of the examples of this type, the main reward_YesA summary of the cost of the nucleotide sequence encoding the NDV F protein, which is the causative agent of the hCMV IE virus. In half a dozen cases, almost everyone worked on the winnings related to your understanding.^AndBabel for analyzing the cost of nucleotides for ILTV gD, ILTV gI, and NDV F.

5 The gpX factor is a component of the pseudorabies virus (PRV).^AndBabel for the analysis of the nucleotide sequence encoding the ILTV gD, ILTV gI, and NDV F proteins in chickens. In half models, the master can win_Yesdm for the cost of nucleotides that induce NDV F, which induce hCMV IE, and

10 The key is the hidden key_YesBlood cost of ILTV gD, which is the endogenous substance of ILTV gD, and is the endogenous substance_YesD to the nucleotide nucleotides encoding ILTV gI and the drug enzyme ILTV gI.

15

20

In some embodiments, the serological pattern of the rMDVnp type is not known for the high quality of the ligands of ILTV gD, ILTV gD, or IL TV gI, both NDV F proteins are included in each of the following copy terminator sequences. In transcript models of this variant, the integrity of the transcription terminators in the non-copy sequence is the same as the nucleotides encoded by the NDV F reduct. In the above models, the costs of ILTV gD and ILTV gI are included in the copy termination cost as complementary to the cost of ILTV gD The NDV F protein is a dependent replication terminator. In solid models, a function block consists of a number of copy termination sequences.

synthetic polyadenylation facility polyadenylation work process cost

sequence. In similar examples, the cost of transcription termination involves making a thymidine kinase to process the polyadenylation of a herpes simplex compound Virus thymidine kinase (HSV TK) Genetic correlation in the model

٤٢٤٣

-١٣-

The rMDVnp genotype, rMDV2 virus, is a viral product resulting from the genetic linkage complex.

Y_YLaryngotracheitis

5 2) Virus(ILTV) gD) Encoder for Perectiv 3) ILTV gD (MV for Perectiv) 4 (ILTV gI)

Low cost of polyphagoprotein (ILTV gI) m FGFs FGFKCRM early multi-leukemia (ILTV gI) (6) hCMV IE encoding cost for the NDV F vaccine, as (7) the transcription termination cost.

A simple example of this type. Your type is also completed with a working genetic linkage contract. The nucleotide sequence has a 17-nucleotide sequence.

<p dir="rtl">10 Y_YAchieve the greatest heights to add two educational styles rMDVnp in which you want to reach the depths of your heart with certainty</p>

Genetic linkage for the height of the rMDVnp haplotype. In some embodiments of this type, the genotype rMDVnp is a language in a non-legal place that includes a genetic linkage of the same type In the sequence 5' to 3', make the following order (1) Laryngotracheitis Virus (ILTV) gD

<p dir="rtl">15 (2) Break-even cost for two pools (3), ILTV gD, win for two pools (ILTV gI), 4) Break-even cost</p>

The cost of the encoding virus for the NDV F virus (6), (6) is the cost of the NDV replication terminator (7) in half of the models._YCost of the cost of the related nucleotide costs, including linkages, break-even costs, and/or all separately disclosed costs, as a result of the liability, see Box 1 below The. In a compact model, the rHVT is completed dependently

<p dir="rtl">20 A nucleotide sequence with a 17-nucleotide bond that is glycated as a non-stanic compound. In standard models of this type, it is a non-essential capacitor and is a US2 capacitor. In all models, the dump is a non-essential dump and is a UL54.5 dump. In all models, the capacitor is non-essential and is a UL7/8 capacitor. In addition to all models, the site is non-essential and is the US10 site. In some examples, the default type is rMDVnp and</p>

٤٢٤٣

-١٤-

Vivirrex rHVT is the result of a genetic gene mutation. In the alternative model, the rMDVnp genotype and the rMDV2 virus are the result of a product of the genetic linkage complex.

Y_YProvide the highest levels of prosperity to create a path for the growth industry^AndI designed rMDVnp for the high altitude. In some models, your food costs are covered by a reasonable cost expense Your work costs

5 nucleotide sequence T_YILTV gD protein, nucleotide sequence cost_YProvide the ILTV gI protein, and the cost of the nucleotide sequence._YSave for the NDV F complex. All of the different flavors will then be delivered to a non-linguistic source for the country.^AndrMDVnp myocardial infarction. In some models, the entire configuration of the non-configured smartphone is a caravan expression set. In the above half examples of this type, a group completes

10 Expression of the nucleotide sequence with a structure 17. In LRIL embodiments, an isotropic agent containing the nucleotide sequence is cleaved._YThe ILTV gD protein is a nucleotide sequence that_YFFR Labractive ILTV gI; The nucleotide sequence is produced in a complex nucleotide sequence._YNDV F. Introduction

15 In the 1970s, it was a monolithic confederation by Daryl McMil US2^AndrMDVnp standard mode The second tone is configured using a non-wireless amplifier as an alternative to the rMDVnp standard mode. In some embodiments, the isoforms are CARRAE expression complexes. In the above-described models for this type of project, it is assumed that the cost variable worked The cost of a nucleotide sequence with a quantity of 16, and the nucleotide represents the second nucleotide.

20 The adaptation variable in the nucleotide sequence equation with a nucleotide sequence 15. In text models, the way to make a model^AndI designed a method for making rMDVnp viruses^AndI was diagnosed with rHVT. In the alternative models, it is the way to make a dream^AndWhat is the solution for rMDVnp and how to make it?^AndDesigned for rMDV2.

Y_YProvide the patient with immunostimulating formulations and/or vaccines that contain a serotype marker.

25 For Liverx rMDVnp to raise the price. In semi-automatic models, the class pattern rMDVnp can...

٤٢٤٣

-١٥-

Virex rHVT. In the original models, the stereotyped type rMDVnp is the same as rMDV2. In addition, Y_YThe vaccine is provided in a way to help protect the vaccine against a disease caused by ViviRex ILTV and/or ViviRex NDV and/or MDV1 if there is a vaccine that does not have an antigenic combination Immunity to the art is the most important thing. In some cases, these methods help in protecting chickens.

5 In certain embodiments of this variant, the high-altitude vaccine is administered by the freeze-dried route. In LR models, the incubation vaccine is administered by means of egg arrest.

As a result of this, there is no place like this._YProviding the highest levels of effective formulations for stable and resilient immunity, including ingredients containing^AndThe rMDVnp video is designed for maximum speed. Y_YProviding the highest levels of immunostimulating formulations and/or vaccines containing a designed type containing the rMDVnp virus.

10 Due to the high altitude, this can guarantee the lack of antibodies to the virus, ILTV, NDV, and/or MDV, as well as the ability to generate immunity.ⁿBlood. In addition, Y_YProvide the highest height to add expensive installations to prevent you from finding taffeta blocks that complete the work of a plastering plaster. My LiveFX MDVnp

To raise nutritious food, it is enough to add a vaccine against a pathogen, such as ILTV, MDV, or NDV. In the lead model of this type, you are the one who is the enemy and you are the one who is the enemy of Virx

15 IBDV

In the Lacar model, the IBDV antigen is mild IBDV. In certain embodiments, the specified IBDV may be replaced by a substituted IBDV. Let the ascension deepen, take care of my dear ones_nI added a way to help with chicken water for my purpose._YCaused by ILTV, NDV, MDV1, and IBDV from administration of food, this serum, and the Madkagen immune complex (made by livestock, chickens).

20 In formula models of this type, lead serum is administered in high-quality freeze-dried bottles. In LL models, a serum agglutinin is given to the follicles in the egg.

In certain embodiments, the immunological formulations include an rHVT component as a component B US2 is the product of a genetic recombination complex containing 5' to 3': (1) gD for the carpentry virus. Laryngotracheitis Virus

25 (ILTV); (2) The cost of producing a two-block compound ILTV gD; (3) The cost of ILTV gI; (4) The cost of

٤٢٤٣

-١٦-

Encapsulation of a two-barrel aggregator ILTV gI; (5) The cost of the early human HCMV virus (hCMV IE); (6) the cost of transcribing a compound with a fusion protein for Newcastle disease (NDV F); (7) the cost of cloning In certain examples of this trait, the combinations are complete. Immune system and/or serum_nAdded to the work of the IBD virus

5 Yes, moderate. In certain embodiments, the moderate IBDV in terms of IBDV is confusing. On specific models, the IBDV is 89/03. In Lacarre compound models of this species, the nickel is the product of a gene cluster with a nickmectide sequence with an identity of 17.

Y_YThere are many expensive formulations to add to your immunity, so you can complete a serum profile for rMDV np for high altitude It costs a lot of money to live in New Delhi, ILTV, NDV, and/or MDV

10 Additional pathogens include MDV, ILTV, and NDV.

And that's how the jokes go to the heights of the sky that will be appreciated by you.^AndPlease refer to the following examples and a detailed description of the current situation.

15 Brief explanation of the drawings

20

Each (1) HVT (FC126) genome, consisting of a unique long (UL) region and a unique short (US) region, each of which is indicated by straight bands and is surrounded by regions Duplicate, They are indicated as squares at the bottom of the spectrogram of your gene._HIt is a complex work to add BamHI restriction enzymes, with respect to the size of the genome they contain, and the elegant name associated with each part. (The largest parts were given the “A” column, and the next shelf. In the largest part, the “B” room was removed, as well as the following columns.)_YEquivalent to each cloned sub-genichemist (named) used for re-infection of the Emilia Vivivirx FC126 (HVT) for you rHVT/NDV/ILT and NGV_HPlease refer to the description of BamHI restriction enzymes. Ktd_YThe asterisk mark (*) is a work with a price tag: UL7/UL8 in...

٤٢٤٣

-١٧-

Nicola cosmid 1196-05.1; UL54.5 in Plasmid 29.4-1332; As US2, you have the transport code 1332-47.A2, and you have the transport code 1317-15.1-1.

All (2) is a diagram of a series of interconnected HVT virxes that are genetically linked, which is_YThe description of the genes involved in the basic structure of the HVT virus and the site of its introduction. Innovax-LT and K vaccine

5 In other words, rHVT is the product of the genetic linkage agreement, which means that the caraval expression group is described as a single gene. The ILTV gD and ILTV gI are installed in a UL54.5 LMP-1000 rHVT. The Innovax-ND vaccine is an rHVT virus resulting from genetic linkage analysis that allows

Your collection of expressions as a source for your needs. Integration of the NDV mklvfklg fffkfkfkfkfkfkfkfk US10 for the rHVT. The 1348-34C vaccine is an effective all-in-one vaccine for rHVT.

10 The Karaki expression set is coded for the ILTV gD and ILTV gI genes, which are packaged in a UL54.5 assembly for the rHVT virus, and the Karaki expression set is coded for the fusion gene for the NDV virus. You are in a US10 cable for FireX rHVT. Vaccine 1332-62E and all of you in the phrase fodder for ViviRex rHVT, which includes the whole expression group

Karai encodes the ILTV gI, ILTV gD, and NDV fusion genes encoded in the US2 recombination of the rHVT virus. Vaccine 46-1317 is a rHVT virus derived from the CARAI expression kit.

15 The ILTV gD and ILTV gI genes are coded for the US2 gene, and the CarAi expression complex is coded for the NDV fusion gene, coded for UL7 and UL8 (i.e RF, UL7/8 (UL7/8) for Vivirix rHVT. Vaccine 1332-70B, which is a vaccine for ViviRex rHVT, which is completely safe. A caray expression set encoding the fusion genes ILTV gI, ILTV gD, and NDV coded in the UL54.5 assembly for the rHVT virus.

20

Detailed description:

25

The high cost of the previous industrial class related to the ability to make rMDVnp projectile discharges related to your country^AndOf the allergic antibodies that can cause T_YKafr Maya against all types of virx pathogens found in Docans by providing unique MDV np injections resulting from MAV This is the genetic link between the two countries._YFvver kt_YAbavar, Karaiyan, Eph, Mlichlidat, the frog

٤٢٤٣

-١٨-

The model is a file format for ILTV, NDV, and other formats._YSuch as Marek's Disease, Newcastle Disease, Laryngotracheitis Virus. In the first half model,_YSo He forgave you_YAbbafar Karayevian IlTV

5 NDV only, it can only be downloaded_YHelp against Marek's Disease, a disease

Newcastle Disease, laryngotracheitis Virus. In a semi-automatic model, the classifier type rMDVnp and the classifier type rHVT are all enough. In early models, the type rMDVnp is designated as .rMDV2

At such a high level, Nabeul's HVT injections have already been completed, including a 10-pound NDV vaccine in the US10 region. The HVT-NDV tube is stable and reliable._YAbavar Karayavan Afif

Sufficient stocks of the NDV supplement, NDV F, and whole grains._YTo protect your summer chickens from exposure to harmful NDV additives. In addition, the company's HVT technology has already been lost The ILTV is located in the UL54.5 region of the HVT. HVT-ILTV is a stable country in Nepal and this country is stable._YAbbar Karayayan Afif

15 Sufficient levels of the products corresponding to the ILTV gene, such as the ILTV proteases from the myrtle gI and gD, are_YKafr Maya for summer chickens vaccinated against exposure to the virulent ILTV virus.

20

25

Accordingly, a multivalent formulation HVT has been designed to protect against both NDV and ILTV._nThe resulting combinations include, i.e., the insertion of the NDV-F gene into the US10 plot and the insertion of the ILTV gD and gI genes into the UL54.5 plot [to see, 1348-34C into the plot [2]. However, it is in an unpronounced wordⁿAfter this combination was used in tissue cultures, the virus lost expression of the proteins ILTVgI, ILTVgD, and NDV F. This is the result of a genetic linkage complex This is the genetic link to rHVT. In Cape Town, these virions resulting from genetic linkage were unstable and unsuitable for development in specific locations. These results show that Napoleon's design is a multivalent component of rHVT that covers your jaw.^Andۻ stable for y_YTrans Karayan Af Kl^AndNDV F contains proteins

٤٢٤٣

-١٩-

ILTVgD like ILTVgI is not a simple process that..._YThey cannot be extrapolated from existing information. In the future, if multivalent multivalent supplements are available, multivalent multivalent supplements for rHVT are feasible. It is very beautiful, so its design is very attractive._YAn unreported group actⁿThe problem with complicated transactionsⁿThe language of God

It must be included in the box at the master's place of delivery_YesDermatology of allergic genes required for treatment. T

Now, the design of rHVT formulations cannot be easily traced from the conventional wisdom.

10

15

20

25

MG_YWe are the most important of the rituals It is the case of the Jenx ILTV as a jam, as the Firex NDV. In this model, all of the genetic genes were introduced into the US2 region of the HVT genome. When chickens incubate their eggs with this rHVT vaccine, the family members expressed half a caraway for the protein...ⁿSee it with the coated gene cassette. It's a problem_nTherefore, the NDV and ILTV proteins expressed in rHVT caused a violent immune response in chickens caught in the vaccine against the intended target. Using NDV and ILTV video media. In addition, it is possible to use the filter type rMDVnp in_YHow much is a roll?_YYou will be able to recover from the negative problems that you face in every way.^AndMultimedia files, FireX, NDV and ILTV. In the past, rHVT withdrawal was necessary for the treatment of both anticonvulsants and ferrexine, as always Protection against the ILTV virus is a protection against the NDV virus.

For this reason, high altitude is useful for everyone on the roads._YA hundred meters ago

Against the ILTV virus against NDV, with a vaccination kit, decagon eggs with the MDVnp virus only, genetic linkage replications. In a reasonable manner, it would not allow for additional vaccinations to be given on the way to the nutritional value of the sheep, in which case the amount of the nutritional burden would be reduced._YIt is expensive to ride a jet boat in Darfur.

Egg, cake to save on manufacturing costs due to weathering.^AndThen Nabeul was almost only two countries from Nabeul. In addition to doing so, it would be possible to include an additional antigen in the serum for IBDV, for example strain 89/03.

Ka'alaka_nIn doing so, the following two models are added, which enable the creation of multiple combinations of the rMDVnp parameter in the same context He/she has immunomodulatory formulations. In some models and such

٤٢٤٣

-٢٠-

In this way, the contract includes the required composition of the work of the RMDV2 RMDV HVT, KK_Hٿ Mnemma y_YProvide you with plenty of antibodies. In Cape Verde, the cost of reducing the cost of ferroelectric (rHVTs), which leads to a combination that generates significant energy savings for everyone. In the first place, the combination of Vivirex rHVT and Vivirex rMDV2 leads to the improvement of this condition.

5 Great.

For this reason, in half cases, a vaccine for high-grade HIV has the effect of rHVT._YThe prolactin ILTVgD, the prolactin ILTVgI, and the prolactin NDV F contain the rMDV2 virus._YIt provides protection against one of the viral antibodies for Medicag.

This is due to the increase in the estimate of the full value of the area_nThe following definitions are provided.

10 The use of singular phrasal verbs for the sake of appropriateness in the description is not intended to be entirely^And�����������������������������������������

Yo

I am a resident of Ghana in a very large way. For your sake, your work is for you, for your sake, for your sake, for your sake, for your sake, for your sake. Composition

The word "polypeptide CAD" means that CAD refers to any of these polypeptides.

As well as Mr_YesIn this case, "Non-pathogenic Marek's Disease Virus" means "MDVnp" and "npMDV" means the phrase Virus in the MDV family in my country._YThe back of the neck is wrapped

15 My land is for you, for your sake, for your sake, for your sake, for your sake GF. It is necessary to use the refinery aspiring "MDVnp" to extract it.

Existing MDVs are decrypted^AndIt is natural that it was passed through

You have a single memory for the first time

Treating it in different ways,

However, it does not include the phylogenetic structures in which a specific genome is replaced by a class pattern.

There is a MDV location in the area corresponding to the MDV classifier for the cost of the MDV repair, money New hemispheres (NAHV). In some embodiments, the design pattern is missing

20 MDVnp and Firefox HVT. In Rachel models, the class mode is MDVnp and FireX MDV2. In models with this variant, the genotype MDV2 and SB1 are sufficient.

As for you and for you as a master_YesIn this case, there is a class pattern for VirRex MDVnp that was modified by Karanian in order to..._YThe variant of the heterogeneous nucleotide sequence is designated as “MDVnp” and “rMDVnp”.

٤٢٤٣

-٢١-

How much and how many times you are a mistress_YesIn this case, "non-Syrian sex" is a phrase containing sex in the MDV genome that is being inserted The cost of nucleotide sequences is heterogeneous. This caused the Yemeni virus MDVnp to replicate in the host family. Non-essential landfills are defined by the number of seeds in which all the landfills are located, such as landfill US2, for each area between two parts of the site, such as landfill UL7/8.

As well as Mr_YesD in the humiliation of the situation_YThe term "deckage" includes chicken, turkey, duck, eagle, quail, and peregrine falcon.

10

15

You are a master_YesIn this context, the word “vaccine” means a formulation that is suitable for vaccines that are

(Which includes, in some examples, the gender of the word, so where is it because in examples of the word it is possible to work like this

The risk of being identified as a gender-neutral person (which means that you can do the same for every million people who live in HIV/AIDS).

Two typical countries of Nabeul came before pharmacy, where there was no liquid industry, which_YThis happens when you give a negative response to it that is sufficient to compensate for it being sufficient to compensate for it.^AndThere are many forms of unruly behavior in the world, in other words, You are sufficiently adequate in order to compromise on the extent of the medical illness, and/or for the sake of hope, etc._YA way to treat clinical disease.

As well as Mr_YesIn this context, the term “multivalent vaccine” means a vaccine containing one kilogram of recombinant antibodies. There is a lead model in this situation,_YThe multivalent immune system wins the key to receptor antibodies against each of the recombinant pathogens.

As well as Mr_YesIn this context, the term “helps in doing so” does not require the full meaning of anything.

20 Indication of infection with pneumonia. For money, yes_YCoverage The phrase “aids in the protection” means covert cover that is sufficient because, after exposure to injury, the former’s land can be denied employment All, K/Lak, Laf, Kadl, Lak, K/Lak, Laf, Kadul, Lak, Kafr, Kafr, Ka'la, reasons for you. Underlying cellular mechanisms, physiological, and underlying biochemical causes, causing the earth to be rejected and to be rejected. He barks at me_YIn a wrap

٤٢٤٣

5

-٢٢-

The term "rejected", as Mr_YesBlood in the context, in relation to the disease, means the disease, which includes the molecular machinery of infection, not only the physiological machinery of infection.

You are a master_YesIn this context, the term “adjuvant material” means material that enables a supportive action to include a number of critical events It ultimately results in an immune response to a host, meaning, an integrated physical response to a hostile substance. This is a helpful video that can help you.^AndThis is not a major requirement for a severe immune response event, but it is the capital of South Korea._YThis made the response difficult.

10

15

20

K as and Mister_YesIn this case, the term “pharmaceutically acceptable” is used.^AndAs a dispenser, it means wrapping the medication according to the condition that it is suitable for use in a pharmaceutical product. When it is used, it is used as a precursor to describe the precursor to a pharmaceutical vaccine, its description gives the precursor its characteristic In order to be compatible, all components of each structure are compatible because they are not in conflict with each other.

Unzip^AndNot relevant to the intended future of the vaccine.

As you are, Mr_YesIn the case of the vicinity, "Systemic administration" is enough, " Cardiovascular as the Lymphatic System (, Thus, this reflects the functions of the entire body without additional meanings, such as the gastroesophageal duct (through the mouth or rectal administration) or the respiratory system On the way to Malan's injections, Daryl Envan intranasal administration._YThe functions of the organs are carried out by administering the intramuscular tissue, intradermal or transdermal administration, subcutaneous administration, etc The layer is submucosal (submucosal). �������������������� Kurdah (intravenous Kurdah) to rrrrl.

٤٢٤٣

5

-٢٣-

As well as Mr_YesIn this context, the term “non-stop administrations” includes the blood vessels, the arterial canals, the articular canals, and the muscle canals lt, the cannibals of the gallbladder, and the infusion.

The term “two approximations” can be retrieved with decoding^AndInterchange the term "cal" with the meaning of the value within the letter "k" as a definition in the percent of the value referred to, meaning "rrr", so the "peptide" constitutes two "approximations" of 100 as constructive units Yes, for the sake of my life_YIt costs 75 to 125 thousand for a building block of amino acid.

10

15

How much and how much you are in control_YesIn this context, it is intended to use the term, “polypeptide” in order to^AndYou can exchange all the ingredients for “Bacteractin” and “Peptide” as a compound. Your work will be done on your own. What is the amino acid attached to each other by peptide bonds? The term "polypeptide" is used as a term_YesIn this case, I have provided you with a large amount of information, and it includes an extension of the construction materials that you can stand on Darel had a job for the past 8 years, and he had two jobs for the past 12 years, and they were typical for the past 16 years. For the past of Minnya, k pfk^And20 of the past years, and in the forms joined by the word^AndRsa, it will stop the 30, for you, for you, for the past, in the past, M, 35, 40, 45, 50, It was possible to complete the term that replaces y/l and ends in literal at all pasts, since it is changed at structural codes 1, 2, 3, to errl, and it ends at, 155, 154, 153, to errl, in all assignments. Universality.

Unzip^AndIn this way, the polypeptide must be derived from some structural components that are encoded by genes, each of which is a part of the messenger RNA. For money, the gene has a 20-molecule messenger RNA._YSave on the cost of construction materials and the final work plan - polypeptide

(i.e., redundancy cost) that is separated from the polypeptide, and for this reason, two parts of the final polypeptide are not needed.

As well as Mr_YesD - In the humiliation of the situation, the term “jazzat mukalid lamadad” is sufficient for what is generalⁿI am the one who is the one who is missing my money.

٤٢٤٣

5

-٢٤-

It is a small amount of money that comes from the whole world) which is due to the enemy, meaning, in order to understand the work of dealing with you.^AndA unique molecule that distinguishes all of the frogs found in the device.

Immune system, your immune system is immune (antibody) because you have a future born against the immune system T._nCreated in the NDV merger complex, the two_nIt is filled with two fusion factors, which is characterized by the fact that it is an antigen. K pvc^AndFrom now on, I have isolated a antigen for the antigen that is immunodominant for the recognition of the antibody and/or the T receptor.

10

15

20

As well as Mr_YesD In this way, the equation of two integers 100 is “identical” to the equation of two integer equations if the two summation sequences are perfectly complementary, and are bound only by their equivalent substitutions How much you need to know and what you need to know in Denver. As a result, the cost of overcoming the Minigli industry 80: “Matching” the cost of the Minievian surplus 80

They are completely complementary, and are combined only by equivalent conservative substitutions.

The construction companies have equivalent professional backgrounds and functions._YIt is an expensive component that is often replaced with structural components within the sequence, which leads to the replacement of amino acid reserves. That confusion_YHe defined the term “replace with what is preserved” as a substitute_YesThis is the situation. Work for money, y_YIt is expensive to replace each of the employees of the construction company who has previously worked within the cost, in addition to a salary of a similar nature, who works as a job employee, an employee A y_Yِِأُعِِِِِِِِِِِِِِِِِِِِِِِِِِِِ Officerِِ Officer Substitution transitions must be made with a minimum guarantee within the dependency of individual members in the category to which the minimum guarantee belongs. Working for money, reflecting on the non-polar secular past (alanine), alanine

leucine, isoleucine, valine, proline, phenylalanine, tryptophan and

methionine. The industrial past of making aromatic antiseptic formulations such as phenylalanine and phenylalanine.

glycine, tryptophan, and tyrosine. serine, threonine, cysteine, tyrosine, asparagine, and glutamine

Minerals: lysine, arginine, histidine, taffeta Negative pastes include aspartic acid and glutamic acid.

٤٢٤٣

5

-٢٥-

The bias meant the y_YTkbⁿHow much is the apparent molecular weight?ⁿDetermine the electronegativity using a polyacrylamide gel, which has a point of electronegativity.

10

Unpacked retainer replacements^AndRatio: lysine instead of arginine and vice versa_YI can't do this in the most conservative way_YIt is obligatory; glutamic instead of aspartic and vice versa_YI can't do this in the most conservative way_Ynegative nh; Serif Badalan M Arkniv Yth_YI can't do that_YIn this way, it is possible to maintain the work of the other person free of charge --OH can be

maintained --OH; As Gln instead of Asn where_YIn this way, it is possible to preserve the work of NH2. Minor points to add_nY_YThe cost of a coil placed in the following combinations: (1)

glutamine, asparagine, (2); proline, alanine, glycine, serine, and threonine

glutamic acid, and aspartic acid; (3) histidine, lysine, and arginine; (4)

phenylalanine, (6); valine, leucine, isoleucine, methionine (5); cysteine, tyrosine, and tryptophan

In the model of slander, Y_YIt is not possible to distinguish between the two identical DNA sequences for protection by their lead identity, but they apply identical technical definitions._YI love you so much. Money and this comparison of costs

15 Y_YThey can be implemented by using basic statistical software that is available in the costs data bank.

In a compact model_YProvide two identical sequences to protect from the DNA costs of the past years in which the proportion of the application of the 2000 estimate is 80:^AndOf those who added to Kakar Kalali 90: Percentage that matches the meaning of the word^AndMan Nadlal Kakar Kalali 95: Applicable percentage. K pfk^AndFor each letter, two identical sequences are completed to protect a matching ratio of approximately 80:^AndWho fought for Karkali 90: Matching percentage was

20 Unzip^And100% matching rate.

As well as Mr_YesD in the humiliation of the Kaya, y_YThe cost of calculating the percentage matching of the cost of the two prolactin is estimated as

DNA using European software (MacVector v9, available commercially available) (Accelrys Burlington, Massachusetts) as well as standard alignment standards Intention to match ratio to consider, Malan Thompson, et al, 1994. Nucleic

And in any software_YIts cost includes two labor fees for the Clustal W.Acids Res system. 22:4673-4680 25

٤٢٤٣

-٢٦-

Technical analysis in Macintosh, Dos and Unix programs from EMBLI, Malan EMBLI Institute for Adaptive Technology. If you confuse the words of Michael,_YIt is expensive to find your expensive work http://www.ebi.ac.uk/clustalw. Thus, I will throw you with you, I will throw you to Rachael, who will add to you._Y1 kg roll_YThey will be used to determine the reliability balance by using the same default criteria for each corresponding default criteria.

<p dir="rtl">5 How much and how much you have mastered_YesIn this way, the use of the compounds "polynucleotide" means that you have "more of your part" than you have "part of your part".^AndExchange the meaning of a complementary molecule of complementary nucleotides</p>

Work, but it is not limited to the work, costs of DNA, complementary RNA, genomic DNA_YesBl k tv

Higher DNA costs. Synthetics are used to add synthetic molecules that contain a number of base isotopes known in the technical field, DNA or RNA.

<p dir="rtl">10 “Depreciation cost” means the same cost as the “explained cost” for two proteins, meaning each peptide, and its equivalent cost The nucleotide sequence that is translated into a polypeptide in the laboratory in the body when it is placed under the control of the appropriate regulatory elements.</p>

The cost of translating with a simple symbols will increase by the end of the day - 5' symbols for translation The stubbornness of the end - 3'. Y_YThe cost of wrapping is the cost of wrapping, but it is not limited to work, the costs of objects are primitive.

<p dir="rtl">15 Spectrum, deoxyribonucleic acid DNA from ribonucleic acid messenger RNA of xenobiotic organisms, glycoproteins from xenobiotic organisms Cr(</p>

DNA, how many deoxyribonucleic acid waste DNA costs. Y_YIt may not be expensive

Transcription ends that are folded at the 3' end of the coding sequence.

Tver phrase “linked to decrypt^And"Babylon to transform" into an arrangement of elements in which the components are described as well as

<p dir="rtl">20 You have prepared for all of you._YImplementing its usual functions. Therefore, the officers attached to the^AndBabafel</p>

To analyze the cost of saving, it is necessary to use the Karay expression for the cost of saving. The controlling elements do not need to be identical to the cost of savings, as long as the elements do the job of calculating the expression.

Caray for me. Therefore, for the sake of money, the recurring dependencies are not translated but are not translated.

٤٢٤٣

5

-٢٧-

Y_YThe cost of saving how much it costs to remove the money from the profit_YIt is considered “related to dismantling.”^And“Babylon Interpretation” means the possibility of interpretation.

You are a master_YesIn this context, the term “copy completion cost” is used to explain^AndShare the term “polyadenylation cleaning agent” and the cost of your work in cleaning your area. To transcribe DNA, you will need two coats to coat the entire container to replicate the transcoding process attached to the DNA.

As much as you are a master_YesIn this sense, the “Cakara expression set” is a kind of genetic relatedness concept that is based on a heterogeneous coding mechanism associated with each chapter I don't know what that pain is. In many of these examples, the Karaoke Expression Assembly is completed to add 10 jobs to the cost of copying completion. In addition, the introduction of the Karay-Darrell expression set is a non-scientific source for the designer pattern of the rMDVnp gene._YThis could lead to the successful expression of the allosteric coding mechanism using the rMDVnp classifier. In half cases, the pattern is rMDVnp and rHVT. In early models, the rMDVnp pattern is rMDV2.

15

20

25

“The cost of nucleotide sequences is a heterogeneous configuration,” according to Klak, Mr._YesIn this case, the cost of the nucleotides is added to the cost of the high-altitude nucleotides using a multi-coupled method The genetic linkage complex to control the flow of your bad taste, which cannot be created by your love.^AndIt is natural for two people in nature. In the following models, the “cost of heterogeneous nucleotides” for the highest level_Ymkv lv t_YProvide the antigens for NDV F, ILTV gI, and ILTV gD. Costs of isomerized nucleotides_YIt is possible to add to the T_YIn addition, the cost of fusion mechanisms is different Adaptation j_YOne kilogram per roll_YThese are peptides and/or proteins that contain structural and/or regulatory leads. In similar models, the cost of isomeric nucleotide_YHow much is a roll?_YProviding the protein with a peptide that acts as a supplement for the protein, the peptide.ⁿBy relying on nicotinamides for the next offspring, it is enough for you to use the genetic linkage conventions without changing the term “kareyan”. In the model, to add,_YCost of the cost Thousands of costs

٤٢٤٣

-٢٨-

Nicomatics to increase the quality of food. Y_YThe cost of a TV wrap, the cost of electronic components, the cost adjustment facility, and the work of unexplained, integrated, and non-explanatory requirements, including various locations, regulatory locations, and so on.

The previous introduction of an antigen known as the rMDVnp antigen is easily accomplished when the ends meet you.^AndIn the past, Nabeul has worked together to work together. K 5 If it is not possible to do this or that, then it will cost you the burden of the generous burden of the poor The cost of the nucleotide sequence and/or the nucleotide sequence is carried out by digestion of new nucleotide supernatants (such as DNA supernatants) that have been modified by cleavage by the restriction enzyme endonuclease to produce Likewise, the same result can be achieved by simply unscrewing the new ends with an appropriate polymerase enzyme.

10

And so on, yes_YIt is expensive to produce the desired compound, simply by attaching the oligonucleotides (ligands) to the ends. The ligands must consist of specific oligonucleotide sequences that determine the desired restriction sites.

The restriction sites can be synthesized using a polymerase chain reaction (PCR). To see, see Saiki et al., Science 15 (1988) 239:487-491].

It is necessary to modify the blasted napkin to bind the DNA, if necessary, by means of the corresponding plasmid tracer.

Protein antibodies, as well as the cryptic DNA of proteobacterial antibodies.

20

IF GIF ILTV gD Ydbdak Nah J_YThe glycoprotein is made up of 434 amino acids in the child and has two molecular weights of 48,477 dals, despite the fact that there are 377 nucleotides in the gene pool Yes From ancient times, it could be the actual country code. [Wild et al., Virus Genes (1996) 116–12:104]. Y_YThe ILTV gI gene, the glycoprotein, contains a number of 362 technical functions throughout the species, and it consists of two closed molecular components Darl 39.753 Daltvik at high altitude

٤٢٤٣

5

-٢٩-

American building number 6875856, including its facilities in this case as a garage [. Laboratory-contained antigens of natural tests and laboratory-contained antigens for ILTV gD and ILTV gI proteins are to be replaced by complementary proteins in this context.

10

In the highest-ranking model, the rMDVnp genotype is completed using a genetic linkage complex (KARAI expression complex)._YThe ILTV gD protein, which is based on the mechanism of the antigen, has the same potential as 2 molecules that are specific to an antigen of the same type. In relevant models, the rMDVnp design pattern generally follows the development of genetic linkage institutes._YGiven the given formula ILTV gD with a minimum absolute cost that has a matching ratio for the largest mn 90:, k/lk for the largest mn 95:, k/lk for the largest mn 98:, k/lk for the largest mn 99: m There is a Lord and a Creator 2. In the classical embodiments, the ILTV gD protein is encoded by a nucleotide sequence with a composition and sequence of 1. In one example, It is enough for you to read the class pattern rMDVnp and to take care of rHVT. In early models, the type rMDVnp is designated as .rMDV2

In some high-income models, a detailed classification pattern is very clear to you Genetic association (malan Karai expression complex)._YProvide the cost of the proposed ILTV gI complex.

<p dir="rtl">15 There is a specific antigen that has a strong potential 4, but it is a compound that is associated with an antigen of the same type. In relevant models, the rMDVnp genotype includes the genetic linkage complexes_YGiven the potential ILTV gI fraction, the equation of the minimum is given by a matching ratio of 90:, k/kg, of 95:, k/kg, of 98:, k/kg, of 99:m, the minimum cost He has greatness and creation 4. In the above examples, the ILTV gI protein is encoded by a synthetic nucleotide basophil.</p>

<p dir="rtl">20 sequence with a sequence definition3. In the first half of the model, the class mode is rMDVnp and all types are rHVT. In early models, the rMDVnp isotype is called rMDV2.</p>

Y_YFFR Jeff PracticalNDV F Why J_YKnown as the “merger” pool. The NDV vaccine was derived as a strain of the NDV vaccine FFAY J_YThe Geneva Floating Maritime Fleet was created. Explained terms and conditions

<p dir="rtl">25 It will cost you to operate in your country.</p>

٤٢٤٣

-٣٠-

Equality in terms of the application Sakat_HIt was a non-virulent, moderately virulent, pathogenic strain of the NDV virus. It is responsible for the protection of both the periwinkle and the periwinkle. What is the result of NDV? In the upper half-highest models, it is likely that^AndrMDVnp designers have worked on explaining the genetic association conventions (meaning of the karaage expression group)

<p dir="rtl">5 Slander_YProvide the fusion protein in the NDV virus, which is supposed to work independently in terms of possible quantity of 6 molecules that generate an antigen of its own genus. In relevant embodiments, the designed type rMDVnp is complete</p>

Since then, there are genetic linkage institutes._YProvide the two NDF complexes F that are expected to make a mixture cost for a mini that has a conformity ratio of 90:, The cost of surplus for a mini-mini with a certain amount of money 6 In half models, it is not possible to explain.

<p dir="rtl">10 The fusion protein for the NDV virus is produced by a nucleotide sequence with a nucleotide sequence of 5. In some non-replicating models, it is possible to^AndrMDVnp was designed by the Genetic Linkage Consortium (MCA) which is called the Caray Expression Assembly._YProvide the fusion pool for the NDV virus, which is supposed to be independently dependent on two possible entities 8 to create a antigen of the same type. In relevant models, the following^AndrMDVnp designers have worked in the past to provide genetic linkage institutes.</p>

<p dir="rtl">15 Y_YProvide the two NDF F ponds that are expected to operate at a mini flow cost that has a similar application ratio for a large capacity</p>

<p dir="rtl">90:, k/lk for the greater of 95:, k/lk for the greater of 98:, k/lk for the greater of 99: m is the cost of saving money with interest and how 8. In the first semi-model, the cost is Fusion agents for NDV with a cost-effective nucleotide reductase 7. In half examples, the designed pattern is rMDVnp and rHVT. In early models, the rMDVnp pattern is suppressed</p>

20 wkvirx rMDV2.

The elements regulating polyadenylation processing

Many thousand people have lost their lives in the Middle East._YHow much is a roll?_YYou will use the expression "kakarai" for a homologous bird. The adaption is a given word for a species-specific antigen. You have created a name for a antigen of the same type in a tiger.^AndI designed rMDVnp for the high quality. Please click on the pseudorabies virus (PRV) gpX to look at,

25 The clinical application may be 87/04463 WO[, LTR for the cancerous virus, Rous’ cancer, won.

٤٢٤٣

-٣١-

Early SV40, ILTV gD vaccine, ILTV gI protein vaccine for financial consideration, American breeding population (Maybe 6183753), Gene gene vaccine, early viral infection of H. vulgaris viremia 1 (hCMV IE1). American 5,830745 5980906]ⁿٿ

5 In this context, the proposed Towne hCMV IE strain, a potential nucleotide sequence 12 gene, is a potential novel ILTV gD 11 gene Nycmimictidae symbionts with a single nucleotides 9, K The proposed ILTV gI mechanism for nucleotides with a chemical structure 10.

The inclusion of a regulatory element for polyadenylation processing in the following coding region of the DNA would be in the required 10 kilograms._nTranscription mechanisms for the double-stranded DNA. Kkfqfafa_nTherefore, complete the contents of the package.

Genes act as a regulatory element in the polyadenylation process at the next end of the phosphorylation cost associated with them. The organization's members are able to distinguish between the organized elements and the organization_YExpensive per roll_YHow will you respond in Nymph?^AndI designed rMDVnp for high quality. The accusative of the Nicks of the Polydenylation as a The case of the Kaita, the public, the completion of the complexity of the NCLOTIODE Sequence

With a structure and method 13, as the HSV thymidine kinase signal for the polyadenylation process of the nucleotide sequence with a structure and structure 14.

Tests, such as immunosuppressive formulations

The increase in genetic levels goes deep with the use of Virus Marik, MDVnp gene binding conjugates, and esterified LN20 molecules._YesMDVnp viruses are available to the family to develop them, regardless of the cost of their gender.

All of them need to reach a higher level in order to manufacture a vaccine for Medicin. As a result of this, y_YThe vaccine has been provided with immunostimulant formulations that include MDVnp, or multivalent genetic linkage complexes, for the purpose of raising the number of mules. These are the locations_YHow much is a roll?_YYou will receive help if you have Newcastle Disease, if you have Marek's Disease, if you have

25 Diseases associated with infection after ILTV. A movie about the Kafqan vaccine for high-altitude growth_Ymkv

٤٢٤٣

5

-٣٢-

Roll y_YYou will be receiving medical treatment and you will be receiving treatment, so the vaccine may not interfere with your treatment plan or clinical disease.

10

15

20

If the virus is non-pathogenic, MDVnp, genetic linkage complexes for high-grade bacteria, etc._YThe cost of twisting fluid is increased by the number of fluid coils that are twisted._YLean practices in the practical field. He worked for money,

Virex MDVnp genetic linkage associations for alleles_YThe cost can be increased by reclaiming the factory-grown Ralifa chicken farms, to establish a financial background for the country 2017-2017 Recovery of kidney embryonic fibroblast cells (CEFs)._YCEFs can be damaged by the chicken poultry with the trypsin enzyme. Rally CEFs add to this_YIt is expensive to plant your crops in different layers of Africa, thus ruining the country's economy GFVFX MDVnp. And the humiliation of the solid generality_YThey can easily be bred to reach the lux range of industrial production for this rally.

For this reason, the company uses a way to adjust the link according to the full height level Making transmission lines for the virus MDVnp with confirmation of the genetic linkage for the highest number of host strains, all host strains infected with Virex, and After that, mix the family raliya from the entire factory in Naples, before your next family class. If the appropriate methods are used in the decades of the decade, such as agricultural and collective farming, a notebook in the concept and a complex of whatⁿShe has a motherhood in the humiliation of the situation.

Typically, the virus-infected host strain is isolated while it is still healthy due to its cousin, MDVnp, having genetic linkage sequences in its strain-associated environment. Y_YIt is possible for the Raliya to be made to make a suitable formulation to repair the defects and stability by preparing it for freezing and freezing. Ralia infected with Virex_YThe cost of wrapping and rolling glass containers, which are sealed, frozen and arranged in liquid nitrogen. Accordingly, in some models of high-calorie production, the places where the compositions required for the high-risk immunity are grown in a freezer machine as a consequence, this implies a A soft food made with barakadah.

Use of dimethyl sulfoxide (DMSO) to treat infected frozen berries.

٤٢٤٣

-٣٣-

Alternatively, when the MDVnp virus has genetic linkage complexes and the HVT virus has genetic linkage complexes, it is_YThe wrapping of the isolation of the pamphlets of the pamphlets for the pamphlets of the way to the way of the way to the way What do you do, as it is to be dried up by refrigeration). The concentration is then re-watered in a fluid containing a large amount of it, without stopping

Restore anything done reusably, work for money, move files to a degree suitable for rent. In some embodiments, a specific portion of the multivalent vaccine can be made up of any number of antibodies, and a specific portion of the multivalent vaccine can be made up of any number of antibodies.

10

15

20

In the experimental models, the cultured vaccine is not the one (you have approved it)._YThere is a wrapping capacity in each freeze-dryer, two kilograms for each package. The cost of wrapping costs is as follows: In the future of God, Lord, 2010/125084, which includes all its adaptations in this case as a boiler. As a collocation, the reference to the Imamate was marked, from page 15, line 28 to page 27, line 9 of the international students, perhaps

2010/125084, the document describes the method of producing quick-to-move-out packages/krivets. Freeze-dried whole foods_YIt is expensive to wrap them easily in the facility, so you can wrap the packages for the vaccine.

Y_YExpensive measures and installations are taken into account, especially in the context of a physiologically compatible organisation The number of people is the same as the alphabet, in addition to the help of the alphabet before the Ninian classroom. Maccadian_YThe cost of the treatment The cost of the assistance The cost of the assistance The cost of the assistance The cost of the assistance The location of the site was hosted. This is a description of the drug's use as two working methods for the immune system, but it does not indicate_YThey may not be useful in targeting a critical component of the immune system. Many of the compounds included in this oil would have to be added to the solution. Because of this, the skyscrapers of the sky are the highest in the world._YIt is expensive to turn your phone around to add additional work to help. If the work of chemical compounds that are_Ymkv lv t_YThey may be used as auxiliary substances, but they are not limited to the compounds of cuminum (malan hydroxide, cuminum), metabolizable and non-metabolizable oils, and mineral oils that provide adducts of mannaid kidneys in a mineral oil mixture (malan, 70 MO). NTANIDE ISA MF

25

٤٢٤٣

5

-٣٤-

, Seppic SA France (, as the mineral marriage is the drainol 6VR, in Climart, the stimulus against the ful. ػ 12(k)

CARBOPOL®

10

15

20

To provide appropriate assistance to the African country, Africa has also received the appropriate assistance._YI am sorry to hear about the immune systems, but they are not limited to the work of: cytokines, nomadic agents, chemical substances, and spectrophotometers In the provision of artificial farms for the African Republic, the African Republic of Africa, the European Republic of Mexico In the lymphatic system, there are many archaeological hosts in plants. You have bacteria, you have parasites (host bacteria, staphylococcus, soluble lipopolysaccharides) that have the means of mitosis. In both cases, a material assistance is given to a lesser person in the same amount of money given to a less fortunate person for the sake of high affluence. However, it is a helpful word._YIt is expensive to pay you instead because they are given for a period of seventy years before the summer in the job, or for a period of time after the summer in the job, i.e., work for the same amount of time as the period of antibody administration, Malan, Virex MDVn p Binding complexes The genetics of the larvae that remain in the tissues.

Antiseptics and/or immunosuppressant formulations should be given by a course of drug administration, such as white-cell drugs, as well as non-body drugs, in order to complete the action of the drug All muscles, no standing frozen, no standing dark Read more, stand inside the freezer, by using the freezer scraper, by giving your mouth, by no means assigned from all the paths.

Aalaka_nIn doing so, the MDVnp virus has multivalent genetic linkage complexes for the highest levels._YHow much does it cost?_YYou/you will have additional antibodies from NDV, ILTV, and other antibodies.

MDV for manufacturing and processing capacityⁿ1/2 Antigen antigens for various pathogens in order to provide immune protection against those pathogens. Additional antibodies and so on_YThey are composed of entire living organisms, each of which are species resulting from genetic linkage, each of which are genera, each of which are species, each of which are derived from the genera and so on Before, very much, so that you do not interfere with a multi-colored negative picture, such as the letters What is the effectiveness of the proposed plan?_nELF

25 The height is not high.

٤٢٤٣

-٣٥-

The cost of the multivalent MDVnp virus, the genetic linkage associations for the highest level, the additional antigen for the virus MDV, NDV, and/or ILTV._YIt is expensive to be suitable in all machines that have substitutionary strains to protect against ILTV, NDV, MDV, but it is not feasible._nIn a certain rural area. In this regard, the cost of multivalent MDVnp is

<p dir="rtl">5 Genetic linkage indexes for high levels of MDV1, MDV2, MDV1, HVT, and SLV strain (MDV1). SB1 (MDV2), FC-126 (HVT) PB1 (HVT). Response against NDV, NDV MDVnp is multivalent with evidence of genetic linkage, but it must be related to the NDV vaccine strain, unless the C2 strain of the NDV virus vaccine has no.</p>

10

It includes a working nation of microscopic organisms that..._Ymkv lv t_YThey will be used as an anti-skid chloride_nMultivalent MDVnp virus, genetic linkage complex for the highest order: (1) MDVnp virus, infectious bronchitis virus, the specific virus , adenovirus

Egg drop syndrome virus, infectious bursal disease virus, chicken anemia virus

<p dir="rtl">15 Virus, brainstem virus, chicken pox virus, chicken pox virus, duck viral enteritis, pigeon pox virus, hyperplasia virus Avian leucosis virus, Avian pneumonia virus, Avian pneumovirus, and reovirus 2 (bacteria, African alkaloidosis virus, SARS-CoV-2).</p>

<p dir="rtl">20 Salmonella, Ornitobacterium, Haemophilus fowleri, Pasteurella vulgaris, Haemophilus vulgaris_YThere are many types of bacteria in the world._Y(3) parasites, (4) fungi gi, similar to Aspergillus species. In models based on genetic variation, MDVnp has no genetic correlation coefficients for genetic variation. The one who loves me_YWhen you die, you can't die without it</p>

25 IBDV vaccine strain D78 (cloned intermediate strain), Cu-1, PBG98,

٤٢٤٣

-٣٦-

12-ST (intermediate strain), 03-89 (Delaware neutralizing strain) in multivalent serum. Many of these strains are recovered in commercial settings.

Vaccine cost j_YMKV roll it_YIt is made in various ways, including by mixing the MDVnp virus with genetic linkage complexes for various types of hosts, such as bacteria, fungi, parasites, and the host species cells, each of which is a well-known link. You have all the items. In commercial models, the components are produced to produce a cost-effective vaccine, thereby^AndFill it with a separate idea and then combine it, so they are in the same place as the vaccine.

As intended for illnesses, the Kafqan vaccine has not caused a significant rise in prices._YHow much does it cost?_YYou will respond with your jaw^AndIt is suitable for atonement

10 There is no effective immunological substance in the glands, as it is often used to feed stubbornly The right age is found in the egg. As an alternative, he will also be sure to be an individual experienced in poultry vaccines, and the costs prescribed for the medicines will ensure that the class schedules are met Multivalent MDVnp Multivalent Genetic Linkage Complies You are precious, you are expensive, you are lost, you are weak, you are precious. It is not necessary to give it to you, as it is very important to you; Two million people

15 Virx MDVnp Genetic linkage institutes need to be inactivated by egg clotting, strain NDV C2 and/or strain IBDV (for financial purposes, 03-89) It may be necessary to roll_YIt will be available on the specified date/time.

20

And as a result of this, Y_YIt is expensive to wrap a lot of perfumes, soaring heights. Raise the birds to birds in a dose that is beneficial to you, in multiple doses. For money, I want_YYou will receive the inbred vaccine at the time of hatching and you will receive it by locking the eggs on Day 16-18 (Embryonation Day). When multiple doses are given, all doses may be given in the same dose to separate you.^AndIt is modified, in the pattern and time compatible with the composition of the vaccine, and in the quantity that is_YTkbⁿImmunologically effective wrap. For this reason, the highest altitude vaccine in the country should work in you.^AndEviel and Zephan, so he bowed down to Miqat, Al-Dhimhi_YHow much does it cost?_Ytbk y_YA great deal of the difference between a booster with the identical vaccine, but with a high level of damage from the vaccine due to the advanced inactivated whole-virus vaccine, boosted with an adjuvant.

25

٤٢٤٣

-٣٧-

The number of vaccine doses for each person is high. Raise the number of people._YIt is expensive to apply the wrap and adjust it carefully to achieve the desired application method: Vacuuming with a thick stick is used to loosen the dirt.^AndUse a thickness of 0.05 mm/0.5 mm/kg, and the device must be unscrewed.^AndThe habit is between 0.1 and 1 mm/bird. It is an important task, as controlling the entire dose of the vaccine is important and must be done in a short time.

5 Possibilities of opportunities to train experienced professionals in the field of chicken farms.

Table of dependencies

<tr><td><p dir="rtl">The bastard</p></td><td><p dir="rtl">Description</p></td><td><p dir="rtl">God of interdependence</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>ILTV gD Glycoprotein</p></td><td><p>1</p></td></tr><tr><td><p dir="rtl">Flash to Mini</p></td><td><p>ILTV gD Glycoprotein</p></td><td><p>2</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>ILTV gI Glycoprotein</p></td><td><p>3</p></td></tr><tr><td><p dir="rtl">Flash to Mini</p></td><td><p>ILTV gI Glycoprotein</p></td><td><p>4</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p dir="rtl">Perective NDV F (Nasima 30)</p></td><td><p>5</p></td></tr><tr><td><p dir="rtl">Flash to Mini</p></td><td><p dir="rtl">Perective NDV F (Nasima 30)</p></td><td><p>6</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>(B1 Hitchner strain) NDV F Protective</p></td><td><p>7</p></td></tr><tr><td><p dir="rtl">Flash to Mini</p></td><td><p>(B1 Hitchner strain) NDV F Protective</p></td><td><p>8</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>ILTV gD m vz</p></td><td><p>9</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>ILTV gI m vz</p></td><td><p>10</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p dir="rtl">hCMV IE (Innovative)</p></td><td><p>11</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>(Towne strain) hCMV IE Mfs</p></td><td><p>12</p></td></tr>

٤٢٤٣

-٣٨-

<tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p dir="rtl">High-quality polyadenylation treatment</p></td><td><p>13</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>HSV TK polyadenylation treatment</p></td><td><p>14</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>IE-NDV F Klija</p></td><td><p>15</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p dir="rtl">Klija ILTV</p></td><td><p>16</p></td></tr><tr><td><p dir="rtl">I'm going to fuck you</p></td><td><p>IE-NDV F/ILTVKlija</p></td><td><p>17</p></td></tr>

The automatic progression must be understood in a preferable way by indicating the following unrestricted lead, which is

Presenting them as an excellent model for the advancement of children. The following statement is presented in an envelope for the full explanation of the sequence models. ٿ

The cup is for the second time.

5 For a moment

What 1

Infat napalate for ILTV/NDV/HVT reversals resulting from genetic linkage complex

The ability to generate herpesviruses by means of transferring the mutant herpes virus has appeared in the genome of the cloned and cloned subgenome every time when studying quantum viruses._YesB

10 Liars. Van Zijl et al., J. Virology 62:2191-2195 (1988)

Its use is based on the Genetic Linkage Institute, at the highest level in the United States, number 5853733, which was completed Adding all of its facilities in this regard as a home for your business.

This method deals with the method described above regarding HVT injections of Viverx tablets with genetic linkage agreements [K Used in ILTV/NDV/HVT ferroelectric nozzle exhausts.

15 The genetic linkage of the breeding population. In this way, the entire genome of the bacterial nematode HVT virus has been cloned into several large subgenomes that are mutually exclusive.

Maniatis et al., (1982) DNA genetic linkage complexes eliminated using standard techniques

٤٢٤٣

-٣٩-

Molecular reproduction Cold Spring Harbor Laboratory Press, Cold Spring,

, Cold Harbor reproduction, New York (1982); and Sambrook et al., Molecular.] Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989).

The cosmid assembly of the HVT strain FC126 was derived from sheared viral DNA.

5 The clone was created by Darel Nabel Stratagene, now Agilent Technologies (pWE15, cosmid of Santa Clara, CA). In addition, large multiplexes of genomic DNA were isolated using a restriction enzyme , BamHI, a scientific analysis by Daryl Emilia Nablus cosmid pWE15, Lk Nablus plasmid Promega, Madison WI (pSP64)

10 The kidney embryo fibroblast (CEF) leads to the regeneration of the HVT genome by a simple process resulting from the matching genetic linkage knot across the intervening regions to pass._nThe subgenome of the subgenome is used for the transmission of fodder, which leads to a high frequency of viruses that cause the transmission of fodder How are you working with me? A letter of clonal clones whose subgenome is required to generate the FC126 HVT strain, will work.

15 Basically, all ILTV/NDV/HVT viruses result from genetic linkage.

ILTV1332-62.E1/NDV/HVT: TDP Makkaka for two, in the struggling of a mechanic, 5853733, as: 8 for the struggling rituals of 5853733; Redrawn, work

A partial bifurcation, a partial bifurcation, a bifurcating 1, a partial bifurcation, and the same type of situation. An allowance for integration processes around the US region

20 For the FC126 HVT genome, the circumscribed region has now been encrypted by a cosmid basal, perhaps 378.

50 In the highest altitude in America, perhaps 5,853,733, including asymptomatic infection of Sahara: pSY640 as

60.6-556, with the plasmid transferase KD (1332-47.A2), was synthesized with the two ligands, and is similar to the ILTV/NDV expression complexes in the US2 gene pool.

٤٢٤٣

-٤٠-

The number is transported using wet formulas: 3 cosmids and 4 cosmids all together.

Some have produced CEFs, using a standard CaCl2 metal transfer protocol and the resulting viral stock is purified from the ingredients once.

HVT/NDV/ILTV1332-70.B1: Implementation of the cosmid in the LMPH series xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

5 HVT/NDV/ILTV 1332-70.B1 How much is your cost in the high-rise building in Malan, 5853733? All 8 of the American high-rise buildings numbered 5,853,733; Redrawn, work

There are two partial explanations, in verse 1, and in this case]. To allow for integration into the UL54.5 genome FC126 HVT region, the flanking region has now been encoded with cosmid 407-32.1C1 in the American transcribed link 5853733, from the number of zamaidat for Sahar:-672

10 01.A40 K 672-07.C40, K by the colleague Naql and K K (29.4-1332), K K and K K work ۻ ạdhif

Now, how are the ILTV/NDV expression complexes in the carcass dump UL54.5.

The number is transported using wet formulas: 3 cosmids and 4 cosmids all together.

Some have produced CEFs, using a standard CaCl2 metal transfer protocol and the resulting viral stock is purified from the ingredients once.

15 Inflation 1-HVT/NDV/ILTV 1317-46.A1: Implementation of the cosmid renewal for the HVT/NDV/ILTV ferroelectric 1317-46.A1-1 How much is your cost in... 5853733 American high altitude tower 5853733; The redrawn one, in accordance with the two sub-sections, F-F-F-F-F-K-1 , F--------------------------------------------------------- To allow for integration into the US genome FC126 HVT, the region surrounded by a cosmid of perhaps 50-378 in

20 The American population was estimated at 5853733, with a population of asymptoids for Sahara: pSY640 as 60.6

556 It was also reported that the work of the ILTV gene was installed in the US2 gene dump The FC126 HVT is included in the UL region cosmid replacement priming Rab-407

32.2C3 in the American height section, perhaps 5,853,733 ml cosmid transport (05.0-1196),

٤٢٤٣

-٤١-

What are the working terms of the NDV vocabulary for the HVT UL7 gene?

UL8

The kit is to be transported with the following formulations: 1 uncut cosmid (05.1-1196), 2 rolls of remaining wet cosmids, 4 with wet cosmids They are all related to each other, each other is Daryl Raliva

5 CEFs, using a standard CaCl2 metal transfer protocol and the resulting ferric acid is purified from the machines once and for all.

Description of the FC126 HVT Genome Subgenome Synthesis System:

Transcriptome of the branch genome 407-32.2C3. 407-32.2C3 cosmid approximation your work

40 170

This area is filled [Afonso et al., 2001, supra; Acc. #AF291866 10 39.754;

In the genome of the HVT enzyme BamHI, it is 2,092 pairs of bases long.

The sub-genome 172-07.BA2. You are in charge of the application 172-07.BA2, making 25,931 regions to pair with the genetic DNA of Virex HVT. It should be completed with a copy machine for Part B.

15 The BamHI enzyme genome for the HVT gene 37.663 to 63.593; Afonso et

Promega, Madison (pSP64 plasmid production) al., 2001, supra; Acc. #AF291866

)WI

Nessima subgenome 407-32.5G6. 407-32.5G6 cosmid contains 39,404 binding regions on the HVT genomic DNA base, 61,852 – 101,255; Afonso

20 et al., 2001, supra; Acc. #AF291866[. This region includes the K, Q, C, H, K2, and M molecules in the genome of the BamHI enzyme of the HVT virus, in addition to 1,742 pairs of bases for the B segment, and 3,880 pairs of bases for the J segment.

Neisseria subgenome 407-32.1C1. tk 407-32.1C1 cosmid 37.444

Lezkaj region of the HVT gene base, 96.095 - 133.538; Afonso

٤٢٤٣

-٤٢-

et al., 2001, supra; Acc. #AF291866[. This region includes the molecules O, F, I, G, and J in the genome of the BamHI enzyme of the HVT virus, in addition to 1,281 pairs of bases for the K2 fragment, and 6,691 pairs of bases for the A fragment.

Nasima Subgenome 378-50. It is 378-50 cosmid in 28,897 Lazkaj area

5 With the HVT genomic DNA to look at all 8 of the US breeding population number 5853733; Redrawn, based on two partial terms, in all 1, in this context]. It was intended to be terminated by the BamHI gene transcription comb for the HVT gene, 126848-155744;

cosmid pWE15 Daryl [Afonso et al., 2001, supra; Acc. #AF291866

HVT/NDV/ILTV 1332-62.E1:

10 Subphylogenetic genome 1332-47.A2. Your work is covered by EcoRI 1332-47.A2. Your work is covered by EcoRI HVT

Afonso et al., 2001, supra; Acc. #AF291866 Al-Madad 136880-144190;

Darell's plasmid cloner Promega, Madison WI (pSP64). Two elements were produced, Darell's unique StuI assembly contained in the HVT gene for the virus US2, 140541/140540.

Among the economic trends, Afonso et al., 2001, supra; Acc. #AF291866 15

Structural Section 124 and 125] These two elements are divided into two parts: 3563 parts of the rules, SalI - HindIII, related to exposure to NVSL, IL TV Dynasty, 2-83 # Lot

Wild et al., Virus Genes 12:104 – 116 (1996); Location 10532 - 14094;

Acc.# U28832], which expresses the total childhood Glycoprotein D (gD) gene.

20 HCMV IE, NDV strain Transcriptome 30, fusion cavity (F), marked with a marker for processing with marked polyadenylation. The ILTV gI, ILTV gD, and NDV F genes are transcribed in the opposite direction to the HVT gene US2.

٤٢٤٣

-٤٣-

Neisseria subspecies genome pSY640. The pSY640 comes with approximately 13,600 regions.

Labeled with the DNA base of the HVT gene, 126848-140540; ,.Afonso et al

BamHI enzyme genome A 2001.ⁿThis is the most important thing in the world, supra; Acc. #AF291866

To generate this plasmid, the DNA region following the nucleotides creating the US2 gene was cloned.

5 The prefix at the base is StuI, the cap in the genome, US2, and the end of the device.

BamHI enzyme, cloned into the plasmid Promega, Madison WI (pSP64).

Sub-genome 60.6-556. Your additional cost is approximately 556-60.6, approximately 12,500.

FigureⁿA, a, a, a ginome, a bamhi, the approximate run, 143300, to Al -Mutaad 155744, .afonso et al

2001[. And this plasmid was cloned in a region, supra; Acc. #AF291866 10

The DNA of the nucleotides containing the US2 primer at the StuI cap in the DNA

US2 extended at the end of part A of the genome is the BamHI enzyme, in the plasmid pSP64.

Promega, Madison WI((, M) was treated with endonuclease to be “rolled once” from the 150 bp StuI~ construct, and then re-cloned by Darel Nabel plasmid pBR322.

15 HVT/NDV/ILTV 1332-70.B1:

Sub-genome subtext 1332-29.4 You need to know the information 29.4-1332 Function 8.636 Logic

The genetic genetics of the HVT is characterized by the unique genetic logic The expensive one

Mustansir,]Afonso et al., 2001, supra; Acc. #AF291866 109489 -118124;

This region is enclosed in the plasmid AatII-PvuII (pNEB193).

20 In the ASCI, I, I, I, I, the Genome, in Genome. 77 Zagg Al -Qakamid for the Grazit F. ػ

Afonso et al., 2001, supra; Acc. 111241/111240, UL54.5

#AF291866, including the Codes of Building Technical Objectives 21 and 22 [number of 2 elements: Completed

25 3563 pairs of SalI–HindIII bases from the susceptibility strain, NVSL, ILTV

٤٢٤٣

-٤٤-

, 83-2 # Lot 10532 – 14094; – 12:104 Wild et al., Virus Genes 116 (1996); Acc.# U28832], encoding the entire gene for Glycoprotein D (gD) and Glycoprotein I (gI), in addition to partially encoded regions of Glycoprotein E (menin past 1-101), as ORF5 (menin past 73). 4 – 985) As a combined expression

5 Karai mechanization of HCMV IE, Virex NDV, T. strain 30, fusion gene (F), left behind with a secretion for the treatment of vascular polyadenylation. The ILTV gI, ILTV gD and NDV F genes are cloned in the opposite direction to the HVT UL54.5 gene.

Genetic DNA sub-genome 672-01.A40 Herniated HVTⁿFrom the unique cultural area of the city

Mustansir,]Afonso et al., 2001, supra; Acc. #AF291866 10 96095 -110825;

Daryl Muftaq from plasmid pNEB193. This region includes J and G in the genome of the BamHI enzyme of the HVT virus as 1281 pairs of bases of the K2 compound.

Genetic DNA sub-genome 672-07.C40 VT herniatedⁿFrom the unique cultural area of the city

Mustansir,]Afonso et al., 2001, supra; Acc. #AF291866 15 116948 -129467;

Daryl derived from plasmid pNEB193. This region includes the O and F molecules in the genome of the HVT virus BamHI enzyme and is 2620 pairs from the base of the A part.

Additional methods for cauterization are permitted: 1-: HVT/NDV/ILTV 1317-46.A1

Subgenome 05.1-1196 The cosmid 05.1-1196 is approximately 40,170 years old. 20 regions of the genomic DNA base of the HVT virx left-hand end 39,754; Afonso

Tmml. pWE15 cosmid clonogenic Darell et al., 2001, supra; Acc. #AF291866

This region represents 'D, E, N1, P, L, F' in the genome of the BamHI enzyme for the HVT virus as 2.092 pairs of bases for B. In addition, the expression assembly was introduced CARAE fusion fusion (F) for Virex NDV, the European Union won HCMV IE and HSV TK elements

٤٢٤٣

-٤٥-

The regulator of polyadenylation processing is a non-coding region between the HVT UL7 and UL8 genes within the BamHI enzyme, 20030-20035; ,.Afonso et al

HVT in the same direction as NDV F 2001[. Jif is copied, supra; Acc. #AF291866.UL7

5 Nassima subgenome 1-15.1-1317. Refers to the code 1317-15.1-1, 7311, the base coil for the unique short circuit of the EcoRI FiFerx HVT coil, supplemented with 1368 80 -

CNS Darrel, [Afonso et al., 2001, supra; Acc. #AF291866 144190;

Plasmid Promega, Madison WI (pSP64). In addition, 3563 pairs of bases were found in SalI – HindIII parts from susceptible strains infected with the virus Lot # 83-2, NVSL, ILTV

Wild et al., Virus Genes 12:104 – 116 (1996); 10 Location 10532 – 14094;

Acc.# U28832] containing the full glycoprotein gene (Glycoprotein D (gD and Glycoprotein I), in addition to partial coding regions of Glycoprotein E) (min. 1-101). (, as ORF5) Technical Terms 734 – 985 Afonso et al.

15 2001, supra; Acc. #AF291866.

The ILTV gI, ILTV gD, and NDV F genes are transcribed in the opposite sequence relative to the US2 gene of the HVT virus.

Neisseria subspecies genome pSY640. The pSY640 gene contains approximately 13,600 regions that match the genomic DNA base of the HVT virus, 126,848-140,540; ,.Afonso et al

Synthesis of the BamHI enzyme. Genome A 2001. Synthesized from fragments, supra; Acc. #AF291866 20

In this plasmid, the DNA region following the nucleotides containing the US2 gene, starting at the StuI cap in the US2 gene, was cloned. A type of enzyme

BamHI, Daryl plasmid pSP64 (Promega, Madison WI).

Subphylogenetic genome 60.6-556. Total work 12,500

25 LogicⁿGenome A is unique.

٤٢٤٣

-٤٦-

BamHI, approximate number 143,300 to number 155,744, Afonso et al., 2001.

This plasmid was cloned into the supra region.] Acc. #AF291866

The nucleotides that make up the US2 ligand, starting at the StuI capsid in the US2 ligand, are extended at the end of part A of the BamHI enzyme genome, part of the plasmid Promega, (pSP). 64

5 (Madison WI), cells were treated with endonuclease in order to be sequenced “in a single roll” from the 150 bp StuI ~ construct, and then re-cloned by Darel Nabel with plasmid pBR322.

Standard calcium compound CaCl2 for metal transfer: CEF's Chinese culture was done in 6-well culture dishes and the layers were incubated at 38°C M5:CO2 gas for 24 hours The stacked valley. Each eye has a quantity of 0.25.

10 Microglyphs, DNA, cosmids and plasmids in the regulated Hepes complex are characterized by addition.

125 Mix CaCl2 drop by drop to make the precipitation efficient. This mixture was added to the bottom layer of the CEF Rally, and added for a period of 2 to 3 hours. The removal of the spectral material was carried out

A thin layer of 15: GmCrCl, KT was added_YLeave the rally running for 1 minute. After that, the layer and other layers were removed, in accordance with the cost of the PBS, and a new culture pad was added to add Why?

15 The rally lasts for 5 days. After that, the ralia was modified by digestion with the enzyme trypsin and the ralia was cultured from individual dishes each._HI made several layers of new layers of Raliya CEF in a layer with a thickness of 10 centimeters and they were lightened to a maximum of 50-90 CPE. After that, the entire rally was completed

The transferred matrix was treated with the enzyme trypsin, and layers 10-2 to 10-4 were added to a 10-cm-thick layer of the CEF layers Yenya. In

20 Next, a dish was installed with bricks, and a number of individual air conditioners were insulated to make ILTV/NDV/HVT filters, similar to those of CEFs.

What 2

The HVT/ND/ILTV vaccine has been exposed to HIV since its lifetime.

Infection with Laryngotracheitis Virus

٤٢٤٣

-٤٧-

Two articles, including the 1332-70B1 strain ILTV-1332-62E1/NDV/HVT, have been evaluated for their effectiveness in saving hundreds of thousands of people Avoid exposure to Laryngotracheitis Virus . NDV/ILTV-1332-62E1/HVT strains and rHVT viruses

5 It contains the basic structure of the FC126 HVT model, which operates at a cost of 17 factories at the US2 landfill (see, 1 million for treatment). 1332-HVT/NDV/ILTV/ILTV 70B1 strains are an rHVT virus Genetic linkage indexes involved in the structure of A The SASI FC126 HVT includes a 17-liter terminology standard defined in UL54.5 (for example, Table 1).

10

It is necessary to make the time for the sacrifice of the wise man Ruka, Rally, Ms. Additional 11 mg of water in tissue cultures and tests from 1332-62E1.

Antibiotics are given to chickens at the time of hatching, a vaccine against specific antigens (SPF).

15 Antigen free by freezing administration. The bird was then exposed to infection at the age of four years with the infectious ILTV virus through endotracheal administration, and the bird was observed for 10 days to record clinical disease symptoms. The incidence of the disease in these groups was compared to the control groups in whichⁿThe Genetic Linkage Institutes (Innovax®-ILT, from Merck Animal Health) have offered an HVT/ILTV vaccine for those who have not received a vaccine.

20 You are required to register for future registration (9CFR) in the form of 80%: all unvaccinated and unvaccinated birds must be registered._Y90: Clinical disease symptoms must be wrapped in order for the test to be considered healthy. 90: Birds vaccinated with the vaccine must be wrapped in a blanket that does not show any clinical disease symptoms in order for the vaccine to be considered to protect hundreds of patients._YesYeh. The results of this study are presented in Table 1 for Daniel. All of them are located in the Infantry and are genetically linked to the country.ⁿGF

25 satisfactory against exposure to the virulent ILTV strain.

٤٢٤٣

-٤٨-

Find out 1

Efficacy of multivalent ILTV/NDV/HVT vaccine against virulent ILTV infection

<tr><td><p dir="rtl">Waterproof:</p></td><td><p dir="rtl">Al -Naqitah Division of Tafar</p><p dir="rtl">Lamjath **</p></td><td><p dir="rtl">With you, the competency guide**</p></td><td><p dir="rtl">For your sake, the land of the Mughals, for the purpose of mechanics.</p><p>disease</p><p>**</p></td><td><p dir="rtl">Dosage*</p></td><td><p dir="rtl">The vaccine</p></td><td><p dir="rtl">Collected</p></td></tr><tr><td><p>:97.2</p></td><td><p>= 36/1</p><p>:2.8</p></td><td><p>36/1</p></td><td><p>36/1</p></td><td><p>2170</p></td><td><p>1332-62.E</p><p dir="rtl">MRR 8</p></td><td><p>1</p></td></tr><tr><td><p>:100</p></td><td><p dir="rtl">36/0 =</p><p dir="rtl">zero:</p></td><td><p>36/0</p></td><td><p>36/0</p></td><td><p>1409</p></td><td><p>1332-62.E</p><p dir="rtl">MRR 11</p></td><td><p>2</p></td></tr><tr><td><p>:91.7</p></td><td><p>= 36/3 :8.3</p></td><td><p>36/2</p></td><td><p>36/3</p></td><td><p>2483</p></td><td><p>1332-70.B</p><p dir="rtl">MRR 8</p></td><td><p>3</p></td></tr><tr><td><p>:100</p></td><td><p dir="rtl">24/0 =</p><p dir="rtl">zero:</p></td><td><p>24/0</p></td><td><p>24/0</p></td><td><p>2200</p></td><td><p>Innovax®-</p><p>ILT</p></td><td><p>4</p></td></tr><tr><td><p dir="rtl">zero:</p></td><td><p>= 10/10 :100</p></td><td><p>10/9</p></td><td><p>10/10</p></td><td><p>NA</p></td><td><p dir="rtl">Total Exhibition Council As a description. Virxat forest</p></td><td><p dir="rtl">5L</p></td></tr><tr><td><p>NA</p></td><td><p>10/0</p></td><td><p>10/0</p></td><td><p>10/0</p></td><td><p>NA</p></td><td><p dir="rtl">Your collection</p></td><td><p dir="rtl">5b</p></td></tr>

٤٢٤٣

-٤٩-

<tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">NS He was injured.</p></td><td></td></tr>

* The dose is described as 0.2 mm dose (pfu)/g.

** You will need to record the results in a page on the number of frequencies prepared for Ma’al. Quantitative glands of the spectrometer (quantitative glands).

What 3

ILTV/ND/HVT vaccine Genetic recombinants

Exposure to infection with Newcastle disease viruses

10

15

20

The chickens are given antifungal antibodies at the age of 19 years and are found to have genetic linkage conjugates, HVT/NDV/ ILTV-1332-62E1, used for 11 in tissue cultures, etc. Two commercial NDV/HVT genetic linkage recombinants (Innovax®-ND) have been found._Y(Sold commercially by Merck Animal Health) and then exposed at four years of age to infection with the virulent Newcastle Disease (ND) virus, of the Texas-GB strain, via intramuscular isolation. After a period of 14 months, She died Follow-up and registration of a comprehensive survey of the technical land for the Newcastle project.

Disease, the objective analysis rate was compared in each group, the most recent group, and the most recent group in the control group not protected by the vaccine. It is required that registration be submitted (9CFR) in accordance with 80: Uncertified controlled birds must be notified._YClinical disease symptoms appear, wrapping, wrapping, wrapping, taking into account the confusion in each row, each and every one. 90: A vaccine package containing the vaccine must still contain a sign of a clinical symptom of the pathogen in order for the vaccine package to be considered to provide protection for patients._YesYeh. The results of this study are a guide to developing the vaccine - 1332 HVT/NDV/ILTV 62E1 Genetic Linkage Associations without a doubtⁿThere is no protection against exposure to the ND virus strain.

When the memo notes are given in my way.

٤٢٤٣

-٥٠-

Find out 2

Efficacy of multivalent ILTV/NDV/HVT vaccine against virulent NDV infection

<tr><td><p dir="rtl">The most beautiful thing:</p></td><td><p dir="rtl">With you, you are the competent one **</p></td><td><p dir="rtl">For your sake, for your sake nickivi</p><p>clinical disease</p><p>**</p></td><td><p dir="rtl">I love you so much</p><p dir="rtl">The ticker</p></td><td><p dir="rtl">How to give</p></td><td><p dir="rtl">Dosage*</p></td><td><p dir="rtl">The vaccine</p></td><td><p dir="rtl">Collected</p></td></tr><tr><td><p>:100</p></td><td><p dir="rtl">31/0 = zero:</p></td><td><p dir="rtl">31/0 =</p><p dir="rtl">zero:</p></td><td><p>31</p></td><td><p dir="rtl">Eggs</p></td><td><p>2160</p></td><td><p>1332-</p><p>62.E</p><p dir="rtl">MRR 11</p></td><td><p dir="rtl">1L</p></td></tr><tr><td><p>:100</p></td><td><p dir="rtl">31/0 =</p><p dir="rtl">zero:</p></td><td><p dir="rtl">31/0 =</p><p dir="rtl">zero:</p></td><td><p>31</p></td><td><p dir="rtl">tfkfkfkfkfkfkfkt</p><p dir="rtl">Freezing</p></td><td><p>2010</p></td><td><p>1332-</p><p>62.E</p><p dir="rtl">MRR 11</p></td><td><p dir="rtl">1b</p></td></tr><tr><td><p>:90.6</p></td><td><p>= 31/2</p><p>:6.3</p></td><td><p>= 32/3 :9.4</p></td><td><p>32</p></td><td><p dir="rtl">Eggs</p></td><td><p>2046</p></td><td><p>Innovax</p><p>®-ND</p></td><td><p dir="rtl">2l</p></td></tr><tr><td><p>:96.9</p></td><td><p>32/1</p><p>:3</p></td><td><p>= 32/1</p><p>:3</p></td><td><p>32</p></td><td><p dir="rtl">tfkfkfkfkfkfkfkt</p><p dir="rtl">Freezing</p></td><td><p>1872</p></td><td><p>Innovax</p><p>®-ND</p></td><td><p dir="rtl">2b</p></td></tr><tr><td><p dir="rtl">zero:</p></td><td><p>12/12</p></td><td><p>= 12/12 :100</p></td><td><p>12</p></td><td><p dir="rtl">tfkfkfkfkfkfkfkt</p><p dir="rtl">Freezing</p></td><td><p>NA</p></td><td><p dir="rtl">MRFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF</p><p dir="rtl">The</p></td><td><p>3</p></td></tr>

٤٢٤٣

-٥١-

Mariev

100:

<p dir="rtl">* The dosage description is based on formulas (PFU)/dose (0.2 mm/dose in frozen foods, 0.1 mm/dose in eggs).</p>

<p dir="rtl">* * There is a way to record the results in a class on the number of students submitted to Maa Quantitative glands of the spectrometer (quantitative glands).</p>

<p dir="rtl">5 What 4</p>

ILTV/ND/HVT vaccine Genetic recombinants

Exposure to infection with Laryngotracheitis Virus.

Newcastle disease

10 Evaluation of the vaccine, 1-46.1-1317-HVT/NDV/ILT, indicating effectiveness in providing protection for chickens

Either from exposure to Laryngotracheitis Virus or from exposure to Newcastle Disease virus. in order to_YThe 1317-46.1-1-HVT/NDV/ILTV vaccine is considered to be the primary source of the FC126 HVT vaccine, which may provide a reliable source of cancer Block 16, located in office US2,

15 The reliability of the contract may be related to UL7/8, meaning pls. 15, including:

The UL7 and UL8 genes for the HVT virus (see box 1 for diseases). The vaccine vector is derived from the SARS-CoV-2 virus.ⁿThe blood is removed from the blood, the tissues of the kidneys, the kidneys, the chickens, the farmed chickens, 15 times.

The vaccine is given to other people during the hatching period, so that it does not contain any anti-violent substances (SPF) in this way.

20 Do not freeze. The birds were then exposed at four years of age to birds infected with the laryngotracheitis virus (ILT), which kills the laryngotracheitis virus Observe the bird for 10 days, apparently due to clinical symptoms of the pathogen.

٤٢٤٣

5

-٥٢-

10

15

It has been exposed to the virulent Newcastle disease virus, the Texas-GB strain, through the fowl and has been infected with the bird's livestock for 14 days. A comparison of the rates of disease reduction in these control group branches was compared to the control group branches that wereⁿThe vaccine is either HVT/ILT, the HVT/ND vaccine, or the HVT/ND vaccine, for which no vaccine has been evaluated. You are required to register as a worker (9CFR) with a record of 80: A flight attendant who is not regulated by the Code must have a record of 80:_Y90: Clinical disease symptoms must be detected in order to be considered healthy, and all infected birds must be treated with the infection in order to be considered healthy The vaccine cures many diseases_YesYeh. The results and results of this study are presented in Table 3. The HVT/NDV/ILT vaccine provides protection against infection with NDV. As you work with the wrapper, wrap the waterproof paper in the primer pad as well as the composition If you are exposed to an injury with additional ILTV supplements, you may have missed all the requirements.

This is not the case, but it must provide a high degree of income for Medicaid.

Find out 3

Efficacy of the multivalent ILTV/NDV/HVT vaccine against NDV infection

ILTV

<tr><td colspan="4"><p dir="rtl">Results after an injury</p></td><td rowspan="3"><p dir="rtl">I love you so much</p><p dir="rtl">The ticker</p></td><td rowspan="3"><p dir="rtl">Dosage*</p></td><td rowspan="3"><p dir="rtl">Processing bundle</p></td></tr><tr><td colspan="2"><p>NDV</p></td><td colspan="2"><p>ILT</p></td></tr><tr><td><p dir="rtl">The most beautiful thing:</p></td><td><p dir="rtl">Quantity/quantity**</p></td><td><p dir="rtl">Water saving:</p></td><td><p dir="rtl">Quantity/quantity**</p></td></tr><tr><td><p>:100</p></td><td><p dir="rtl">19/0 =</p><p dir="rtl">zero:</p></td><td><p>:80</p></td><td><p>= 20/4</p><p>:20</p></td><td><p>20</p></td><td><p>1356</p></td><td><p>HVT/NDV/ILT</p><p>1317-46 (p15)</p></td></tr>

٤٢٤٣

-٥٣-

<tr><td></td><td></td><td><p>:95</p></td><td><p>= 20/1</p><p>:5</p></td><td><p>20</p></td><td><p>1740</p></td><td><p>Innovax®-ILT</p></td></tr><tr><td><p>:100</p></td><td><p dir="rtl">20/0 =</p><p dir="rtl">zero:</p></td><td></td><td></td><td><p>20</p></td><td><p>1836</p></td><td><p>Innovax®-ND</p></td></tr><tr><td><p dir="rtl">zero:</p></td><td><p>= 8/8</p><p>:100</p></td><td><p dir="rtl">zero:</p></td><td><p>= 10/10</p><p>:100</p></td><td><p>10</p></td><td><p>NA</p></td><td><p dir="rtl">Add kgkd lm ferex</p></td></tr>

* The dose is described as a formula of 0.2 mm dose (pfu)/g.

<p dir="rtl">** The results are recorded on a note: the number of birds imported (to determine the clinical disease and the efficiency rate) in relation to the bird’s quantity (number of birds/quantity).</p>

What 5

<p dir="rtl">5 HVT/ND/ILTV The result of the genetic combination in the cost of immunosuppressive scabies disease 89/03 in an anti-virus serum for immunosuppressive scabies</p>

Pools of old-age chicks are vaccinated with combined HVT/NDV/ILTV 1332-62E1 (SPF Leghorn) with serum 89/03 IBDV in the recovery batch IBDV reached only 3.5 log10 TCID50 per dose. The 10 chicks for the experiment were breastfed at seven years of age with an E-IBDV test. After the experiment was conducted on nightshades, the chicken palms were eaten to determine the body/immune levels and the quantitative lesions compatible with IBD. The results tend to be known to a degree based on the applicable 9CFR 113.331 requirements.

IBDV 89/03 is a harmful product used in the poultry industry to protect against swarms against old and new strains of M. The target dose dose was dosed with a serum of 89/03 log10 TCID50 3.5 IBDV per 0.2 ml per dose. As a dose dose

٤٢٤٣

-٥٤-

Target dose: 3000 PFU HVT/NDV/ILT per 0.2 mg/dose. To measure the target doses in the final serum container, serum 1332-HVT/NDV/ILTV 62E1 is formulated at 6000 PFU per 0.2 ml dose, which is approximately twice the target dose. The serum is dosed 89/03 to give a result of 3.8 log10 TCID50, which is approximately 5 times the target dose. For Group 1, the combined strainer is combined with an HVT/NDV series merging machine /ILTV-1332-62E1 as 89/03. In the case of Group 2, the cost received only 3/89 serum, a whole lot was added to the facility. Old age groups in each treatment group received 0.2 ml of relevant serum for substitution therapy via the cryotherapy (SC) route (see Table 4).

10 Table 4

Experimental model

<tr><td colspan="3"><p dir="rtl">IBDV myelin E</p></td><td rowspan="3"><p dir="rtl">dose</p><p>-HVT (89/03)</p></td><td rowspan="3"><p dir="rtl">Serum</p></td><td rowspan="3"><p dir="rtl">Lord</p></td><td rowspan="3"><p dir="rtl">Collected</p></td></tr><tr><td rowspan="2"><p dir="rtl">The class</p><p dir="rtl">Differentiation</p></td><td colspan="2"><p dir="rtl">Experience</p></td></tr><tr><td><p dir="rtl">I love you so much</p><p dir="rtl">The ticker</p></td><td><p dir="rtl">the age</p></td></tr><tr><td><p dir="rtl">10 Liam after the experience</p></td><td><p>40 &gt;</p></td><td><p dir="rtl">4 For Sabi</p></td><td><p>3000 –</p><p>(3.5 log10</p><p>TCID50)</p></td><td><p>HVT/NDV/ILT+89/03</p></td><td><p>45</p></td><td><p>1</p></td></tr><tr><td><p dir="rtl">10 Liam after the experience</p></td><td><p>40 &gt;</p></td><td><p dir="rtl">4 For Sabi</p></td><td><p>NA -</p><p>(3.5 log10</p><p>TCID50)</p></td><td><p>89/03</p></td><td><p>45</p></td><td><p>2</p></td></tr>

٤٢٤٣

-٥٥-

<tr><td><p dir="rtl">10 Liam after the experience</p></td><td><p>40 &gt;</p></td><td><p dir="rtl">4 For Sabi</p></td><td></td><td><p dir="rtl">Your eyes Comparatives You received alternative therapy</p></td><td><p>45</p></td><td><p>3</p></td></tr><tr><td><p dir="rtl">10 Liam after the experience</p></td><td><p>25 &gt;</p></td><td></td><td></td><td><p dir="rtl">Your eyes Comparatives You received alternative therapy</p></td><td><p>30</p></td><td><p>4</p></td></tr><tr><td colspan="7"><p dir="rtl">Upon hatching, chicks in each serum treatment group were marked with a group of marked birds.</p></td></tr>

Afkaya Makzaa_nOr assign it to retrieve the Afkai tax program in EXCEL. In addition, the birds removed from each group after seven days of the experiment were randomly assigned to each tissue group and performed in a tissue group for immunological experiments using the group test program in EXCEL.

5 The chicks were then fed for trial to a quarter of the males with Virex IBDV - Test E. Each chick received 0.06 ml. 102.2 EID50 reports_nWithout each dose, it is taken by mouth. Seven days after the experiment, 6 to 9 birds were removed from each group that underwent histological assessment of IR on an individual kidney (see Table 5). Eyes were plasticized Immunoglobulin wrapping with all of the ingredients together to gather undamaged tissue. Use a tweezer to remove the tissue sample into 10 individual balls containing 10:

You can see the Arabs, as IBD-Var E, as the EGP, Al -Aif Al -Wardaard as/ You have the metaphors, as well as the number of al -Nisji. Immune flaps include bleeding visible to the naked eye, edema/exudate, creamy/yellow spot, cracks, and a total atrophy of 15. It was written in the form of a fathom in the form of a fathom in the form of the weight of each individual cereal in the form of a gram. The immune system was weighed with a single bulb, which was divided into hundreds of pounds. The ratio of the immune body weight/body weight for each bird was taken using the formula, the BW ratio: (immune body weight ÷ body weight) x 1000. The body weight ratio was taken into account. The immunological analysis of the urine sample for CMV 2 showed that the standard of the comparison sample was negative. How many million people are infected with the common immunological disease.

20 The results of this study for the treatment groups with serum 1 and 2 were negative for IBD._nDa,

٤٢٤٣

-٥٦-

Not a messenger_nOh, about the comparison sample that was not breastfed by the alternative treatment) which shows that both designs are effective and it is clear to me_nAdded to the formula, it is found to be administered in water contained by the strain 89/03 of the anti-IBDV serum due to the structure of the HVT/NDV/ILT network. I want to know the exact contract of my genetic machine._nAdd them to the multivalent serum (see Table 5).

5 Table 5

Data for Mtfarih regarding the IBDV trial E

<tr><td><p dir="rtl">Median follicles' shedding rate on palpation</p></td><td><p dir="rtl">Serum</p></td><td><p dir="rtl">The Lord</p></td><td><p dir="rtl">Collected</p></td></tr><tr><td><p>5.464</p></td><td><p>HVT/NDV/ILT+89/03</p></td><td><p>9</p></td><td><p>1</p></td></tr><tr><td><p>5.715</p></td><td><p>89/03</p></td><td><p>9</p></td><td><p>2</p></td></tr><tr><td><p>(SD+0.641)** 1.874</p></td><td><p dir="rtl">Comparative information that is beneficial to an alternative therapist</p></td><td><p>9</p></td><td><p>3</p></td></tr><tr><td><p>5.838</p></td><td><p dir="rtl">Comparative information that is beneficial to an alternative therapist</p></td><td><p>6</p></td><td><p>4</p></td></tr>

** 2 SD from the comparison sample is statistically significant_nHey.

Money is Lord 6

Dependencies

10 The following costs will be used in the formulations of Vivirrex rHVT_YesMuniyeh. Includes the estimated costs incurred for the individual components, which are:_YHow much is a roll?_YThey will be easily replaced with the substrates of the alternative containers without modifying the protein antigen leads that are used._YFFⁿThese are the interpretation equations.

Glycoprotein ILTV gD, autotransposon (replica number: 1)

٤٢٤٣

-٥٧-

ATGCACCGTCCTCATCTCAGACGGCACTCGCGTTACTACGCGAAAGGA

GAGGTGCTTAACAAACACATGGATTGCGGGTGGAAAACGGTGCTGCTCA

GGCGCAGCTGTATTCACTCTTTTCTGGACTTGTGTCAGGATTATGCGG

GAGCATATCTGCTTTGTACGCAACGCTATGGACCGCCATTTATTTTTGA

GGAATGCTTTTTGGACTATCGTACTGCTTTCTTCCTTCGCTAGCCAGAG 5

CACCGCCGCCGTCACGTACGACTACATTTTAGGCCGTCGCGCGCTCG

ACGCGCTAACCATACCGGCGGTTGGCCCCGTATAACAGATACCTCACTA

GGGTATCAAGAGCTGCGACGTTGTCGAGCTCAACCCGATTTCTAACG

TGGACGACATGATATCGGGCGGCCAAAGAAAAAGAGAAGGGGGGCCCT

TTCGAGGCCTCCGTCGTCTGGTTCTACGTGATTAAGGGCGACGACGG 10

CGAGGACAAGTACTGTCCAATCTATAGAAAAGAGTACAGGGAATGTGG

CGACGTACAACTGCTATCTGAATGCGCCGTTCAATCTGCACAGATGTG

GGCAGTGGACTATGTTCCTAGCACCCTTGTATCGCGAAATGGCGCGG

GACTGACTATATTCTCCCCCACTGCTGCGCTCTCTGGCCAATACTTGCT

GACCCTGAAAAATCGGGAGATTTGCGCAAACAGCTCTCGTAACTCTAGA 15

AGTTAACGATCCGCTGTTTAAAGATCGGGTCGCAGCTTAACTTTTTACCG

TCGAAATGCTGGACAACAGAACAGTATCAGACTGGATTTCAAGGCGAA

CACCTTTTATCCGATCGCAGACACCAATACACGACACGCGGACGACGTA

TATCGGGGATACGAAGATATTCTGCAGCGCTGGAATAATTTGCTGAGG

AAAAAGAATCCTAGCGCGCCAGACCCTCGTCCAGATAGCGTCCCGCAA 20

GAAATTCCCGCTTGTAACCAAGAAAGCGGAAAGGGCGCACCCCGGACGC

AGAAAGCAGCGAAAAGAAGGCCCCTCCAGAAGACTCGGAGGACGACA

TGCAGGCAGAGGCTTCTGGAGAAAATCCTGCCGCCCTCCCCGAAGAC

GACGAAGTCCCCGAGGACACCGAGCACGATGATCCAAACTCGGATCC

TGACTATTACAATGACATGCCCCGCCGTGATCCCGGTGGAGGAGACTAC 25

TAAAAGTTCTAATGCCGTCTCCATGCCCATATTCGCGGCGTTCGTAGC

٤٢٤٣

-٥٨-

CTGCGCGGTCGCGCTCGTGGGGCTACTGGTTTGGAGCATCGTAAAAT

GCGCGCGTAGCTAA

Glycoprotein ILTV gD, interdependence transcribed (replica number: 2)

MHRPHLRRHSRYYAKGEVLNKHMDCGGKRCCSGAAVFTLFWTCVRIMR

EHICFVRNAMDRHLFLRNAFWTIVLLSSFASQSTAAVTYDYILGRRALDALT 5

IPAVGPYNRYLTRFSRGCDVVELNPISNVDDMISAAKEKEKGGPFEASVV

WFYVIKGDDGEDKYCPIYRKEYRECGDVQLLSECAVQSAQMWAVDYVPS

TLVSRNGAGLTIFSPTAALSGQYLLTLKIGRFAQTALVTLEVNDRCLKIGSQ

LNFLPSKCWTTEQYQTGFQGEHLYPIADTNTRHADDVYRGYEDILQRWN

NLLRKKNPSAPDPRPDSVPQEIPAVTKKAEGRTPDAESSEKKAPPEDSED 10

DMQAEASGENPAALPEDDEVPEDTEHDDPNSDPDYYNDMPAVIPVEETT

KSSNAVSMPIFAAFVACAVALVGLLVWSIVKCARS

ILTV gI Glycoprotein, glycoprotein (environmental glycoprotein: 3)

ATGGCATCGCTACTTGGAACTCTGGCTCTCCTTGCCGCGACGCTCGCA

CCCTTCGGCGCGATGGGAATCGGTGATCACTGGAAATCACGTCTCCGC 15

CAGGATTGACGACGATCACATCGTGATCGTCGCGCCTCGCCCCGAAG

CTACAATTCAACTGCAGCTATTTTTCATGCCTGGCCAGAGACCCCACAA

ACCCTACTCAGGAACCGTCCGCGTCGCGTTTCGGTCTGATATAACAAA

CCAGTGCTACCAGGAACTTAGCGAGGAGCGCTTTGAAAATTGCACTCA

TCGATCGTCTTCTGTTTTTGTCGGCTGTAAAGTGACCGAGTACACGTTC 20

TCCGCCTCGAACAGACTAACCGGACCTCCACACCCGTTTAAGCTCACT

ATACGAAATCCTCGTCCGAACGACAGCGGGATGTTCTACGTAATTGTT

CGGCTAGACGACACCAAAGAACCCATTGACGTCTTCGCGATCCAACTA

TCGGTGTATCAATTCGCGAACACCGCCGCGACTCGCGGACTCTATTCC

٤٢٤٣

-٥٩-

AAGGCTTCGTGTCGCACCTTCGGATTACCTACCGTCCAACTTGAGGCC

TATCTCAGGACCGAGGAAAGTTTGGCGCAACTGGCAAGCGTACGTTGC

CACGGAGGCCACGACGACCAGCGCCGAGGCGACAACCCCGACGCCC

GTCACTGCAACCAGCGCCTCCGAACTTGAAGCGGAACACTTTACCTTT

CCCTGGTAGAAAATGGCGTGGATCATTACGAACCGACACCGCAAAC 5

GAAAATTCAAACGTTACTGTCCGTCTCGGGACAATGAGCCCTACGCTA

ATTGGGGTAACCGTGGCTGCCGTCGTGAGCGCAACGATCGGCCTCGT

CATTGTAATTTCCATCGTCACCAGAAAACATGTGCACCCCGCACCGAAA

ATTAGACACGGTCTCGCAAGACGACGAAGAACGTTCCCAAACTAGAAG

GGAATCGCGAAAATTTGGACCCATGGTTGCGTGCGAAATAAACAAGGG 10

GGCTGACCAGGATAGTGAACTTGTGGAACTGGTTGCGATTGTTAACCC

GTCTGCGCTAAGCTCGCCCGACTCAATAAAAATGTGA

ILTV gI Glycoprotein (IQR: 4)

MASLLGTLALLAATLAPFGAMGIVITGNHVSARIDDDHIVIVARPEATIQLQ

LFFMPGQRPHKPYSGTVRVAFRSDITNQCYQELSEERFENCTRSSSVFV 15

GCKVTEYTFSASNRLTGPPHPFKLTIRNPRPNDSGMFYVIVRLDDTKEPID

VFAIQLSVYQFANTAATRGLYSKASCRTFGLPTVQLEAYLRTEESWRNWQ

AYVATEATTTSAEATTPTPPVTATSASELEAEHFTFPWLENGVDHYEPTPAN

ENSNVTVRLGTMSPTLIGVTVAAVVSATIGLVIVISIVTRNMCTPHRKLDTVS

QDDEERSQTRRESRKFGPMVACEINKGADQDSELVELVAIVNPSALSSPD 20

SIKM

Practical NDV F, Interdependence of Interpretation (Interdependence of Interpretation: 5): Al-Nasima 30

ATGGGCCCCAGACCTTCTACCAAGAACCCAGTACCTATGATGCTGACT

GTCCGAGTCGCGCTGGTACTGAGTTGCATCTGTCCGGCAAACTCCATT

٤٢٤٣

-٦٠-

GATGGCAGGCCTCTTGCGGCTGCAGGAATTGTGGTTACAGGAGACAA

AGCCGTCAACATATACACCTCATCCCAGACAGGATCAATCATAGTTAAG

CTCCTCCCGAATCTGCCCAAGGATAAGGAGGCATGTGCGAAAGCCCC

CTTGGATGCATACAACAGGACATTGACCACTTTGCTCACCCCCCTTGG

TGACTCTATCCGTAGGATACAAGAGTCTGTGACTACATCTGGAGGGGG 5

GAGACAGGGGCGCCTTATAAGGCGCCATTATTGGCGGTGTGGCTCTTG

GGGTTGCAACTGCGCACAAATAACAGCGGCCGCAGCTCTGATACAA

GCCAAACAAAATGCTGCCAACATCCTCCGACTTAAAGAGAGCATTGCC

GCAACCAATGAGGCTGTGCATGAGGTCACTGACGGATTATCGCAACTA

GCAGTGGCAGTTGGGAAGATGCAGCAGTTTGTTAATGACCAATTTAAT 10

AAAACAGCTCAGGAATTAGACTGCATCAAAATTGCACAGCAAGTTGGT

GTAGAGCTCAACCTGTACCTAACCGAATTGACTACAGTATTCGGACCA

CAAATCACTTCACCTGCTTTAAACAAGCTGACTATTCAGGCACTTTACA

ATTCTAGCTGGTGGAAATATGGATTACTTATTGACTAAGTTAGGTGTAGG

GAACAATCAACTCAGCTCATTAATCGGTAGCGGCTTAATCACCGGTAA 15

CCTATTCTATACGACTCACAGACTCAACTCTTTGGGTATACAGGTAACT

CTACCTTCAGTCGGGAAGCTAAAATAATATGCGTGCCACCTACTTGGAA

ACCTTATCCGTAAGCACAACCAGGGGATTTGCCTCGGCACTTGTCCCA

AAAGTGGTGACACAGGTCGGTTCTGTGATAGAAGAACTTGACACCTCA

TACTGTATAGAAACTGACTTACATTTATATTGTACAAGAATAGTAACGTT 20

CCCTATGTCCCCTGGTATTTATTCCTGCTTGAGCGGCAATACGTCGGC

CTGTATGTACTCAAAGACCGAAGGCGCACTTACTACACCATACATGACT

ATCAAAGGTTCAGTCATCGCCAACTGCAAGATGACAACATGTAGATGT

GTAAACCCCCCGGGTATCATATCGCAAAACTATGGAGAAGCCGTGTCT

CTAATAGATAAACAATCATGCAATGTTTTATCCTTAGGCGGGATAACTTT 25

AAGGCTCAGTGGGGAATTCGATGTAACTTATCAGAAGAATATCTCAATA

٤٢٤٣

-٦١-

CAAGATTCTCAAGTAATAATAACAGGCAATCTTGATATCTCAACTGAGC

TTGGGAATGTCAACAACTCGATCAGTAATGCTTTGAATAAGTTAGAGGA

AAGCAACAGAAAACTAGACAAAGTCAATGTCAAACTGACTAGCACATCT

GCTCTCATTACCTATATCGTGTTGACTATCATATCTCTTGTTTTTGGTAT

ACTTAGCCTGATTCTAGCATGCTACCTAATGTACAAGCAAAAGGCGCAA 5

CAAAAGACCTTATTATGGCTTGGGAATAATACTCTAGATCAGATGAGAG

CCACTACAAAATGTGA

Practical NDV F, Interdependence of Interpretation (Dependent Syntax: 6): Al-Nasima 30

MGPRPSTKNPVPMMLTVRVALVLSCICPANSIDGRPLAAAGIVVTGDKAVN

IYTSSQTGSIIVKLLPNLPKDKEACAKAPLDAYNRTLTTLLTPLGDSIRRIQE 10

SVTTSGGGRQGRLIGAIIGGVALGVATAAQITAAAALIQAKQNAANILRLKE

SIAATNEAVHEVTDGLSQLAVAVGKMQQFVNDQFNKTAQELDCIKIAQQV

GVELNLYLTELTTVFGPQITSPALNKLTIQALYNLAGGNMDYLLTKLGVGNN

QLSSLIGSGLITGNPILYDSQTQLLGIQVTLPSVGKLNNMRATYLETLSVSTT

RGFASALVPKVVTQVGSVIEELDTSYCIETDLHLYCTRIVTFPMSPGIYSCL 15

SGNTSACMYSKTEGALTTPYMTIKGSVIANCKMTTCRCVNPPGIISQNYGE

AVSLIDKQSCNVLSLGGITLRLSGEFDVTYQKNISIQDSQVIITGNLDISTELG

NVNNSISNALNKLEESNRKLDKVNVKLTSTSALITYIVLTIISLVFGILSLILAC

YLMYKQKAQQKTLLWLGNNTLDQMRATTKM

20 Reactive NDV F, replicon (replicator strain: 7): (B1 Hitchner strain)

ATGGATCGATCCGGTTGGCGCCCTCCAGGTGCAGGATGGGCTCCAG

ACCTTCTACCAAGAACCCACCTATGATGCTGACTATCCGGGTCGC

GCTGGTACTGAGTTGCATCTGTCCGGCAAACTCCATTGATGGCAGGCC

TCTTGCAGCTGCAGGAATTGTGGTTACAGGAGACAAAGCAGTCAACAT

٤٢٤٣

-٦٢-

ATACACCTCATCCCAGACAGGATCAATCATAGTAAGCTCCTCCCGAAT

CTGCCAAAGGATAAGGAGGCATGTGCGAAAGCCCCCTTGGATGCATA

CAACAGGACATTGAACCACTTTGCTCACCCCCTTGGTGACTCTATCCG

TAGGATACAAGAGTCTGTGACTACATCTGGAGGGGGGAGACAGGGGC

GCCTTATAAGGCGCCATTATTGGCGGTGTGGCTCTTGGGGTTGCAACTG 5

CCGCACAAATAACAGCGGCCGCAGCTCTGATACAAGCCAAACAAAATG

CTGCCAACATCCTCCGACTTAAAGAGAGCATTGCCCGCAACCAATGAGG

CTGTGCATGAGGTCACTGACGGATTATCGCAACTAGCAGTGGCAGTTG

GGAAGATGCAGCAGTTCGTTAATGACCAATTTAATAAAACAGCTCAGGA

ATTAGACTGCATCAAAATTGCACAGCAAGTTGGTGTAGAGCTCAACCT 10

GTACCTAACCGAATCGACTACAGTATTCGGACCACAAATCACTTCACCT

GCCTTAAACAAGCTGACTATTCAGGCACTTTACAATCTAGCTGGTGGG

AATATGGATTACTTATTGACTAAGTTAGGTATAGGGAACAATCAACTCA

GCTCATTAATCGGTAGCGGCTTAATCACCGGTAACCCTATTCTATACGA

CTCACAGACTCAACTCTTTGGGTATACAGGTAACTCTACCTTCAGTCGG 15

GAACCTAAATAATATGCGTGCCACCTACTTGGAAACCTTATCCGTAAGC

ACAACCAGGGGATTTGCCTCGGCACTTGTCCCAAAAGTGGTGACACG

GGTCGGTTTCTGTGATAGAAGAACTTGACACCTCATACTGTATAGAAACT

GACTTAGATTTATATTGTACAAGAATAGTAACGTTCCCTATGTCCCCTG

GTATTTACTCCTGCTTGAGCGGCAATACATCGGCCTGTATGTACTCAAA 20

GACCGAAGGCGCACTTACTACACCATATATGACTATCAAAGGCTCAGT

CATCGCTAACTGCAAGATGACAACATGTAGATGTGTAAACCCCCCGGG

TATCATATCGCAAAACTATGGAGAAGCCGTGTCTCTAATAGATAAAACAA

TCATGCAATGTTTTATCCTTAGGCGGGATAACTTTAAGGCTCAGTGGG

GAATTCGATGTAACTTATCAGAAGAATATCTCAATACAAGATTCTCAAGT 25

AATAATAACAGGCAATCTTGATATCTCAACTGAGCTTGGGAATGTCAAC

٤٢٤٣

-٦٣-

AACTCGATCAGTAATGCCTTGAATAAGTTAGAGGAAAGCAACAGAAAAC

TAGACAAAGTCAATGTCAAACTGACCAGCACATCTGCTCTCATTACCTA

TATCGTTTTGACTATCATATCTCTTGTTTTTGGTATACTTAGCCTGATTC

TAGCATGCTACCTAATGTACAAGCAAAAGGCGCAACAAAAGACCTTATT

ATGGCTTGGGAATAATACCCTAGATCAGATGAGAGCCACTACAAAAAT 5

GTGA

Reactive NDV F, replicon (replica number: 8): (B1 Hitchner strain)

MDRSRLAPSRCRMGSRPSTKNPAPMMLTIRVALVLSCICPANSIDGRPLA

AAGIVVTGDKAVNIYTSSQTGSIIVKLLLPNLPKDKEACAKAPLDAYNRTLTTL

LTPLGDSIRRIQESVTTSGGGRQGRLIGAIIGGVALGVATAAQITAAAALIQA 10

KQNAANILRLKESIAATNEAVHEVTDGLSQLAVAVGKMQQFVNDQFNKTA

QELDCIKIAQQVGVELNLYLTESTTVFGPQITSPALNKLTIQALYNLAGGNM

DYLLTKLGIGNNQLSSLIGSGLITGNPILYDSQTQLLGIQVTLPSVGNLNNM

RATYLETLSVSTTRGFASALVPKVVTRVGSVIEELDTSYCIETDLDLYCTRIV

TFPMSPGIYSCLSGNTSACMYSKTEGALTTPYMTIKGSVIANCKMTTCRCV 15

NPPGIISQNYGEAVSLIDKQSCNVLSLGGITLRLSGEFDVTYQKNISIQDSQ

VIITGNLDISTELGNVNNSISNALNKLEESNRKLDKVNVKLTSTSSALITYIVLTI

ISLVFGILSLILACYLMYKQKAQQKTLLWLGNNTLDQMRATTKM

ILTV gD (independent rate: 9)

AAACAGCTGTACTACAGAGTAACCGATGGAAAGAACATCGGTCCAGCTA 20

ATGTGCCTGTCGTGCACGAGCCATTCTCCGGAACCTTACTGTCTTTTC

GACACGTCTCTTATAGCGAGGGAAAAAGATATCGCGCAGAGTTATAC

TTTACCTCTGATCCGCAAACGGCATACTGCACAATAACTCTGCCCGTCC

GGCGTTGTTCCGAGATTCGAATGGAGCCTTAATAATGTTTCACTGCCG

٤٢٤٣

-٦٤-

GAATATTTGACGGCCACGACCGTTGTTTCGCATACCGCTGGCCAAAGT

ACAGTGTGGAAGAGCAGCGCGAGAGCAGGCGAGGGCGTGGATTTCTGG

CCGGGGAGGCAATATATACGAATGCACCGTCCTCATCTCAGACGGCAC

TCGCGTTACTACGCGAAAAGGAGAGGTGCTTAACAAACACATGGATTGC

GGTGGAAAACGGTGCTGCTCAGGCGCAGCTGTATTCACTCTTTTCTGG 5

ACTTGTGTCAGGATTATGCGGGAGCATATCTGCTTTGTACGCAACGCT

ILTV gI (independent rate: 10)

TGACTATTACAATGACATGCCCCGCCGTGATCCCGGTGGAGGAGACTAC

TAAAAGTTCTAATGCCGTCTCCATGCCCATATTCGCGGCGTTCGTAGC

CTGCGCGGTCGCGCTCGTGGGGCTACTGGTTTGGAGCATCGTAAAAT 10

GCGCGCGTAGCTAATCGAGCCTAGAATAGGTGGGTTTCTTCCTACATGC

CACGCCTCACGCTCATAATAATAAATCACATGGAATAGCATACCAATGCC

TATTCATTGGGACGTTCGAAAAGC

hCMV IE MV (CounterID: 11) (Innovative)

CGCGCCAGGTCAATTCCCTGGCATTATGCCCAGTACATGACCTTATGG 15

GACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCA

TGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTG

ACCACGGGGATTTCCAAGTCTCCACCCCCATTGACGTCAATGGGAGTT

TGTTTTGGACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTC

CGCCCCATTGACGCAAATGGGCGGTAGCGTGTACGGTGGGAGGTCTA 20

TATAAGCAGAGCTCGTTTAGTGAACCGTCAGATCGCCTGGAGACGCCA

TCCACGCTGTTTTGACCTCCATA

hCMV IE (Council number: 12): (Towne strain)

٤٢٤٣

-٦٥-

GTGAATAATAAAATGTGTGTTTGTCCGAAATACGGCGTTTGAGATTTCTG

TCCCGACTAAATTCATGTCGCGCGATAGTGGTGTTTATCGCCGATAGA

GATGGCGATATTTGGAAAAATCGATATTTGAAAATATGGCATATTGAAAA

TGTCGCCGATGTGAGTTTCTGTGTAACTGATATCGCCATTTTTTCCAAAA

GTTGATTTTGGGCATACGCGATATCTGGCGATACGCTTATATCGTTTA 5

CGGGGGATGGCGATAGACGCCTTTTGGTGACTTGGGCGATTCTGTGTG

TCGCAAATATCGCAGTTTCGATATAGGTGACAGACGATATGAGGCTATA

TCGCCGATAGAGGCGACATCAAGCTGGCACATGGCCAATGCATATCGA

TCTATACATTGAATCAATATTGGCCATTAGCCATATTATTCATTGGTTAT

ATAGCATAAATCAATATTGGCTATTGGCCATTGCATACGTTGTATCCAT 10

ATCATAATATGTACATTTATATTGGCTCATGTCCAACATTACCGCCATGT

TGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATT

AGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAAT

GGCCGCCTGGCTGACCCGCCCAACGACCCCCGCCCATTGACGTCAAT

AATGACGTATGTTCCCATAGTAACGCCAATAAGGGACTTTCCATTGACGT 15

CAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAA

GTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAAT

GGCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTA

CTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCG

GTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGG 20

ATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCAC

CAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGA

CGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGA

GCTCGTTTAGTGAACCGTCAGATCGCCTGGAGACGCCATCCACGCTGT

TTTGACCTCCATAGAAGACACCGG 25

٤٢٤٣

-٦٦-

Maram polyadenylation treatmentⁿ(And an interdependent entity: 13)

GGAATTCTAGATCCCACGTCACTATTGTATACTCTATATTATACTCTATG

TTATACTCTGTAATCCTACTCAATAAACGTGTCACGCCTGTGAAACCGT

ACTAAGTCTCCGTGTCTTCTTATCACCATCAGGTGACATCCTCCGCCCA

GGCTGTCAATCATGCCGTATCGATTCCAGTAGCACCGGCCCCACGCT 5

GACAACCCACTCTTGCAGCGTTAGCAGCGCCCCTCTTAACAAGCCGAC

CCCCACCAGCGTCGCGGTTACTAACACTCCTCTCCCCC

HSV TK polyadenylation treatment regimen (number: 14)

GGGAGATGGGGGAGGCTAACTGAAACACGGAAGGAGACAATACCGGA 10

AGGAACCCGCGCTATGACGGCAATAAAAGACAGAATAAAACGCACG

GTGTTGGTCCGTTTGTTCATAAACGCGGGGTTCGGTCCCAGGGCTGG

CACTCTGTCGATACCCCACCGAGACCCCATTGGGACCAATACGCCCG

CGTTTCTTCCTTTTCCCCACCCCAACCCCCAAGTTCGGGTGAAGGCCC

AGGGCTCGCAGCCAACGTCGGGGCGGCAAGCCCTGCCATAGCCACG 15

GGCCCCGTGGGTTAGGGACGGGGTCCCCCATGGGGAATGGTTTATGG

TTCGTGGGGGTTATTATTTTGGGCGTTGCGTGGGGTCAGGTCCACGAC

TGGACTGAGCAGACAGACCATGGTTTTTGGATGGCCTGGGCATGGA

CCGCATGTACTGGCGCGACACGAACACCGGGCGTCTGTGGCTGCCAA

ACACCCCCGACCCCCAAAAACCACCGCGCGGATTTCTGGCGCCGCCG 20

GACG

IE-NDV F (1317-46) (15 bp): (3593 bp)

TAATTAACCCGGGAAGCTTGCATGCCTGCAGTGAATAATAAAATGTGTG

TTTGTCCGAAATACGCGTTTGAGATTTCTGTCCCGACTAAATTCATGTC

٤٢٤٣

-٦٧-

GCGCGATAGTGGTGTTTATCGCCGATAGAGATAGGCGATATTGGAAAAA

TCGATATTTGAAAATATGGCATATTGAAAATGTCGCCGATGTGAGTTTC

TGTGTAACTGATATCGCCATTTTTCCAAAAGTTGATTTTTGGGCATACG

CGATATCTGGCGATAACGCTTATATCGTTTACCGGGGGATGGCGATAGAC

GCCTTTGGTGACTTGGGCGATTCTGTGTGTCGCAAATATCGCAGTTTC 5

GATATAGGGTGACAGACGATATGAGGGCTATATCGCCGATAGAGGCGACA

TCAAGCTGGCACATGGCCAATGCATATCGATCTATACATTGAATCAATA

TTGGCCATTAGCCATATTATTCATTGGTTATATAGCATAAATCAATATTG

GCTATTGGCCATTGCATACGTTGTATCCATATCATAATATGTACATTTAT

ATTGGCTCATGTCCAACATTACCGCCATGTTGACATTGATTATTGACTA 10

GTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATG

GAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCG

CCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATA

GTAACGCCAATAAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTA

CGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGT 15

ACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTAT

GCCCAGTACATGACCTTATGGGGACTTTCCTACTTGGCAGTACATCTAC

GTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCA

ATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACC

CCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACT 20

TTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGGCGGTA

GGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCGTTTAGTGAACC

GTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAGAA

GACACCGGGACCATGGATCGATCCGGTTGGCGCCCTCCAGGTGCAG

GATGGGCTCCAGACCTTCTACCAAGAACCCAGCACCTATGATGCTGAC 25

TATTCCGGGTCGCGCTGGTACTGAGTTGCATCTGTCCGGCAAACTCCAT

٤٢٤٣

-٦٨-

TGATGGCAGGCCTCTTGCAGCTGCAGGAATTGTGGTTACAGGAGACAA

AGCAGTCAACATATACACCTCATCCCAGACAGGATCAATCATAGTTAAG

CTCCTCCCGAATCTGCCAAAGGATAAGGAGGCATGTGCGAAAGCCCC

CTTGGATGCATACAACAGGACATTGACCACTTTGCTCACCCCCCTTGG

TGACTCTATCCGTAGGATACAAGAGTCTGTGACTACATCTGGAGGGGG 5

GAGACAGGGGCGCCTTATAAGGCGCCATTATTGGCGGTGTGGCTCTTG

GGGTTGCAACTGCGCACAAATAACAGCGGCCGCAGCTCTGATACAA

GCCAAACAAAATGCTGCCAACATCCTCCGACTTAAAGAGAGCATTGCC

GCAACCAATGAGGCTGTGCATGAGGTCACTGACGGATTATCGCAACTA

GCAGTGGCAGTTGGGAAGATGCAGCAGTTCGTTAATGACCAATTTAAT 10

AAAACAGCTCAGGAATTAGACTGCATCAAAATTGCACAGCAAGTTGGT

GTAGAGCTCAACCTGTACCTAACCGAATCGACTACAGTATTCGGACCA

CAAATCACTTCACCTGCCTTAAACAAGCTGACTATTCAGGCACTTTACA

ATTCTAGCTGGTGGGAATATGGATTACTTATTGACTAAGTTAGGTATAGG

GAACAATCAACTCAGCTCATTAATCGGTAGCGGCTTAATCACCGGTAA 15

CCTATTCTATACGACTCACAGACTCAACTCTTTGGGTATACAGGTAACT

CTACCTTCAGTCGGGAACCTAAATAATATGCGTGCCACCTACTTGGAAA

CCTTATCCGTAAGCACAACCAGGGGATTTGCCTCGGCACTTGTCCCAA

AAGTGGTGACACGGGTCGGTTCTGTGATAGAAGAACTTGACACCTCAT

ACTGTATAGAAACTGACTTAGATTTTATATTGTACAAGAATAGTAACGTTC 20

CCTATGTCCCCTGGTATTTACTCCTGCTTGAGCGGCAATACATCGGCC

TGTATGTACTCAAAGACCGAAGGCGCACTTACTACACCATATATGACTA

TCAAAGGCTCAGTCATCGCTAACTGCAAGATGACAACATGTAGATGTG

TAAACCCCCCGGGTATCATATCGCAAAACTATGGGAAAGCCGTGTCTC

TAATAGATAAACAATCATGCAATGTTTTATCCTTAGGCGGGATAACTTTA 25

AGGCTCAGTGGGGAATTCGATGTAACTTATCAGAAGAATATCTCAATAC

٤٢٤٣

-٦٩-

AAGATTCTCAAGTAATAATAACAGGCAATCTTGATATCTCAACTGAGCT

TGGGAATGTCAAACAACTCGATCAGTAATGCCTTGAATAAGTTAGAGGAA

AGCAACAGAAAACTAGACAAAGTCAATGTCAAACTGACCAGCACATCT

GCTCTCATTACCTATATCGTTTTGACTATCATATCTCTTGTTTTTGGTAT

ACTTAGCCTGATTCTAGCATGCTACCTAATGTACAAGCAAAAGGCGCAA 5

CAAAAGACCTTATTATGGCTTGGGAATAATACCCTAGATCAGATGAGAG

CCACTACAAAAATGTGAACACAGATGAGGAACGAAGGTTTCCCTAATA

GTAATTTGTGTGAAAGTTCTGGTAGTCTGTCAGTTCGGAGAGTTAAGAA

AAAAAAAAAACCCCCCCCCCCCCCCCCCCCCCTGGGTACGATC

CTCTAGAGTCGGGAGATGGGGGAGGCTAACTGAAACACGGAAGGAGA 10

CAATACCGGAAGGAACCCGCGCTATGACGGCAATAAAAAGACAGAATA

AAACGCACGGGTGTTGGGTCGTTTGTTCATAAACGCGGGGTTCGGTC

CAGGGCTGGCACTCTGTCGATACCCCACCGAGACCCCATTGGGACCA

ATACGCCCGCGTTTCTTCCTTTTCCCCACCCCAACCCCCAAGTTCGGG

TGAAGGCCCAGGGCTCGCAGCCAACGTCGGGGCGGCAAGCCCTGCC 15

ATAGCCACGGGCCCCGTGGGTTAGGGACGGGGTCCCCCATGGGGAA

TGGTTTATGGTTCGTGGGGGTTATTATTTTGGGCGTTGCGTGGGGTCA

GGTCCACGACTGGACTGAGCAGACAGACCCATGGTTTTTGGATGGCCT

GGGCATGGACCGCATGTACTGGCGCGACACGAACACCGGGCGTCTGT

GGCTGCCAAACACCCCCGACCCCCAAAAACCACCGCGCGGATTTCTG 20

GCGCCGCCGGACGTCGACTTAAT

The Interpretation of the Interpretation of the ILTV

gTCGACGGCAGAGTCGCAGACGCCCCTATTGGACGTCAAAATTGTAGA

GGTGAAGTTTTTCAAACGATGGGCGAAGTAACGGCGACTTGCGTTTCCAC

CGTCAAATCTCCCTATAGGGTAGAAACTAATTGGAAAGTAGACCTCGTA 25

٤٢٤٣

-٧٠-

GATGTAATGGATGAAATTTCTGGGAACAGTCCCGCCGGGGTTTTTAAC

AGTAATGAGAAATGGCAGAAACAGCTGTACTACAGAGTAACGATGGA

AGAACATCGGTCCAGCTAATGTGCCTGTCGTGCACGAGCCATTCTCCG

GAACCTTACTGTCTTTTCGACACGTCTCTTATAGCGAGGGAAAAAGATA

TCGCGCCAGAGTTATACTTTACCTCTGATCCCGCAAACGGCATACTGCA 5

CAATAACTCTGCCGTCCGGCGTTGTTCCGAGATTCGAATGGAGCCTTA

ATAATGTTTCACTGCCGGAATATTTGACGGCCACGACCGTTTTTTCGCA

TACCGCTGGCCAAAGTACAGTGTGGAAGAGCAGCGCGAGAGCAGGCG

AGGCGTGGATTTCTGGCCGGGGAGGCAATATATACGAATGCACCGTC

CTCATCTCAGACGGCACTCGCGTTACTACGCGAAAAGGAGAGGTGCTTA 10

ACAAACACATGGATTGCGGTGGAAAACGGTGCTGCTCAGGCGCAGCT

GTATTCACTCTTTTCTGGACTTGTGTCAGGATTATGCGGGAGCATATCT

GCTTTTGTACGCAACGCTATGGACCGCCATTTATTTTTGAGGAATGCTTT

TTGGACTATCGTACTGCTTTTCTTCCTTCGCTAGCCAGAGCACCGCCGC

CGTCACGTACGACTACATTTTAGGCCGTCGCGCGCTCGACGCGCTAAC 15

CATACCGGCGGTTGGCCCGTATAACAGATACCTCACTAGGGTATCAAG

AGGCTGCGACGTTGTCGAGCTCAACCCGATTTCTAACGTGGACGACAT

GATATCGGCCGGCCAAAGAAAAAGAGAAGGGGGGCCCTTTCGAGGCCT

CCGTCGTCTGGTTCTACGTGATTAAGGGCGACGACGGCGAGGACAAG

TACTGTCCAATCTATAGAAAAGAGTACAGGGAATGTGGCGACGTACAA 20

CTGCTATCTGAATGCGCCGTTCAATCTGCACAGATGTGGGCAGTGGAC

TATGTTCCTAGCACCCTTGTATCGCGAAATGGCGCGGGACTGACTATA

TTCTCCCCCACTGCTGCGCTCTCTGGCCAATACTTGCTGACCCTGAAA

ATCGGGAGATTTGCGCAAACAGCTCTCGTAACTCTAGAAGTTAACGAT

CGCTGTTTAAAGATCGGGTCGCAGCTTAACTTTTTACCGTCGAAATGCT 25

GGACAACAGAACAGTATCAGACTGGATTTCAAGGCGAACACCTTTTATC

٤٢٤٣

-٧١-

CGATCGCAGACACCAATACACGACACCGCGGACGACGTATATCGGGGA

TACGAAGATATTCTGCAGCGCTGGAATAATTTGCTGAGGAAAAAGAATC

CTAGCGCGCCAGACCCTCGTCCAGATAGCGTCCCGCAAGAAAATTCCC

GCTGTAACCAAGAAAGCGGAAGGGCGCACCCCGGACGCAGAAAGCAG

CGAAAAGAAGGGCCCCTCCAGAAGACTCGGAGGACGACATGCAGGCAG 5

AGGCTTCTGGAGAAAATCCTGCCGCCCTCCCCGAAAGACGACGAAGTC

CCCGAGGACACCGAGCACGATGATCCAAACTCGGATCCTGACTATTAC

AATGACATGCCCGCGTGATCCCGGTGGAGGAGACTACTAAAAGTTCT

AATGCCGTCTCCATGCCCATATTCGCGGCGTTCGTAGCCTGCGCGGTC

GCGCTCGTGGGGCTACTGGTTTGGAGCATCGTAAAATGCGCGCGTAG 10

CTAATCGAGCCTAGAATAGGTGGGTTTCTTCCTACATGCCACGCCTCAC

GCTCATAATATAAATCACATGGAATAGCATACCAATGCCTATTCATTGG

GACGTTCGAAAAGCATGGCATCGCTACTTGGAACTCTGGCTCTCCTTG

CCGCGACGCTCGCACCCTTCGGCGCGATGGGAATCGGTGATCACTGGA

AATCACGTCTCCGCCAGGATTGACGACGATCACATCGTGATCGTCGCG 15

CCTCGCCCCGAAGCTACAATTCAACTGCAGCTATTTTTCATGCCTGGC

CAGAGACCCCACAAACCCTACTCAGGAAACCGTCCGCGTCGCGTTTCG

GTCTGATATAACAAACCAGTGCTACCAGAACTTAGCGAGGGAGCGCTT

TGAAAATTGCACTCATCGATCGTCTTCTGTTTTTGTCGGCTGTAAAGTG

ACCGAGTACACGTTCTCCGCCTCGAACAGACTAACCGGACCTCCACAC 20

CCGTTTAAGCTCACTATACGAAATCCCTCGTCCGAACGACAGCGGGATG

TTTCTACGTAATTGTTCGCTAGACGACACCAAAGAACCCATTGACGTCT

TCGCGATCCAACTATCGGTGTATCAATTCGCGAACACCGCCGCGACTC

GCGGACTCTATTCCAAGGCTTCGTGTCGCACCTTCGGATTACCTACCG

TCCAACTTGAGGCTATCTCAGGACCGAGGAAAGTTTGGCGCAACTGG 25

CAAGCGTACGTTGCCACGGAGGCCACGACGACCAGCCGAGGCGA

٤٢٤٣

-٧٢-

CAACCCCCGACGCCCGTCACTGCAACCAGCGCCTCCGAACTTGAAGCG

GAACACTTTACCTTTCCCTGGCTAGAAAATGGGCGTGGATCATTACGAAC

CGACACCCGCAAACGAAAATTCAAACGTTACTGTCCGTCTCGGGACAA

TGAGCCCTACGCTAATTGGGGTAACCGTGGCTGCCGTCGTGAGCGCA

ACGATCGCCTCGTCATTGTAATTTCCATCGTCACCAGAAAACATGTGCA 5

CCCCGCACCGAAAATTAGACACGGTCTCGCAAGACGACGAAGAACGTT

CCCAAACTAGAAGGGAATCGGAAAATTTGGACCCATGGTTGCGTGCG

AAATAAACAAGGGGGCTGACCAGGATAGTGAACTTGTGGAACTGGTTG

CGATTGTTAACCCGTCTGCGCTAAGCTCGCCCGACTCAATAAAAATGT

GATTAAGTCTGAATGTGGCTCTCCAATCATTTCGATTCTCTAATCTTCCC 10

AATCCTCTCAAAAGGGGCAGTATCGGACACGGACTGGGAGGGGCGTA

CACGATAGTTATATGGTACAGCAGAGGCCTCTGAACACTTAGGAGGAG

AATTCAGCCGGGGAGAGCCCCTGTTGAGTAGGCTTGGGAGCATATTG

CAGGATGAACATGTTAGTGATAGTTCTCGCCTCTTGTCTTGCGCGCCT

AACTTTTGCGACGCGACACGTCCTCTTTTTTGGAAGGCACTCAGGCTGT 15

CCTCGGGGAAGATGATCCCAGAAACGTTCCGGAAGGGACTGTAATCAA

ATGGACAAAAGTCCTGCGGAACGCGTGCAAGATGAAGGCGGCCGATG

TCTGCTCTTCGCCTAACTATTGCTTTCATGATTTAATTTACGACGGAGG

AAAGAAAGACTGCCCGCCCGCGGGACCCCCTGTCTGCAAACCTGGTAA TTTTACTAAAGCGCGGCGAAagctt 20

Klīja Mamma'a of the expression Karai Anā'ī (Wakīyah Mutakaliyya Rab: 17): 5920 bp

gTCGACGGCAGAGTCGCAGACGCCCCTATTGGACGTCAAAATTGTAGA GGTGAAGTTTCAAACGATGGGCGAAGTAACGGCGACTTGCGTTTCCAC

CGTCAAATCTCCCTATAGGGTAGAAACTAATTGGAAAGTAGACCTCGTA

GATGTAATGGATGAAATTTCTGGGAACAGTCCCGCCGGGGTTTTTAAC 25

٤٢٤٣

-٧٣-

AGTAATGAGAAATGGCAGAAACAGCTGTACTACAGAGTAACGATGGA

AGAACATCGGTCCAGCTAATGTGCCTGTCGTGCACGAGCCATTCTCCG

GAACCTTACTGTCTTTTCGACACGTCTCTTATAGCGAGGGAAAAAGATA

TCGCGCCAGAGTTATACTTTACCTCTGATCCCGCAAACGGCATACTGCA

CAATAACTCTGCCGTCCGGCGTTGTTCCGAGATTCGAATGGAGCCTTA 5

ATAATGTTTCACTGCCGGAATATTTGACGGCCACGACCGTTTTTTCGCA

TACCGCTGGCCAAAGTACAGTGTGGAAGAGCAGCGCGAGAGCAGGCG

AGGCGTGGATTTCTGGCCGGGGAGGCAATATATACGAATGCACCGTC

CTCATCTCAGACGGCACTCGCGTTACTACGCGAAAAGGAGAGGTGCTTA

ACAAACACATGGATTGCGGTGGAAAACGGTGCTGCTCAGGCGCAGCT 10

GTATTCACTCTTTTCTGGACTTGTGTCAGGATTATGCGGGAGCATATCT

GCTTTTGTACGCAACGCTATGGACCGCCATTTATTTTTGAGGAATGCTTT

TTGGACTATCGTACTGCTTTTCTTCCTTCGCTAGCCAGAGCACCGCCGC

CGTCACGTACGACTACATTTTAGGCCGTCGCGCGCTCGACGCGCTAAC

CATACCGGCGGTTGGCCCGTATAACAGATACCTCACTAGGGTATCAAG 15

AGGCTGCGACGTTGTCGAGCTCAACCCGATTTCTAACGTGGACGACAT

GATATCGGCCGGCCAAAGAAAAAGAGAAGGGGGGCCCTTTCGAGGCCT

CCGTCGTCTGGTTCTACGTGATTAAGGGCGACGACGGCGAGGACAAG

TACTGTCCAATCTATAGAAAAGAGTACAGGGAATGTGGCGACGTACAA

CTGCTATCTGAATGCGCCGTTCAATCTGCACAGATGTGGGCAGTGGAC 20

TATGTTCCTAGCACCCTTGTATCGCGAAATGGCGCGGGACTGACTATA

TTCTCCCCCACTGCTGCGCTCTCTGGCCAATACTTGCTGACCCTGAAA

ATCGGGAGATTTGCGCAAACAGCTCTCGTAACTCTAGAAGTTAACGAT

CGCTGTTTAAAGATCGGGTCGCAGCTTAACTTTTTACCGTCGAAATGCT

GGACAACAGAACAGTATCAGACTGGATTTCAAGGCGAACACCTTTTATC 25

CGATCGCAGACACCAATACACGACACCGCGGACGACGTATATCGGGGA

٤٢٤٣

-٧٤-

TACGAAGATATTCTGCAGCGCTGGAATAATTTGCTGAGGAAAAAGAATC

CTAGCGCGCCAGACCCTCGTCCAGATAGCGTCCCGCAAGAAAATTCCC

GCTGTAACCAAGAAAGCGGAAGGGCGCACCCCGGACGCAGAAAGCAG

CGAAAAGAAGGGCCCCTCCAGAAGACTCGGAGGACGACATGCAGGCAG

AGGCTTCTGGAGAAAATCCTGCCGCCCTCCCCGAAAGACGACGAAGTC 5

CCCGAGGACACCGAGCACGATGATCCAAACTCGGATCCTGACTATTAC

AATGACATGCCCGCGTGATCCCGGTGGAGGAGACTACTAAAAGTTCT

AATGCCGTCTCCATGCCCATATTCGCGGCGTTCGTAGCCTGCGCGGTC

GCGCTCGTGGGGCTACTGGTTTGGAGCATCGTAAAATGCGCGCGTAG

CTAATCGAGCCTAGAATAGGTGGGTTTCTTCCTACATGCCACGCCTCAC 10

GCTCATAATATAAATCACATGGAATAGCATACCAATGCCTATTCATTGG

GACGTTCGAAAAGCATGGCATCGCTACTTGGAACTCTGGCTCTCCTTG

CCGCGACGCTCGCACCCTTCGGCGCGATGGGAATCGGTGATCACTGGA

AATCACGTCTCCGCCAGGATTGACGACGATCACATCGTGATCGTCGCG

CCTCGCCCCGAAGCTACAATTCAACTGCAGCTATTTTTCATGCCTGGC 15

CAGAGACCCCACAAACCCTACTCAGGAAACCGTCCGCGTCGCGTTTCG

GTCTGATATAACAAACCAGTGCTACCAGAACTTAGCGAGGGAGCGCTT

TGAAAATTGCACTCATCGATCGTCTTCTGTTTTTGTCGGCTGTAAAGTG

ACCGAGTACACGTTCTCCGCCTCGAACAGACTAACCGGACCTCCACAC

CCGTTTAAGCTCACTATACGAAATCCCTCGTCCGAACGACAGCGGGATG 20

TTTCTACGTAATTGTTCGCTAGACGACACCAAAGAACCCATTGACGTCT

TCGCGATCCAACTATCGGTGTATCAATTCGCGAACACCGCCGCGACTC

GCGGACTCTATTCCAAGGCTTCGTGTCGCACCTTCGGATTACCTACCG

TCCAACTTGAGGGCCTATCTCAGGACCGAGGAAAGTTTGGCGCAACTGG

CAAGCGTACGTTGCCACGGAGGCCACGACGACCAGCCGAGGCGA 25

CAACCCCCGACGCCCGTCACTGCAACCAGCGCCTCCGAACTTGAAGCG

٤٢٤٣

-٧٥-

GAACACTTTACCTTTCCCTGGCTAGAAAATGGGCGTGGATCATTACGAAC

CGACACCCGCAAACGAAAATTCAAACGTTACTGTCCGTCTCGGGACAA

TGAGCCCTACGCTAATTGGGGTAACCGTGGCTGCCGTCGTGAGCGCA

ACGATCGCCTCGTCATTGTAATTTCCATCGTCACCAGAAAACATGTGCA

CCCCGCACCGAAAATTAGACACGGTCTCGCAAGACGACGAAGAACGTT 5

CCCAAACTAGAAGGGAATCGGAAAATTTGGACCCATGGTTGCGTGCG

AAATAAACAAGGGGGCTGACCAGGATAGTGAACTTGTGGAACTGGTTG

CGATTGTTAACCCGTCTGCGCTAAGCTCGCCCGACTCAATAAAAATGT

GATTAAGTCTGAATGTGGCTCTCCAATCATTTCGATTCTCTAATCTTCCC

AATCCTCTCAAAAGGGGCAGTATCGGACACGGACTGGGAGGGGCGTA 10

CACGATAGTTATATGGTACAGCAGAGGCCTCTGAACACTTAGGAGGAG

AATTCAGCCGGGGAGAGCCCCTGTTGAGTAGGCTTGGGAGCATATTG

CAGGATGAACATGTTAGTGATAGTTCTCGCCTCTTGTCTTGCGCGCCT

AACTTTTGCGACGCGACACGTCCTCTTTTTTGGAAGGCACTCAGGCTGT

CCTCGGGGAAGATGATCCCAGAAACGTTCCGGAAGGGACTGTAATCAA 15

ATGGACAAAAGTCCTGCGGAACGCGTGCAAGATGAAGGCGGCCGATG

TCTGCTCTTCGCCTAACTATTGCTTTCATGATTTAATTTACGACGGAGG

AAAGAAAGACTGCCCGCCCGCGGGACCCCCTGTCTGCAAACCTGGTAA

TTTTACTAAAGCGCGGCGAAAGCTTCGCGCCAGGTCAATTCCCTGGCA

TTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATC 20

TACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACA

TCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCC

ACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGG

ACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCG

GTAGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCGTTTAGTGAA 25

CCGTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAG

٤٢٤٣

-٧٦-

AAGACACCGGTTGCGCCGCCACCATGGGCCCCAGACCTTCTACCAAG

AACCCAGTACCTATGATGCTGACTGTCCGAGTCGCGCTGGTACTGAGT

TGCATCTGTCCGGCAAACTCCATTGATGGCAGGCCTCTTGCGGCTGCA

GGAATTGTGGTTACAGGAGACAAAGCCGTCAACATATACACCTCATCC

CAGACAGGATCAATCATAGTTAAGCTCCTCCCGAATCTGCCCAAGGAT 5

AAGGAGGCATGTGCGAAAGCCCCCTTGGATGCATACAACAGGACATTG

ACCACTTTGCTCACCCCCTTGGTGACTCTATCCGTAGGATACAAGAG

TCTGTGACTACATCTGGAGGGGGGAGACAGGGGCGCCTTATAAGGCGC

CATTATTGGCGGTGTGGCTCTTGGGGTTGCAACTGCCGCACAAAATAAC

AGCGGCCGCAGCTTCTGATACAAGCCAAACAAAATGCTGCCAACATCCT 10

CCGACTTAAAGAGAGCATTGCCGCAACCAATGAGGCTGTGCATGAGGT

CACTGACGGATTATCGCAACTAGCAGTGGCAGTTGGGGAAGATGCAGCA

GTTTGTTAATGACCAATTTAATAAAACAGCTCAGGAATTAGACTGCATC

AAAATTGCACAGCAAGTTGGTGTAGAGCTCAACCTGTACCTAACCGAA

TTGACTACAGTATTCGGACCACAAATCACTTCACCTGCTTTAAACAAGC 15

TGACTATTCAGGCACTTTACAATCTAGCTGGTGGAAATATGGATTACTT

ATTGACTAAGTTAGGTGTAGGGAACAATCAACTCAGCTCATTAATCGGT

AGCGGCTTAATCACCGGTAACCCTATTCTATACGACTCACAGACTCAAC

TCTTGGGTATACAGGTAACTCTACCTTCAGTCGGGAAGCTAAATAATAT

GCGTGCCACCTACTTGGAAACCTTATCCGTAAGCACAACCAGGGGATT 20

TGCCTCGGCACTTGTCCCAAAAGTGGTGACACAGGTCGGTTCTTGTGAT

AGAAGAACTTGACACCTCATACTGTATAGAAACTGACTTACATTTATATT

GTACAAGAATAGTAACGTTCCCTATGTCCCCTGGTATTTATTCCTGCTT

GAGCGGCAATACGTCGGCCCTGTATGTACTCAAAGACCGAAGGCGCAC

TTACTACACCATACATGACTATCAAAGGTTCAGTCATCGCCAACTGCAA 25

GATGACAACATGTAGATGTGTAAACCCCCCGGGTATCATATCGCAAAA

٤٢٤٣

-٧٧-

CTATGGAGAAGCCGTGTCTCTAATAGATAAACAATCATGCAATGTTTTA

TCCTTAGGCGGGATAACTTTAAGGCTCAGTGGGGAATTCGATGTAACT

TATCAGAAGAATATCTCAATACAAGATTCTCAAGTAATAATAACAGGCA

ATCTTGATATCTCAACTGAGCTTGGGAATGTCAAACAACTCGATCAGTAA

TGCTTTGAATAAGTTAGAGGAAAGCAACAGAAAACTAGACAAAGTCAAT 5

GTCAAACTGACTAGCACATCTGCTCTCATTACCTATATCGTGTTGACTA

TCATATCTCTTGTTTTTGGTATACTTAGCCTGATTCTAGCATGCTACCTA

ATGTACAAGCAAAAGGCGCAACAAAAGACCTTATTATGGCTTGGGAAT

AATACTCTAGATCAGATGAGAGCCACTACAAAAATGTGAGGATCTCTCG

AGGAATTCTAGATCCCACGTCACTATTGTATACTCTATATTATACTCTAT 10

GTTATACTCTGTAATCCTACTCAATAAACGTGTCACGCCTGTGAAACCG

TACTAAGTCTCCCGTGTCTTCTTATCACCATCAGGTGACATCCTCGCCC

AGGCTGTCAATCATGCCGGTATCGATTCCAGTAGCACCGGCCCCACG

CTGACAACCCACTCTTGCAGCGTTAGCAGCGCCCCTCTTAACAAGCCG

ACCCCCACCAGCGTCGCGGTTACTAACACTCCTCTCCCCGACCTGCAA 15

CTAGT

If the rise is high, the most expensive_YQ_YesUse it to make your scissors work. Light up the work of the relevant models described in that context. In the Cape, there are various adjustments to the height of the high-rise areas, in addition to the cost in this area._YIt has become apparent to the qualifications of those experienced in the artistic field from the previous class. tmf

20 The adjustments to the actual cost of the cafeteria are all included in the field of financial elements that are based on the above-mentioned scale.

It is necessary to cover all the bases and amino acids, all the molecular weights in each molecular mass, which is similar to the name of the chemical compound in the polypeptide The values are approximate in themselves and are presented for the sake of description.

25 Dependencies

٤٢٤٣

-٧٨-

Intervet International BV &lt;110&gt;

Cook, Stephanie

Morsey, Mohamed

Petersen, Gary

RECOMBINANT NON-PATHOGENIC MAREK'S DISEASE VIRUS &lt;120&gt;

CONSTRUCTS

ENCODING INFECTIOUS LARYNGOTRACHEITIS VIRUS AND

NEWCASTLE DISEASE

VIRUS ANTIGENS

US-PCT-2011.029 &lt;130&lt;

549,844/61&gt;150&lt;

21-10-2011&gt;151&lt;

17&gt;160&lt;

PatentIn version 3.5&gt;170&lt;

1&gt;210&lt;

1305&gt;211&lt;

DNA &gt;212&lt;

Infectious laryngotracheitis virus &gt;213&lt; 1 &gt;400&lt;

10

15

٤٢٤٣

-٧٩-

atgcaccgtc ctcatctcag acggcactcg cgttactacg cgaaaggaga ggtgcttaac

60

aaacacatgg attgcggtgg aaaacggtgc tgctcaggcg cagctgtatt cactcttttc

120

tggacttgtg tcaggattat gcgggagcat atctgctttg tacgcaacgc tatggaccgc 1805

cattatttt tgaggaatgc tttttggact atcgtactgc tttcttcctt cgctagccag240

agcaccgccg ccgtcacgta cgactacatt ttaggccgtc gcgcgctcga cgcgctaacc

300

ataccggcgg ttggcccgta taacagatac ctcactaggg tatcaagagg ctgcgacgtt 36010

gtcgagctca acccgatttc taacgtggac gacatgatat cggcggccaa agaaaaagag

420

aaggggggcc ctttcgaggc ctccgtcgtc tggttctacg tgattaaggg cgacgacggc

480

gaggacaagt actgtccaat ctatagaaaa gagtacaggg aatgtggcga cgtacaactg 1 5

540

ctatctgaat gcgccgttca atctgcacag atgtgggcag tggactatgt tcctagcacc 600

cttgtatcgc gaaatggcgc gggactgact atattctccc ccactgctgc gctctctggc 660

caatacttgc tgaccctgaa aatcgggaga tttgcgcaaa cagctctcgt aactctagaa 720 20

gttaacgatc gctgtttaaa gatcgggtcg cagcttaact ttttaccgtc gaaatgctgg 780

٤٢٤٣

-٨٠-

acaacagaac agtatcagac tggatttcaa ggcgaacacc tttatccgat cgcagacacc

840

aatacacgac acgcggacga cgtatatcgg ggatacgaag atattctgca gcgctggaat

900

aatttgctga ggaaaaagaa tcctagcgcg ccagaccctc gtccagatag cgtcccgcaa 5

960

gaaattcccg ctgtaaccaa gaaagcggaa gggcgcaccc cggacgcaga aagcagcgaa

1020

aagaaggccc ctccagaaga ctcggaggac gacatgcagg cagaggcttc tggagaaaat

1080 10

cctgccgccc tccccgaaga cgacgaagtc cccgaggaca ccgagcacga tgatccaaac

1140

tcggatcctg actattacaa tgacatgccc gccgtgatcc cggtggagga gactactaaa

1200

agttctaatg ccgtctccat gcccatattc gcggcgttcg tagcctgcgc ggtcgcgctc 126015

gtggggctac tggtttggag catcgtaaaa tgcgcgcgta gctaa1305

2&gt;210&lt;

434&gt;211&lt;

PRT&gt;212&lt;

Infectious laryngotracheitis virus&gt;213&lt;20

2&gt;400&lt;

٤٢٤٣

-٨١-

Met His Arg Pro His Leu Arg Arg His Ser Arg Tyr Tyr Ala Lys Gly

15 10 51

Glu Val Leu Asn Lys His Met Asp Cys Gly Gly Lys Arg Cys Cys Ser

30 2520

Gly Ala Ala Val Phe Thr Leu Phe Trp Thr Cys Val Arg Ile Met Arg 5

45 4035

Glu His Ile Cys Phe Val Arg Asn Ala Met Asp Arg His Leu Phe Leu

60 5550

Arg Asn Ala Phe Trp Thr Ile Val Leu Leu Ser Ser Phe Ala Ser Gln

80 75 70 6510

Ser Thr Ala Ala Val Thr Tyr Asp Tyr Ile Leu Gly Arg Arg Ala Leu

95 9085

Asp Ala Leu Thr Ile Pro Ala Val Gly Pro Tyr Asn Arg Tyr Leu Thr

110 105100

Arg Val Ser Arg Gly Cys Asp Val Val Glu Leu Asn Pro Ile Ser Asn 15

125 120115

Val Asp Asp Met Ile Ser Ala Ala Lys Glu Lys Glu Lys Gly Gly Pro

140 135130

Phe Glu Ala Ser Val Val Trp Phe Tyr Val Ile Lys Gly Asp Asp Gly

٤٢٤٣

-٨٢-

160 155 150145

Glu Asp Lys Tyr Cys Pro Ile Tyr Arg Lys Glu Tyr Arg Glu Cys Gly

175 170165

Asp Val Gln Leu Leu Ser Glu Cys Ala Val Gln Ser Ala Gln Met Trp

190 185 1805

Ala Val Asp Tyr Val Pro Ser Thr Leu Val Ser Arg Asn Gly Ala Gly

205 200195

Leu Thr Ile Phe Ser Pro Thr Ala Ala Leu Ser Gly Gln Tyr Leu Leu

220 215210

Thr Leu Lys Ile Gly Arg Phe Ala Gln Thr Ala Leu Val Thr Leu Glu 10

240 235 230225

Val Asn Asp Arg Cys Leu Lys Ile Gly Ser Gln Leu Asn Phe Leu Pro

255 250245

Ser Lys Cys Trp Thr Thr Glu Gln Tyr Gln Thr Gly Phe Gln Gly Glu

270 265 26015

His Leu Tyr Pro Ile Ala Asp Thr Asn Thr Arg His Ala Asp Asp Val

285 280275

Tyr Arg Gly Tyr Glu Asp Ile Leu Gln Arg Trp Asn Asn Leu Leu Arg

300 295290

٤٢٤٣

-٨٣-

Lys Lys Asn Pro Ser Ala Pro Asp Pro Arg Pro Asp Ser Val Pro Gln

320 315 310305

Glu Ile Pro Ala Val Thr Lys Lys Ala Glu Gly Arg Thr Pro Asp Ala

335 330325

Glu Ser Ser Glu Lys Lys Ala Pro Pro Glu Asp Ser Glu Asp Asp Met 5

350 345340

Gln Ala Glu Ala Ser Gly Glu Asn Pro Ala Ala Leu Pro Glu Asp Asp

365 360355

Glu Val Pro Glu Asp Thr Glu His Asp Asp Pro Asn Ser Asp Pro Asp

380 375 37010

Tyr Tyr Asn Asp Met Pro Ala Val Ile Pro Val Glu Glu Thr Thr Lys

400 395 390385

Ser Ser Asn Ala Val Ser Met Pro Ile Phe Ala Ala Phe Val Ala Cys

415 410405

Ala Val Ala Leu Val Gly Leu Leu Val Trp Ser Ile Val Lys Cys Ala 15

430 425420

Arg Ser

3&gt;210&lt;

1089&gt;211&lt;

٤٢٤٣

-٨٤-

DNA&gt;212&lt;

Infectious laryngotracheitis virus &gt;213&lt;

3&gt;400&lt;

atggcatcgc tacttggaac tctggctctc cttgccgcga cgctcgcacc cttcggcgcg60

atgggaatcg tgatcactgg aaatcacgtc tccgccagga ttgacgacga tcacatcgtg 5 120

atcgtcgcgc ctcgccccga agctacaatt caactgcagc tatttttcat gcctggccag 180

agaccccaca aaccctactc aggaaccgtc cgcgtcgcgt ttcggtctga tataacaaac 24010

cagtgctacc aggaacttag cgaggagcgc tttgaaaatt gcactcatcg atcgtcttct 300

gtttttgtcg gctgtaaagt gaccgagtac acgttctccg cctcgaacag actaaccgga

360

cctccacacc cgtttaagct cactatacga aatcctcgtc cgaacgacag cgggatgttc 42015

tacgtaattg ttcggctaga cgacaccaaa gaacccattg acgtcttcgc gatccaacta

480

tcggtgtatc aattcgcgaa caccgccgcg actcgcggac tctattccaa ggcttcgtgt

540

cgcaccttcg gattacctac cgtccaactt gaggcctatc tcaggaccga ggaaagttgg 2 0

600

٤٢٤٣

-٨٥-

cgcaactggc aagcgtacgt tgccacggag gccacgacga ccagcgccga ggcgacaacc

660

ccgacgcccg tcactgcaac cagcgcctcc gaacttgaag cggaacactt tacctttccc

720

tggctagaaa atggcgtgga tcattacgaa ccgacacccg caaacgaaaa ttcaaacgtt 5

780

actgtccgtc tcgggacaat gagccctacg ctaattgggg taaccgtggc tgccgtcgtg

840

agcgcaacga tcggcctcgt cattgtaatt tccatcgtca ccagaaacat gtgcaccccg 900 10

caccgaaaat tagacacggt ctcgcaagac gacgaagaac gttcccaaac tagaagggaa

960

tcgcgaaaat ttggacccat ggttgcgtgc gaaataaaca agggggctga ccaggatagt

1020

gaacttgtgg aactggttgc gattgttaac ccgtctgcgc taagctcgcc cgactcaata 15

1080

aaaatgtga1089

4&gt;210&lt;

362&gt;211&lt;

PRT&gt;212&lt;20

Infectious laryngotracheitis virus &gt;213&lt;

٤٢٤٣

-٨٦-

4&gt;400&lt;

Met Ala Ser Leu Leu Gly Thr Leu Ala Leu Leu Ala Ala Thr Leu Ala

15 10 51

Pro Phe Gly Ala Met Gly Ile Val Ile Thr Gly Asn His Val Ser Ala

30 25 205

Arg Ile Asp Asp Asp His Ile Val Ile Val Ala Pro Arg Pro Glu Ala

45 4035

Thr Ile Gln Leu Gln Leu Phe Phe Met Pro Gly Gln Arg Pro His Lys

60 55 5010

Pro Tyr Ser Gly Thr Val Arg Val Ala Phe Arg Ser Asp Ile Thr Asn

80 75 7065

Gln Cys Tyr Gln Glu Leu Ser Glu Glu Arg Phe Glu Asn Cys Thr His

95 9085

Arg Ser Ser Ser Val Phe Val Gly Cys Lys Val Thr Glu Tyr Thr Phe 15

110 105100

Ser Ala Ser Asn Arg Leu Thr Gly Pro His Pro Phe Lys Leu Thr

125 120115

Ile Arg Asn Pro Arg Pro Asn Asp Ser Gly Met Phe Tyr Val Ile Val

٤٢٤٣

-٨٧-

140 135130

Arg Leu Asp Asp Thr Lys Glu Pro Ile Asp Val Phe Ala Ile Gln Leu

160 155 150145

Ser Val Tyr Gln Phe Ala Asn Thr Ala Ala Thr Arg Gly Leu Tyr Ser

175 170 1655

Lys Ala Ser Cys Arg Thr Phe Gly Leu Pro Thr Val Gln Leu Glu Ala

190 185180

Tyr Leu Arg Thr Glu Glu Ser Trp Arg Asn Trp Gln Ala Tyr Val Ala

205 200195

Thr Glu Ala Thr Thr Thr Ser Ala Glu Ala Thr Thr Pro Thr Pro Val 10

220 215210

Thr Ala Thr Ser Ala Ser Glu Leu Glu Ala Glu His Phe Thr Phe Pro

240 235 230225

Trp Leu Glu Asn Gly Val Asp His Tyr Glu Pro Thr Pro Ala Asn Glu

255 250 24515

Asn Ser Asn Val Thr Val Arg Leu Gly Thr Met Ser Pro Thr Leu Ile

270 265260

Gly Val Thr Val Ala Ala Val Val Ser Ala Thr Ile Gly Leu Val Ile

285 280275

٤٢٤٣

-٨٨-

Val Ile Ser Ile Val Thr Arg Asn Met Cys Thr Pro His Arg Lys Leu

300 295290

Asp Thr Val Ser Gln Asp Asp Glu Glu Arg Ser Gln Thr Arg Arg Glu

320 315 310305

Ser Arg Lys Phe Gly Pro Met Val Ala Cys Glu Ile Asn Lys Gly Ala 5

335 330325

Asp Gln Asp Ser Glu Leu Val Glu Leu Val Ala Ile Val Asn Pro Ser

350 345340

Ala Leu Ser Ser Pro Asp Ser Ile Lys Met

360 35510

5&gt;210&lt;

1662&gt;211&lt;

DNA &gt;212&lt;

Newcastle disease virus &gt;213&lt;

5 &gt;400&lt;15

atgggcccca gaccttctac caagaaccca gtacctatga tgctgactgt ccgagtcgcg

60

ctggtactga gttgcatctg tccggcaaac tccattgatg gcaggcctct tgcggctgca 120

٤٢٤٣

-٨٩-

ggaattgtgg ttacaggaga caaagccgtc aacatataca cctcatccca gacaggatca

180

atcatagtta agctcctccc gaatctgccc aaggataagg aggcatgtgc gaaagccccc

240

ttggatgcat acaacaggac attgaccact ttgctcaccc cccttggtga ctctatccgt 300 5

aggatacaag agtctgtgac tacatctgga ggggggagac aggggcgcct tataggcgcc

360

attattggcg gtgtggctct tggggttgca actgccgcac aaataacagc ggccgcagct

420

ctgatacaag ccaaacaaaa tgctgccaac atcctccgac ttaaagagag cattgccgca 1 0

480

accaatgagg ctgtgcatga ggtcactgac ggattatcgc aactagcagt ggcagttggg

540

aagatgcagc agtttgttaa tgaccaattt aataaaacag ctcaggaatt agactgcatc

60015

aaaattgcac agcaagttgg tgtagagctc aacctgtacc taaccgaatt gactacagta

660

ttcggaccac aaatcacttc acctgcttta aacaagctga ctattcaggc actttacaat 720

ctagctggtg gaaatatgga ttacttattg actaagttag gtgtagggaa caatcaactc780

agctcattaa tcggtagcgg cttaatcacc ggtaacccta ttctatacga ctcacagact 84020

٤٢٤٣

-٩٠-

caactcttgg gtatacaggt aactctacct tcagtcggga agctaaataa tatgcgtgcc

900

acctacttgg aaaccttatc cgtaagcaca accaggggat ttgcctcggc acttgtccca

960

aaagtggtga cacaggtcgg ttctgtgata gaagaacttg acacctcata ctgtatagaa 5

1020

actgacttac atttatattg tacaagaata gtaacgttcc ctatgtcccc tggtatttat 1080

tcctgcttga gcggcaatac gtcggcctgt atgtactcaa agaccgaagg cgcacttact

1140

acaccataca tgactatcaa aggttcagtc atcgccaact gcaagatgac aacatgtaga 10

1200

tgtgtaaacc ccccgggtat catatcgcaa aactatggag aagccgtgtc tctaatagat

1260

aaacaatcat gcaatgtttt atccttaggc gggataactt taaggctcag tggggaattc 1320

gatgtaactt atcagaagaa tatctcaata caagattctc aagtaataat aacaggcaat 15

1380

cttgatatct caactgagct tgggaatgtc aacaactcga tcagtaatgc tttgaataag 1440

ttagaggaaa gcaacagaaa actagacaaa gtcaatgtca aactgactag cacatctgct

1500

ctcattacct atatcgtgtt gactatcata tctcttgttt ttggtatact tagcctgatt 1560 20

٤٢٤٣

-٩١-

10

15

ctagcatgct acctaatgta caagcaaaag gcgcaacaaa agaccttatt atggcttggg

1620

aataatactc tagatcagat gagagccact acaaaaatgt ga1662

6&gt;210&lt;

553&gt;211&lt;

PRT &lt;212&lt;

Newcastle disease virus &gt;213&lt;

6&gt;400&lt;

Met Gly Pro Arg Pro Ser Thr Lys Asn Pro Val Pro Met Met Leu Thr

15 10 51

Val Arg Val Ala Leu Val Leu Ser Cys Ile Cys Pro Ala Asn Ser Ile

30 2520

Asp Gly Arg Pro Leu Ala Ala Ala Gly Ile Val Val Thr Gly Asp Lys

45 4035

Ala Val Asn Ile Tyr Thr Ser Ser Gln Thr Gly Ser Ile Ile Val Lys

60 5550

Leu Leu Pro Asn Leu Pro Lys Asp Lys Glu Ala Cys Ala Lys Ala Pro

80 75 7065

Leu Asp Ala Tyr Asn Arg Thr Leu Thr Thr Leu Leu Thr Pro Leu Gly

٤٢٤٣

-٩٢-

95

90

85

Asp Ser Ile Arg Arg Ile Gln Glu Ser Val Thr Thr Ser Gly Gly Gly

110 105100

Arg Gln Gly Arg Leu Ile Gly Ala Ile Ile Gly Gly Val Ala Leu Gly

125 120 1155

Val Ala Thr Ala Ala Gln Ile Thr Ala Ala Ala Ala Leu Ile Gln Ala

140 135130

Lys Gln Asn Ala Ala Asn Ile Leu Arg Leu Lys Glu Ser Ile Ala Ala

160 155 150145

Thr Asn Glu Ala Val His Glu Val Thr Asp Gly Leu Ser Gln Leu Ala 10

175 170165

Val Ala Val Gly Lys Met Gln Gln Phe Val Asn Asp Gln Phe Asn Lys

190 185180

Thr Ala Gln Glu Leu Asp Cys Ile Lys Ile Ala Gln Gln Val Gly Val

205 200 19515

Glu Leu Asn Leu Tyr Leu Thr Glu Leu Thr Thr Val Phe Gly Pro Gln

220 215210

Ile Thr Ser Pro Ala Leu Asn Lys Leu Thr Ile Gln Ala Leu Tyr Asn

240 235 230225

٤٢٤٣

-٩٣-

Leu Ala Gly Gly Asn Met Asp Tyr Leu Leu Thr Lys Leu Gly Val Gly

255 250245

Asn Asn Gln Leu Ser Ser Leu Ile Gly Ser Gly Leu Ile Thr Gly Asn

270 265260

Pro Ile Leu Tyr Asp Ser Gln Thr Gln Leu Leu Gly Ile Gln Val Thr 5

285 280275

Leu Pro Ser Val Gly Lys Leu Asn Asn Met Arg Ala Thr Tyr Leu Glu

300 295290

Thr Leu Ser Val Ser Thr Thr Arg Gly Phe Ala Ser Ala Leu Val Pro

320 315 310 30510

Lys Val Val Thr Gln Val Gly Ser Val Ile Glu Glu Leu Asp Thr Ser

335 330325

Tyr Cys Ile Glu Thr Asp Leu His Leu Tyr Cys Thr Arg Ile Val Thr

350 345340

Phe Pro Met Ser Pro Gly Ile Tyr Ser Cys Leu Ser Gly Asn Thr Ser 15

365 360355

Ala Cys Met Tyr Ser Lys Thr Glu Gly Ala Leu Thr Thr Pro Tyr Met

380 375370

Thr Ile Lys Gly Ser Val Ile Ala Asn Cys Lys Met Thr Thr Cys Arg

٤٢٤٣

-٩٤-

385

390

400395

Cys Val Asn Pro Pro Gly Ile Ile Ser Gln Asn Tyr Gly Glu Ala Val

415 410405

Ser Leu Ile Asp Lys Gln Ser Cys Asn Val Leu Ser Leu Gly Gly Ile

430 425 4205

Thr Leu Arg Leu Ser Gly Glu Phe Asp Val Thr Tyr Gln Lys Asn Ile

445 440435

Ser Ile Gln Asp Ser Gln Val Ile Ile Thr Gly Asn Leu Asp Ile Ser

460 455450

Thr Glu Leu Gly Asn Val Asn Asn Ser Ile Ser Asn Ala Leu Asn Lys 10

480 475 470465

Leu Glu Glu Ser Asn Arg Lys Leu Asp Lys Val Asn Val Lys Leu Thr

495 490485

Ser Thr Ser Ala Leu Ile Thr Tyr Ile Val Leu Thr Ile Ile Ser Leu

510 505 50015

Val Phe Gly Ile Leu Ser Leu Ile Leu Ala Cys Tyr Leu Met Tyr Lys

525 520515

Gln Lys Ala Gln Gln Lys Thr Leu Leu Trp Leu Gly Asn Asn Thr Leu

540 535530

٤٢٤٣

-٩٥-

Asp Gln Met Arg Ala Thr Thr Lys Met

550545

7&gt;210&lt;

1698&gt;211&lt;

DNA&gt;212&lt;5

Newcastle disease virus&gt;213&lt;

7&gt;400&lt;

atggatcgat cccggttggc gccctccagg tgcaggatgg gctccagacc ttctaccaag

60

aacccagcac ctatgatgct gactatccgg gtcgcgctgg tactgagttg catctgtccg 1 0

120

gcaaactcca ttgatggcag gcctcttgca gctgcaggaa ttgtggttac aggagacaaa

180

gcagtcaaca tatacacctc atcccagaca ggatcaatca tagttaagct cctcccgaat

240 15

ctgccaaagg ataaggaggc atgtgcgaaa gcccccttgg atgcatacaa caggacattg

300

accactttgc tcacccccct tggtgactct atccgtagga tacaagagtc tgtgactaca 360

tctggagggg ggagacaggg gcgccttata ggcgccatta ttggcggtgt ggctcttggg

420 20

٤٢٤٣

-٩٦-

gttgcaactg ccgcacaaat aacagcggcc gcagctctga tacaagccaa acaaaatgct

480

gccaacatcc tccgacttaa agagagcatt gccgcaacca atgaggctgt gcatgaggtc

540

actgacggat tatcgcaact agcagtggca gttgggaaga tgcagcagtt cgttaatgac 5

600

caatttaata aaacagctca ggaattagac tgcatcaaaa ttgcacagca agttggtgta

660

gagctcaacc tgtacctaac cgaatcgact acagtattcg gaccacaaat cacttcacct 72010

gccttaaaca agctgactat tcaggcactt tacaatctag ctggtgggaa tatggattac 780

ttattgacta agttaggtat agggaacaat caactcagct cattaatcgg tagcggctta 840

atcaccggta accctattct atacgactca cagactcaac tcttggggtat acaggtaact900

ctaccttcag tcgggaacct aaataatatg cgtgccacct acttggaaac ctttatccgta960

agcacaacca ggggatttgc ctcggcactt gtcccaaaag tggtgacacg ggtcggttct 15

1020

gtgatagaag aacttgacac ctcatactgt atagaaactg acttagattt atattgtaca 1080

agaatagtaa cgttccctat gtcccctggt atttactcct gcttgagcgg caatacatcg 1140

gcctgtatgt actcaaagac cgaaggcgca cttactacac catatatgac tatcaaaggc 1200 20

٤٢٤٣

-٩٧-

tcagtcatcg ctaactgcaa gatgacaaca tgtagatgtg taaaccccccc gggtatcata

1260

tcgcaaaact atggagaagc cgtgtctcta atagataaac aatcatgcaa tgttttatcc

1320

ttaggcggga taactttaag gctcagtggg gaattcgatg taacttatca gaagaatatc 5

1380

tcaatacaag attctcaagt aataataaca ggcaatcttg atatctcaac tgagcttggg

1440

aatgtcaaca actcgatcag taatgccttg aataagttag aggaaagcaa cagaaaacta

1500 10

gacaaagtca atgtcaaact gaccagcaca tctgctctca ttacctatat cgttttgact 1560

atcatatctc ttgtttttgg tatacttagc ctgattctag catgctacct aatgtacaag 1620

caaaaggcgc aacaaaagac ctttattgg cttgggaata ataccctaga tcagatgaga

1680

gccactacaa aaatgtga

1698

15

8 &gt;210&lt;

565 &gt;211&lt;

PRT &lt;212&lt;

Newcastle disease virus &gt;213&lt;

8 &gt;400&lt;

20

Met Asp Arg Ser Arg Leu Ala Pro Ser Arg Cys Arg Met Gly Ser Arg

٤٢٤٣

-٩٨-

15

10

Pro Ser Thr Lys Asn Pro Ala Pro Met Met Leu Thr Ile Arg Val Ala

30 2520

Leu Val Leu Ser Cys Ile Cys Pro Ala Asn Ser Ile Asp Gly Arg Pro

45 40 355

Leu Ala Ala Ala Gly Ile Val Val Thr Gly Asp Lys Ala Val Asn Ile

60 5550

Tyr Thr Ser Ser Gln Thr Gly Ser Ile Ile Val Lys Leu Leu Pro Asn

80 75 70 6510

Leu Pro Lys Asp Lys Glu Ala Cys Ala Lys Ala Pro Leu Asp Ala Tyr

95 9085

Asn Arg Thr Leu Thr Thr Thr Leu Leu Thr Pro Leu Gly Asp Ser Ile Arg

110 105100

Arg Ile Gln Glu Ser Val Thr Thr Ser Gly Gly Gly Arg Gln Gly Arg 15

125 120115

Leu Ile Gly Ala Ile Ile Gly Gly Val Ala Leu Gly Val Ala Thr Ala

140 135130

Ala Gln Ile Thr Ala Ala Ala Ala Leu Ile Gln Ala Lys Gln Asn Ala

٤٢٤٣

-٩٩-

145

150

160

155

Ala Asn Ile Leu Arg Leu Lys Glu Ser Ile Ala Ala Thr Asn Glu Ala

175 170165

Val His Glu Val Thr Asp Gly Leu Ser Gln Leu Ala Val Ala Val Gly

190 185 1805

Lys Met Gln Gln Phe Val Asn Asp Gln Phe Asn Lys Thr Ala Gln Glu

205 200195

Leu Asp Cys Ile Lys Ile Ala Gln Gln Val Gly Val Glu Leu Asn Leu

220 215210

Tyr Leu Thr Glu Ser Thr Thr Val Phe Gly Pro Gln Ile Thr Ser Pro 10

240 235 230225

Ala Leu Asn Lys Leu Thr Ile Gln Ala Leu Tyr Asn Leu Ala Gly Gly

255 250245

Asn Met Asp Tyr Leu Leu Thr Lys Leu Gly Ile Gly Asn Asn Gln Leu

270 265 26015

Ser Ser Leu Ile Gly Ser Gly Leu Ile Thr Gly Asn Pro Ile Leu Tyr

285 280275

Asp Ser Gln Thr Gln Leu Leu Gly Ile Gln Val Thr Leu Pro Ser Val

300 295290

٤٢٤٣

١٠٠-

Gly Asn Leu Asn Asn Met Arg Ala Thr Tyr Leu Glu Thr Leu Ser Val

320 315 310305

Ser Thr Thr Arg Gly Phe Ala Ser Ala Leu Val Pro Lys Val Val Thr

335 330325

Arg Val Gly Ser Val Ile Glu Glu Leu Asp Thr Ser Tyr Cys Ile Glu 5

350 345340

Thr Asp Leu Asp Leu Tyr Cys Thr Arg Ile Val Thr Phe Pro Met Ser

365 360355

Pro Gly Ile Tyr Ser Cys Leu Ser Gly Asn Thr Ser Ala Cys Met Tyr

380 375 37010

Ser Lys Thr Glu Gly Ala Leu Thr Thr Pro Tyr Met Thr Ile Lys Gly

400 395 390385

Ser Val Ile Ala Asn Cys Lys Met Thr Thr Cys Arg Cys Val Asn Pro

415 410405

Pro Gly Ile Ile Ser Gln Asn Tyr Gly Glu Ala Val Ser Leu Ile Asp 15

430 425420

Lys Gln Ser Cys Asn Val Leu Ser Leu Gly Gly Ile Thr Leu Arg Leu

445 440435

Ser Gly Glu Phe Asp Val Thr Tyr Gln Lys Asn Ile Ser Ile Gln Asp

٤٢٤٣

-١٠١-

460 455450

Ser Gln Val Ile Ile Thr Gly Asn Leu Asp Ile Ser Thr Glu Leu Gly

480 475 470465

Asn Val Asn Asn Ser Ile Ser Asn Ala Leu Asn Lys Leu Glu Glu Ser

495 490 4855

Asn Arg Lys Leu Asp Lys Val Asn Val Lys Leu Thr Ser Thr Ser Ala

510 505500

Leu Ile Thr Tyr Ile Val Leu Thr Ile Ile Ser Leu Val Phe Gly Ile

525 520515

Leu Ser Leu Ile Leu Ala Cys Tyr Leu Met Tyr Lys Gln Lys Ala Gln 10

540 535530

Gln Lys Thr Leu Leu Trp Leu Gly Asn Asn Thr Leu Asp Gln Met Arg

560 555 550545

Ala Thr Thr Lys Met

56515

9&gt;210&lt;

527&gt;211&lt;

DNA &gt;212&lt;

Infectious laryngotracheitis virus &gt;213&lt;

٤٢٤٣

-١٠٢-

9 &gt;400&lt;

aaacagctgt actacagagt aaccgatgga agaacatcgg tccagctaat gtgcctgtcg

60

tgcacgagcc attctccgga accttactgt cttttcgaca cgtctcttat agcgagggaa 120

aaagatatcg cgccagagtt atactttacc tctgatccgc aaacggcata ctgcacaata 5

180

actctgccgt ccggcgttgt tccgagattc gaatggagcc ttaataatgt ttcactgccg 240

gaatatttga cggccacgac cgttgtttcg cataccgctg gccaaagtac agtgtggaag

300

agcagcgcga gagcaggcga ggcgtggatt tctggccggg gaggcaatat atacgaatgc 10

360

accgtcctca tctcagacgg cactcgcgtt actacgcgaa aggagaggtg cttaacaaac

420

acatggattg cggtggaaaa cggtgctgct caggcgcagc tgtattcact cttttctgga 480

cttgtgtcag gattatgcgg gagcatatct gctttgtacg caacgct 52715

10&gt;210&lt;

264&gt;211&lt;

DNA &gt;212&lt;

Infectious laryngotracheitis virus &gt;213&lt;

10 &gt;400&lt;20

٤٢٤٣

-١٠٣-

tgactattac aatgacatgc ccgccgtgat cccggtggag gagactacta aaagttctaa

60

tgccgtctcc atgcccatat tcgcggcgtt cgtagcctgc gcggtcgcgc tcgtggggct 120

actggtttgg agcatcgtaa aatgcgcgcg tagctaatcg agcctagaat aggtggtttc 1805

ttcctacatg ccacgcctca cgctcataat ataaatcaca tggaatagca taccaatgcc

240

tattcattgg gacgttcgaa aagc264

11&gt;210&lt;

360 &gt;211&lt;10

DNA &gt;212&lt;

Human cytomegalovirus &lt;213&gt;

11&gt;400&lt;

cgcgccaggt caattccctg gcattatgcc cagtacatga ccttatggga ctttcctact60

tggcagtaca tctacgtatt agtcatcgct attaccatgg tgatgcggtt ttggcagtac 12015

atcaatgggc gtggatagcg gtttgactca cggggatttc caagtctcca ccccattgac

180

gtcaatggga gtttgttttg gcaccaaaat caacgggact ttccaaaatg tcgtaacaac

240

tccgccccat tgacgcaaat gggcggtagc gtgtacggtg ggaggtctat ataagcagag 2 0

300

٤٢٤٣

-١٠٤-

ctcgtttagt gaaccgtcag atcgcctgga gacgccatcc acgctgtttt gacctccata 360

12&gt;210&lt;

1191&gt;211&lt;

DNA &gt;212&lt;

Human cytomegalovirus &gt;213&lt;5

12&gt;400&lt;

gtgaataata aaatgtgtgt ttgtccgaaa tacgcgtttg agatttctgt cccgactaaa60

ttcatgtcgc gcgatagtgg tgtttatcgc cgatagagat ggcgatattg gaaaaatcga

120

tatttgaaaa tatggcatat tgaaaatgtc gccgatgtga gtttctgtgt aactgatatc 18010

gccatttttc caaaagttga tttttgggca tacgcgatat ctggcgatac gcttatatcg 240

tttacgggggg atggcgatag acgcctttgg tgacttgggc gattctgtgt gtcgcaaata 300

tcgcagtttc gatataggtg acagacgata tgaggctata tcgccgatag aggcgacatc

360

aagctggcac atggccaatg catatcgatc tatacattga atcaatattg gccattagcc 1 5

420

atattattca ttggttatat agcataaatc aatattggct attggccatt gcatacgttg 480

tatccatatc ataatatgta catttatatt ggctcatgtc caacattacc gccatgttga 540

cattgattat tgactagtta ttaatagtaa tcaattacgg ggtcattagt tcatagccca 600

٤٢٤٣

-١٠٥-

tatatggagt tccgcgttac ataacttacg gtaaatggcc cgcctggctg accgcccaac

660

gacccccgcc cattgacgtc aataatgacg tatgttccca tagtaacgcc aataggggact

720

ttccattgac gtcaatgggt ggagtattta cggtaaactg cccacttggc agtacatcaa 780 5

gtgtatcata tgccaagtac gccccctatt gacgtcaatg acggtaaatg gcccgcctgg

840

cattatgccc agtacatgac cttatgggac tttcctactt ggcagtacat ctacgtatta 900

gtcatcgcta ttaccatggt gatgcggttt tggcagtaca tcaatggggcg tggatagcgg 960

tttgactcac ggggatttcc aagtctccac cccattgacg tcaatgggag tttgttttgg 1020 10

caccaaaatc aacgggactt tccaaaatgt cgtaacaact ccgccccatt gacgcaaatg

1080

ggcggtaggc gtgtacggtg ggaggtctat ataagcagag ctcgtttagt gaaccgtcag

1140

atcgcctgga gacgccatcc acgctgtttt gacctccata gaagacaccg g 119115

13&gt;210&lt;

281&gt;211&lt;

DNA &gt;212&lt;

Artificial Sequence &lt;213&lt;

&gt;220&lt;20

٤٢٤٣

-١٠٦-

Synthetic sequence &lt;223&lt;

13 &gt;400&lt;

ggaattctag atcccacgtc actattgtat actctatatt atactctatg ttatactctg 60

taatcctact caataaacgt gtcacgcctg tgaaaccgta ctaagtctcc cgtgtcttct 120

tatcaccatc aggtgacatc ctcgcccagg ctgtcaatca tgccggtatc gattccagta 5

180

gcaccggccc cacgctgaca acccactctt gcagcgttag cagcgcccct cttaacaagc

240

cgacccccac cagcgtcgcg gttactaaca ctcctctccc c281

14 &gt;210&lt;10

523&gt;211&lt;

DNA &gt;212&lt;

herpes simplex virus &gt;213&lt;

14&gt;400&lt;

gggagatggg ggaggctaac tgaaacacgg aaggagacaa taccggaagg aacccgcgct 15

60

atgacggcaa taaaaagaca gaataaaacg cacgggtgtt gggtcgtttg ttcataaacg

120

cggggttcgg tcccaggggct ggcactctgt cgatacccca ccgagacccc attgggacca

180 20

٤٢٤٣

-١٠٧-

atacgcccgc gtttcttcct tttccccacc ccaaccccca agttcgggtg aaggcccagg

240

gctcgcagcc aacgtcgggg cggcaagccc tgccatagcc acgggccccg tgggttaggg

300

acggggtccc ccatggggaa tggtttatgg ttcgtgggggg ttattatttt gggcgttgcg 360 5

tggggtcagg tccacgactg gactgagcag acagacccat ggtttttgga tggcctggggc

420

atggaccgca tgtactggcg cgacacgaac accgggcgtc tgtggctgcc aaacaccccc

480

gacccccaaa aaccaccgcg cggatttctg gcgccgccgg acg 52310

15&gt;210&lt;

3593&gt;211&lt;

DNA &gt;212&lt;

Artificial Sequence &lt;213&lt;

&gt;220&lt;15

Expression cassette insert &lt;223&gt;

15&gt;400&lt;

taattaaccc gggaagcttg catgcctgca gtgaataata aaatgtgtgt ttgtccgaaa60

tacgcgtttg agatttctgt cccgactaaa ttcatgtcgc gcgatagtgg tgtttatcgc120

٤٢٤٣

-١٠٨-

cgatagagat ggcgatattg gaaaaatcga tatttgaaaa tatggcatat tgaaaatgtc

180

gccgatgtga gtttctgtgt aactgatatc gccatttttc caaaagttga tttttgggca240

tacgcgatat ctggcgatac gcttatatcg tttacggggg atggcgatag acgcctttgg300

tgacttgggc gattctgtgt gtcgcaaata tcgcagtttc gatataggtg acagacgata 3605

tgaggctata tcgccgatag aggcgacatc aagctggcac atggccaatg catatcgatc

420

tatacattga atcaatattg gccattagcc atattattca ttggttatat agcataaatc 480

aatattggct attggccatt gcatacgttg tatccatatc ataatatgta catttatatt 540

ggctcatgtc caacattacc gccatgttga cattgattat tgactagtta ttaatagtaa 600 10

tcaattacgg ggtcattagt tcatagccca tatatggagt tccgcgttac ataacttacg 660

gtaaatggcc cgcctggctg accgcccaac gacccccgcc cattgacgtc aataatgacg

720

tatgttccca tagtaacgcc aatagggact ttccattgac gtcaatggggt ggagtattta 780

cggtaaactg cccacttggc agtacatcaa gtgtatcata tgccaagtac gccccctatt 1 5

840

gacgtcaatg acggtaaatg gcccgcctgg cattatgccc agtacatgac ctttatgggac

900

tttcctactt ggcagtacat ctacgtatta gtcatcgcta ttaccatggt gatgcggttt 960

tggcagtaca tcaatggggcg tggatagcgg tttgactcac ggggatttcc aagtctccac 20

1020

٤٢٤٣

-١٠٩-

cccattgacg tcaatggggag tttgttttgg caccaaaatc aacgggactt tccaaaatgt

1080

cgtaacaact ccgccccatt gacgcaaatg ggcggtaggc gtgtacggtg ggaggtctat

1140

ataagcagag ctcgtttagt gaaccgtcag atcgcctgga gacgccatcc acgctgtttt 5

1200

gacctccata gaagacaccg ggaccatgga tcgatcccgg ttggcgccct ccaggtgcag

1260

gatgggctcc agaccttcta ccaagaaccc agcacctatg atgctgacta tccgggtcgc

1320 10

gctggtactg agttgcatct gtccggcaaa ctccattgat ggcaggcctc ttgcagctgc

1380

aggaattgtg gttacaggag acaaagcagt caacatatac acctcatccc agacaggatc

1440

aatcatagtt aagctcctcc cgaatctgcc aaaggataag gaggcatgtg cgaaagcccc 15

1500

cttggatgca tacaacagga cattgaccac tttgctcacc ccccttggtg actctatccg 1560

taggatacaa gagtctgtga ctacatctgg aggggggaga caggggcgcc ttataggcgc

1620

cattattggc ggtgtggctc ttggggttgc aactgccgca caaataacag cggccgcagc 20

1680

٤٢٤٣

-١١٠-

tctgatacaa gccaaacaaa atgctgccaa catcctccga cttaaagaga gcattgccgc

1740

aaccaatgag gctgtgcatg aggtcactga cggattatcg caactagcag tggcagttgg

1800

gaagatgcag cagttcgtta atgaccaatt taataaaaca gctcaggaat tagactgcat 5

1860

caaaattgca cagcaagttg gtgtagagct caacctgtac ctaaccgaat cgactacagt

1920

attcggacca caaatcactt cacctgcctt aaacaagctg actattcagg cactttacaa 1980 10

tctagctggt gggaatatgg attacttatt gactaagtta ggtataggga acaatcaact 2040

cagctcatta atcggtagcg gcttaatcac cggtaaccct attctatacg actcacagac

2100

tcaactcttg ggtatacagg taactctacc ttcagtcggg aacctaaata atatgcgtgc 2160

cacctacttg gaaaccttat ccgtaagcac aaccagggga tttgcctcgg cacttgtccc 15

2220

aaaagtggtg acacgggtcg gttctgtgat agaagaactt gacacctcat actgtataga

2280

aactgactta gatttatatt gtacaagaat agtaacgttc cctatgtccc ctggtattta 2340

ctcctgcttg agcggcaata catcggcctg tatgtactca aagaccgaag gcgcacttac 20

2400

٤٢٤٣

-١١١-

tacaccatat atgactatca aaggctcagt catcgctaac tgcaagatga caacatgtag

2460

atgtgtaaac cccccgggta tcatatcgca aaactatgga gaagccgtgt ctctaataga

2520

taaacaatca tgcaatgttt tatccttagg cgggataact ttaaggctca gtggggaatt 25805

cgatgtaact tatcagaaga atatctcaat acaagattct caagtaataa taacaggcaa

2640

tcttgatatc tcaactgagc ttgggaatgt caacaactcg atcagtaatg ccttgaataa 2700

gttagaggaa agcaacagaa aactagacaa agtcaatgtc aaactgacca gcacatctgc 276010

tctcattacc tatatcgttt tgactatcat atctcttgtt tttggtatac ttagcctgat 2820

tctagcatgc tacctaatgt acaagcaaaa ggcgcaacaa aagaccttat tatggcttgg

2880

gaataatacc ctagatcaga tgagagccac tacaaaaatg tgaacacaga tgaggaacga 294015

aggtttccct aatagtaatt tgtgtgaaag ttctggtagt ctgtcagttc ggagagttaa 3000

gaaaaaaaaa aaaccccccc cccccccccc ccccccccct gggtacgatc ctctagagtc

3060

gggagatggg ggaggctaac tgaaacacgg aaggagacaa taccggaagg aacccgcgct 312020

٤٢٤٣

-١١٢-

atgacggcaa taaaaagaca gaataaaacg cacgggtgtt gggtcgtttg ttcataaacg

3180

cggggttcgg tcccaggggct ggcactctgt cgatacccca ccgagacccc attgggacca

3240

atacgcccgc gtttcttcct tttccccacc ccaaccccca agttcgggtg aaggcccagg 5

3300

gctcgcagcc aacgtcgggg cggcaagccc tgccatagcc acgggccccg tgggttaggg

3360

acggggtccc ccatggggaa tggtttatgg ttcgtggggg ttattatttt gggcgttgcg 3420

tggggtcagg tccacgactg gactgagcag acagacccat ggtttttgga tggcctggggc 10

3480

atggaccgca tgtactggcg cgacacgaac accgggcgtc tgtggctgcc aaacaccccc

3540

gacccccaaa aaccaccgcg cggatttctg gcgccgccgg acgtcgactt aat 359315

16&gt;210&lt;

3569&gt;211&lt;

DNA &gt;212&lt;

Artificial Sequence &lt;213&lt;

&gt;220&lt;20

Expression cassette insert &lt;223&gt;

٤٢٤٣

-١١٣-

16 &gt;400&lt;

gtcgacggca gagtcgcaga cgcccctatt ggacgtcaaa attgtagagg tgaagttttc

60

aaacgatggc gaagtaacgg cgacttgcgt ttccaccgtc aaatctccct atagggtaga

120 5

aactaattgg aaagtagacc tcgtagatgt aatggatgaa atttctggga acagtcccgc

180

cggggttttt aacagtaatg agaaatggca gaaacagctg tactacagag taaccgatgg

240

aagaacatcg gtccagctaa tgtgcctgtc gtgcacgagc cattctccgg aaccttactg 1 0

300

tcttttcgac acgtctctta tagcgaggga aaaagatatc gcgccagagt tatactttac 360

ctctgatccg caaacggcat actgcacaat aactctgccg tccggcgttg ttccgagatt

420

cgaatggagc cttaataatg tttcactgcc ggaatatttg acggccacga ccgttgtttc 480 15

gcataccgct ggccaaagta cagtgtggaa gagcagcgcg agagcaggcg aggcgtggat

540

ttctggccgg ggaggcaata tatacgaatg caccgtcctc atctcagacg gcactcgcgt

600

tactacgcga aaggagaggt gcttaacaaa cacatggatt gcggtggaaa acggtgctgc 2 0

660

٤٢٤٣

-١١٤-

tcaggcgcag ctgtattcac tcttttctgg acttgtgtca ggattatgcg ggagcatatc 720

tgctttgtac gcaacgctat ggaccgccat ttatttttga ggaatgcttt ttggactatc 780

gtactgcttt cttccttcgc tagccagagc accgccgccg tcacgtacga ctacatttta 840

ggccgtcgcg cgctcgacgc gctaaccata ccggcggttg gcccgtataa cagatacctc 900 5

actagggtat caagaggctg cgacgttgtc gagctcaacc cgatttctaa cgtggacgac

960

atgatatcgg cggccaaaga aaaagagaag gggggccctt tcgaggcctc cgtcgtctgg

1020

ttctacgtga ttaagggcga cgacggcgag gacaagtact gtccaatcta tagaaaagag 10

1080

tacagggaat gtggcgacgt acaactgcta tctgaatgcg ccgttcaatc tgcacagatg

1140

tgggcagtgg actatgttcc tagcaccctt gtatcgcgaa atggcgcggg actgactata 1200 15

ttctccccca ctgctgcgct ctctggccaa tacttgctga ccctgaaaat cggggagattt 1260

gcgcaaacag ctctcgtaac tctagaagtt aacgatcgct gtttaaagat cgggtcgcag

1320

cttaactttt taccgtcgaa atgctggaca acagaacagt atcagactgg atttcaaggc

1380 20

٤٢٤٣

-١١٥-

gaacaccttt atccgatcgc agacaccaat acacgacacg cggacgacgt atatcgggga

1440

tacgaagata ttctgcagcg ctggaataat ttgctgagga aaaagaatcc tagcgcgcca

1500

gaccctcgtc cagatagcgt cccgcaagaa attcccgctg taaccaagaa agcggaaggg 5

1560

cgcaccccgg acgcagaaag cagcgaaaag aaggcccctc cagaagactc ggaggacgac

1620

atgcaggcag aggcttctgg agaaaatcct gccgccctcc ccgaagacga cgaagtcccc

1680 10

gaggacaccg agcacgatga tccaaactcg gatcctgact attacaatga catgcccgcc

1740

gtgatcccgg tggaggagac tactaaaagt tctaatgccg tctccatgcc catattcgcg

1800

gcgttcgtag cctgcgcggt cgcgctcgtg gggctactgg tttggagcat cgtaaaatgc 15

1860

gcgcgtagct aatcgagcct agaataggtg gtttcttcct acatgccacg cctcacgctc

1920

ataatataaa tcacatggaa tagcatacca atgcctattc attgggacgt tcgaaaagca

1980 20

tggcatcgct acttggaact ctggctctcc ttgccgcgac gctcgcaccc ttcggcgcga

2040

٤٢٤٣

-١١٦-

tgggaatcgt gatcactgga aatcacgtct ccgccaggat tgacgacgat cacatcgtga

2100

tcgtcgcgcc tcgccccgaa gctacaattc aactgcagct atttttcatg cctggccaga

2160

gaccccacaa accctactca ggaaccgtcc gcgtcgcgtt tcggtctgat ataacaaacc 5

2220

agtgctacca ggaacttagc gaggagcgct ttgaaaattg cactcatcga tcgtcttctg

2280

tttttgtcgg ctgtaaagtg accgagtaca cgttctccgc ctcgaacaga ctaaccggac

2340 10

ctccacaccc gtttaagctc actatacgaa atcctcgtcc gaacgacagc gggatgttct

2400

acgtaattgt tcggctagac gacaccaaag aacccattga cgtcttcgcg atccaactat

2460

cggtgtatca attcgcgaac accgccgcga ctcgcggact ctattccaag gcttcgtgtc 15

2520

gcaccttcgg attacctacc gtccaacttg aggcctatct caggaccgag gaaagttggc

2580

gcaactggca agcgtacgtt gccacggagg ccacgacgac cagcgccgag gcgacaaccc

2640 20

cgacgcccgt cactgcaacc agcgcctccg aacttgaagc ggaacacttt acctttccct

2700

٤٢٤٣

-١١٧-

ggctagaaaa tggcgtggat cattacgaac cgacacccgc aaacgaaaat tcaaacgtta

2760

ctgtccgtct cgggacaatg agccctacgc taattggggt aaccgtggct gccgtcgtga

2820

gcgcaacgat cggcctcgtc attgtaattt ccatcgtcac cagaaacatg tgcaccccgc 5

2880

accgaaaatt agacacggtc tcgcaagacg acgaagaacg ttcccaaact agaagggaat

2940

cgcgaaaatt tggacccatg gttgcgtgcg aaataaacaa gggggctgac caggatagtg

3000 10

aacttgtgga actggttgcg attgttaacc cgtctgcgct aagctcgccc gactcaataa

3060

aaatgtgatt aagtctgaat gtggctctcc aatcatttcg attctctaat ctcccaatcc 3120

tctcaaaagg ggcagtatcg gacacggact gggaggggcg tacacgatag ttatatggta

3180 15

cagcagaggc ctctgaacac ttaggaggag aattcagccg gggagagccc ctgttgagta

3240

ggcttgggag catattgcag gatgaacatg ttagtgatag ttctcgcctc ttgtcttgcg 3300

cgcctaactt ttgcgacgcg acacgtcctc tttttggaag gcactcaggc tgtcctcggg 3360

gaagatgatc ccagaaacgt tccggaaggg actgtaatca aatggacaaa agtcctgcgg 20

3420

٤٢٤٣

-١١٨-

aacgcgtgca agatgaaggc ggccgatgtc tgctcttcgc ctaactattg ctttcatgat 3480

ttaatttacg acggaggaaa gaaagactgc ccgcccgcgg gacccctgtc tgcaaacctg

3540

gtaattttac taaagcgcgg cgaaagctt3569

17 &gt;210&lt;5

5921&gt;211&lt;

DNA &gt;212&lt;

Artificial Sequence &lt;213&lt;

&gt;220&lt;

Expression cassette insert &gt;223&lt;10

17&gt;400&lt;

gtcgacggca gagtcgcaga cgcccctatt ggacgtcaaa attgtagagg tgaagttttc

60

aaacgatggc gaagtaacgg cgacttgcgt ttccaccgtc aaatctccct atagggtaga

12015

aactaattgg aaagtagacc tcgtagatgt aatggatgaa atttctggga acagtcccgc

180

cggggttttt aacagtaatg agaaatggca gaaacagctg tactacagag taaccgatgg

240

aagaacatcg gtccagctaa tgtgcctgtc gtgcacgagc cattctccgg aaccttactg 2 0

300

٤٢٤٣

-١١٩-

tcttttcgac acgtctctta tagcgaggga aaaagatatc gcgccagagt tatactttac 360

ctctgatccg caaacggcat actgcacaat aactctgccg tccggcgttg ttccgagatt

420

cgaatggagc cttaataatg tttcactgcc ggaatatttg acggccacga ccgttgtttc 480

gcataccgct ggccaaagta cagtgtggaa gagcagcgcg agagcaggcg aggcgtggat 5 540

ttctggccgg ggaggcaata tatacgaatg caccgtcctc atctcagacg gcactcgcgt

600

tactacgcga aaggagaggt gcttaacaaa cacatggatt gcggtggaaa acggtgctgc 660 10

tcaggcgcag ctgtattcac tcttttctgg acttgtgtca ggattatgcg ggagcatatc 720

tgctttgtac gcaacgctat ggaccgccat ttatttttga ggaatgcttt ttggactatc 780

gtactgcttt cttccttcgc tagccagagc accgccgccg tcacgtacga ctacatttta 840

ggccgtcgcg cgctcgacgc gctaaccata ccggcggttg gcccgtataa cagatacctc 900 15

actagggtat caagaggctg cgacgttgtc gagctcaacc cgatttctaa cgtggacgac

960

atgatatcgg cggccaaaga aaaagagaag gggggccctt tcgaggcctc cgtcgtctgg

1020

ttctacgtga ttaagggcga cgacggcgag gacaagtact gtccaatcta tagaaaagag 20

1080

٤٢٤٣

-١٢٠-

tacagggaat gtggcgacgt acaactgcta tctgaatgcg ccgttcaatc tgcacagatg

1140

tgggcagtgg actatgttcc tagcaccctt gtatcgcgaa atggcgcggg actgactata

1200

ttctccccca ctgctgcgct ctctggccaa tacttgctga ccctgaaaat cggggagattt 1260 5

gcgcaaacag ctctcgtaac tctagaagtt aacgatcgct gtttaaagat cgggtcgcag

1320

cttaactttt taccgtcgaa atgctggaca acagaacagt atcagactgg atttcaaggc

1380

gaacaccttt atccgatcgc agacaccaat acacgacacg cggacgacgt atatcgggga 10

1440

tacgaagata ttctgcagcg ctggaataat ttgctgagga aaaagaatcc tagcgcgcca

1500

gaccctcgtc cagatagcgt cccgcaagaa attcccgctg taaccaagaa agcggaaggg

1560 15

cgcaccccgg acgcagaaag cagcgaaaag aaggcccctc cagaagactc ggaggacgac

1620

atgcaggcag aggcttctgg agaaaatcct gccgccctcc ccgaagacga cgaagtcccc

1680

gaggacaccg agcacgatga tccaaactcg gatcctgact attacaatga catgcccgcc 20

1740

٤٢٤٣

-١٢١-

gtgatcccgg tggaggagac tactaaaagt tctaatgccg tctccatgcc catattcgcg

1800

gcgttcgtag cctgcgcggt cgcgctcgtg gggctactgg tttggagcat cgtaaaatgc

1860

gcgcgtagct aatcgagcct agaataggtg gtttcttcct acatgccacg cctcacgctc 5

1920

ataatataaa tcacatggaa tagcatacca atgcctattc attgggacgt tcgaaaagca

1980

tggcatcgct acttggaact ctggctctcc ttgccgcgac gctcgcaccc ttcggcgcga

2040 10

tgggaatcgt gatcactgga aatcacgtct ccgccaggat tgacgacgat cacatcgtga

2100

tcgtcgcgcc tcgccccgaa gctacaattc aactgcagct atttttcatg cctggccaga

2160

gaccccacaa accctactca ggaaccgtcc gcgtcgcgtt tcggtctgat ataacaaacc 15

2220

agtgctacca ggaacttagc gaggagcgct ttgaaaattg cactcatcga tcgtcttctg

2280

tttttgtcgg ctgtaaagtg accgagtaca cgttctccgc ctcgaacaga ctaaccggac

2340 20

ctccacaccc gtttaagctc actatacgaa atcctcgtcc gaacgacagc gggatgttct

2400

٤٢٤٣

-١٢٢-

acgtaattgt tcggctagac gacaccaaag aacccattga cgtcttcgcg atccaactat

2460

cggtgtatca attcgcgaac accgccgcga ctcgcggact ctattccaag gcttcgtgtc

2520

gcaccttcgg attacctacc gtccaacttg aggcctatct caggaccgag gaaagttggc 5

2580

gcaactggca agcgtacgtt gccacggagg ccacgacgac cagcgccgag gcgacaaccc

2640

cgacgcccgt cactgcaacc agcgcctccg aacttgaagc ggaacacttt acctttccct

2700 10

ggctagaaaa tggcgtggat cattacgaac cgacacccgc aaacgaaaat tcaaacgtta

2760

ctgtccgtct cgggacaatg agccctacgc taattggggt aaccgtggct gccgtcgtga

2820

gcgcaacgat cggcctcgtc attgtaattt ccatcgtcac cagaaacatg tgcaccccgc 15

2880

accgaaaatt agacacggtc tcgcaagacg acgaagaacg ttcccaaact agaagggaat

2940

cgcgaaaatt tggacccatg gttgcgtgcg aaataaacaa gggggctgac caggatagtg

3000 20

aacttgtgga actggttgcg attgttaacc cgtctgcgct aagctcgccc gactcaataa

3060

٤٢٤٣

-١٢٣-

aaatgtgatt aagtctgaat gtggctctcc aatcatttcg attctctaat ctcccaatcc 3120

tctcaaaagg ggcagtatcg gacacggact gggaggggcg tacacgatag ttatatggta

3180

cagcagaggc ctctgaacac ttaggaggag aattcagccg gggagagccc ctgttgagta 3240 5

ggcttgggag catattgcag gatgaacatg ttagtgatag ttctcgcctc ttgtcttgcg 3300

cgcctaactt ttgcgacgcg acacgtcctc tttttggaag gcactcaggc tgtcctcggg 3360

gaagatgatc ccagaaacgt tccggaaggg actgtaatca aatggacaaa agtcctgcgg

3420

aacgcgtgca agatgaaggc ggccgatgtc tgctcttcgc ctaactattg ctttcatgat 3480 10

ttaatttacg acggaggaaa gaaagactgc ccgcccgcgg gacccctgtc tgcaaacctg

3540

gtaattttac taaagcgcgg cgaaagcttc gcgccaggtc aattccctgg cattatgccc

3600

agtacatgac ctttatgggac tttcctactt ggcagtacat ctacgtatta gtcatcgcta 3660 15

ttaccatggt gatgcggttt tggcagtaca tcaatgggcg tggatagcgg tttgactcac 3720

ggggatttcc aagtctccac cccattgacg tcaatggggag tttgttttgg caccaaaatc 3780

aacgggactt tccaaaatgt cgtaacaact ccgccccatt gacgcaaatg ggcggtagcg

3840

tgtacggtgg gaggtctata taagcagagc tcgtttagtg aaccgtcaga tcgcctggag 20

3900

٤٢٤٣

-١٢٤-

acgccatcca cgctgttttg acctccatag aagacaccgg ttgcgccgcc accatggggcc

3960

ccagaccttc taccaagaac ccagtaccta tgatgctgac tgtccgagtc gcgctggtac

4020

tgagttgcat ctgtccggca aactccattg atggcaggcc tcttgcggct gcaggaattg 5

4080

tggttacagg agacaaagcc gtcaacatat acacctcatc ccagacagga tcaatcatag

4140

ttaagctcct cccgaatctg cccaaggata aggaggcatg tgcgaaagcc cccttggatg

4200 10

catacaacag gacattgacc actttgctca ccccccttgg tgactctatc cgtaggatac

4260

aagagtctgt gactacatct ggagggggga gacaggggcg ccttataggc gccattattg

4320

gcggtgtggc tcttggggtt gcaactgccg cacaaataac agcggccgca gctctgatac 15

4380

aagccaaaca aaatgctgcc aacatcctcc gacttaaaga gagcattgcc gcaaccaatg

4440

aggctgtgca tgaggtcact gacggattat cgcaactagc agtggcagtt gggaagatgc

4500 20

agcagtttgt taatgaccaa tttaataaaa cagctcagga attagactgc atcaaaattg

4560

٤٢٤٣

-١٢٥-

cacagcaagt tggtgtagag ctcaacctgt acctaaccga attgactaca gtattcggac

4620

cacaaatcac ttcacctgct ttaaacaagc tgactattca ggcactttac aatctagctg 4680

gtggaaatat ggattactta ttgactaagt taggtgtagg gaacaatcaa ctcagctcat 4740 5

taatcggtag cggcttaatc accggtaacc ctattctata cgactcacag actcaactct

4800

tgggtataca ggtaactcta ccttcagtcg ggaagctaaa taatatgcgt gccacctact

4860

tggaaacctt atccgtaagc acaaccaggg gatttgcctc ggcacttgtc ccaaaagtgg 10

4920

tgacacaggt cggttctgtg atagaagaac ttgacacctc atactgtata gaaactgact

4980

tacatttata ttgtacaaga atagtaacgt tccctatgtc ccctggtatt tattcctgct 5040

tgagcggcaa tacgtcggcc tgtatgtact caaagaccga aggcgcactt actacaccat 15

5100

acatgactat caaaggttca gtcatcgcca actgcaagat gacaacatgt agatgtgtaa

5160

accccccggg tatcatatcg caaaactatg gagaagccgt gtctctaata gataaacaat 5220 20

catgcaatgt tttatcctta ggcgggataa ctttaaggct cagtggggaa ttcgatgtaa 5280

٤٢٤٣

-١٢٦-

cttatcagaa gaatatctca atacaagatt ctcaagtaat aataacaggc aatcttgata

5340

tctcaactga gcttgggaat gtcaacaact cgatcagtaa tgctttgaat aagttagagg

5400

aaagcaacag aaaactagac aaagtcaatg tcaaactgac tagcacatct gctctcatta 5

5460

cctatatcgt gttgactatc atatctcttg tttttggtat acttagcctg attctagcat 5520

gctacctaat gtacaagcaa aaggcgcaac aaaagacctt attatggctt gggaataata

5580

ctctagatca gatgagagcc actacaaaaa tgtgaggatc tctcgaggaa ttctagatcc 10

5640

cacgtcacta ttgtatactc tatattatac tctatgttat actctgtaat cctactcaat5700

aaacgtgtca cgcctgtgaa accgtactaa gtctcccgtg tcttcttatc accatcaggt5760

gacatcctcg cccaggctgt caatcatgcc ggtatcgatt ccagtagcac cggccccacg

582015

ctgacaaccc actcttgcag cgttagcagc gcccctctta acaagccgac ccccaccagc

5880

gtcgcggtta ctaacactcc tctccccgac ctgcaactag t5921

20

٤٢٤٣

-١٢٧-