Untitled record
Abstract
The present invention is directed to cytotoxic pentapeptides, to antibody drug conjugates thereof, and to methods for using the same to treat cancer. The present invention further relates to compositions including the aforementioned payloads, payload-linkers and ADC’s, and methods for using these payloads, payload-linkers and ADC’s, to treat pathological conditions including cancer. Figure 1.

Term
No projected expiry on record.
- Priority
- Filed
- Published
- Today
26 claims: 26 independent, 0 dependent
- 1عناصر الحماية أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، حيث، كل عمى حدة في كل حالة، يكون:W هو O 10 R1 هو C1-C8 alkyl ،hydrogen، أو C1-C8 haloalkyl؛ R2 هو C1-C8 alkyl ،hydrogen أو C1-C8 haloalkyl؛ يتحدد R3A وR3B من أي مما يمي: )1( R3A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl، halogen ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و 15 20 R3B هو C1- ،C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl aralkyl ،heteroaralkyl ،aryl ،C10 heterocyclyl أو halogen؛ أو )2( R3A وR3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ يتحدد R4A وR4B من أي مما يمي: )1( R4A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen، heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و R4B هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو )2( R4A وR4B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ ٤٠٦٩ -٦٩٦- R 12 R R5 هو 5 carbocyclyl وC6-C14 aryl مستبدلين اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1- ،-C1-C8 alkyl-N(R’)2 ،-C1-C8 alkyl- ،C8 alkyl-C(O)R’ - ،-OC(O)R' ،-C(O)R' ،-C1-C8 alkyl-C(O)OR’-O-(C1-C8 alkyl) ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' 10 S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 ؛heterocyclyl ٤٠٦٩ -٦٩٧- R12 R 13 مستبدل اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1-C8 alkyl-C(O)R’ ،-C1-C8 alkyl-N(R’)2 ،C1-C8 alkyl-، - ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،-C1-C8 alkyl-C(O)OR’ ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' -SR' ،-S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3 و’arylene-R، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1- ،C1-C8 alkyl ،hydrogen 10 ،C8heterocyclyl C1-C10alkylene-C3-C8heterocyclyl وaryl، أو يمكن أن يشكل اثنين من ’R، معا 15 مع nitrogen المرتبط معهما، C1-C10 heterocyclyl؛ R6 هو C2-C8 alkynyl ،-C2-C8 alkenyl ،-C1-C8 alkyl ،hydrogen-أو C1-C8 haloalkyl-؛ R12 هو C1-C10 heterocyclyl ،C1-C4 alkyl ،hydrogen أو C6-C14 aryl؛ R13 هو C1-C10 heterocyclyl؛ و X هو O. 2- مركب الصيغة :IIa 20 ٤٠٦٩ -٦٩٨- IIa أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، حيث، كل عمى حدة في كل حالة، يكون: R 1 Y هو -C3-C8 ،-C2-C20 heteroalkylene- ،-C2-C20 alkylene arylene- ،carbocyclo--، -arylene-Cl- ،-Cl-C10alkylene-arylene- ،-C3-C8heterocyclo-،Cl0alkylene- 10 -(-(C3-C8carbocyclo)-Cl- ،-Cl-Cl0alkylene-(C3-C8carbocyclo C10alkylene-، -(Cl-Cl0alkylene-(C3-C8heterocyclo- أو --(C3-C8 heterocyclo)-Cl -Cl0alkylene؛ ٤٠٦٩ -٦٩٩- G هو SH ،-OH ،halogen- أو S-C1-C6 alkyl-؛ R2 هو 01-08 alkyl ،hydrogenأو 01-08 haloalkyl؛ • يتحدد R3A وR3B من أي مما يلي: (١) R3A هو 03-08 carbocyclyl ،01-08 haloalkyl ،01-08 alkyl، aralkyl ،heteroaralkyl ،aryl ،01-010 heterocyclyl أو halogen؛ و R3B هو Cl- ،03-08 carbocyclyl ،01-08 haloalkyl ،01-08 alkyl heteroaralkyl ،aryl ،CIO heterocyclyl أو aralkyl أو halogen؛ أو ٠ ١ (٢) R3A وR3B معا هما C2-C8 alkylene أو CJ-C8 heteroalkylene؛ يتحدد R4Bj R4A من أي مما يلي: (١) R4A هو 03-08 carbocyclyl ،01-08 haloalkyl ،01-08 alkyl ،hydrogen، heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و R4B هو C3-C8 ،01-08 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl ١٥ heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو (٢) R4A وR4B معا هما 02-08 alkyleneأو CJ-C8 heteroalkylene؛ ٤٠٦٩ -٧٠٠- R 12 R R5 هو 5 carbocyclyl وC6-C14 aryl مستبدلين اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1- ،-C1-C8 alkyl-N(R’)2 ،-C1-C8 alkyl- ،C8 alkyl-C(O)R’ - ،-OC(O)R' ،-C(O)R' ،-C1-C8 alkyl-C(O)OR’-O-(C1-C8 alkyl) ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' 10 S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 ؛heterocyclyl ٤٠٦٩ -٧٠١- R12 R 13 مستبدل اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1-C8 alkyl-C(O)R’ ،-C1-C8 alkyl-N(R’)2 ،C1-C8 alkyl-، - ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،-C1-C8 alkyl-C(O)OR’ 5 ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' -SR' ،-S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3 و’arylene-R، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1- ،C1-C8 alkyl ،hydrogen ،C8heterocyclyl 10 C1-C10alkylene-C3-C8heterocyclyl وaryl، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 heterocyclyl؛ R6 هو C2-C8 alkynyl ،-C2-C8 alkenyl ،-C1-C8 alkyl ،hydrogen-أو C1-C8 haloalkyl-؛ 15 R12 هو C1-C10 heterocyclyl ،C1-C4 alkyl ،hydrogen أو C6-C14 aryl؛ R13 هو C1-C10 heterocyclyl؛ و ينتقى R7 عمى حدة في كل حالة من المجموعة المتكونة من NO2 ،Br ،I ،Cl ،F، CN وCF3؛ 20 R10 هو -Cl- ،-aryl ،-C3-C8carbocyclyl ،-Cl-Cl0alkyl ،hydrogen ،C10heteroalkyl ٤٠٦٩ -٧٠٢- Cl- ،-arylene-Cl-Cl0alkyl ،-Cl-Cl0alkylene-aryl ،-C3- C8heterocyclo- -Cl- ،-(C3-C8 carbocyclo)-Cl-Cl0alkyl ،Cl0alkylene-(C3-C8carbocyclo) (Cl0alkylene-(C3-C8heterocyclo، و،-(C3-C8 heterocyclo)-Cl-Cl0alkyl حيث يستبدل اختياريا aryl عمى R10 المشتمل عمى aryl مع R7]h]؛ 5 h هو 1، 2، 3، 4 أو 5؛ و X هو O. IIIa 10 أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، حيث، كل عمى حدة في كل حالة، يكون: R1 هو C1-C8 alkyl ،hydrogen، أو C1-C8 haloalkyl؛ R2 هو C1-C8 alkyl ،hydrogen أو C1-C8 haloalkyl؛ 15 يتحدد R3A وR3B من أي مما يمي: )1( R3A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl، aralkyl ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو halogen؛ و R3B هو C1- ،C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl halogen ،heteroaralkyl ،aryl ،C10 heterocyclyl أو aralkyl؛ أو 20 )2( R3A وR3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ يتحدد R4A وR4B من أي مما يمي: ٤٠٦٩ -٧٠٣- )1( R4A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen، heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و R4B هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl 5 heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو )2( R4A وR4B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ R5 هو ، مستبدل 10 اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من ،-C(O)OR' ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،C1-C8 alkyl ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،-C(O)NHR' ،-C(O)NH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-NH(R') ،-NH2 ،-N3 ،halogen ،-OH S(=O)2R' ،-NHCONH2- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة 15 من C1-C8 alkyl ،hydrogen وaryl غير مستبدل؛ ٤٠٦٩ -٧٠٤- Y هو -C3-C8 ،-C2-C20 heteroalkylene- ،-C2-C20 alkylene ،-arylene- ،carbocyclo- -arylene-Cl- ،-Cl-C10alkylene-arylene- ،-C3-C8heterocyclo- ،Cl0alkylene- -(C3-C8carbocyclo)-Cl- ،-Cl-Cl0alkylene-(C3-C8carbocyclo)-،C10alkylene- 10 -(C3-C8 heterocyclo)-Cl- أو -Cl-Cl0alkylene-(C3-C8heterocyclo)- -Cl0alkylene؛ ، Z هو أو NH2-؛ G هو SH ،-OH ،halogen- أو S-C1-C6 alkyl–؛ 15 ينتقى R7 عمى حدة في كل حالة من المجموعة المتكونة من NO2 ،Br ،I ،Cl ،F، CN وCF3؛ h هو 1، 2، 3، 4 أو 5؛ و ٤٠٦٩ -٧٠٥- X هو 0. ٤-مركب الصيغة :lib أو ملح أو مادة منحلة مقبولة دوائيا من ذلك، حيث، كل على حدة في كل حالة، يكون: οΛνη 2 ٧ هو -C3-C8 ،-02-020 heteroalkylene- ،-02-020 alkylene ،-arylene- ،carbocyclo- ١ , -arylene-CI- ،-Cl-ClOalkylene-arylene- ،-C3-C8heterocyclo- ClOalkylene-، -(C3-C8carbocyclo)-CI-،-CI-CIOalkylene-(C3-C8carbocyclo)-،ClOalkylene- ٥ ١ -(CI-CIOalkylene-(C3-C8heterocyclo- أو -01-(0 11000000 -(C3-C8 -ClOalkylene؛ ٤٠٦٩ -٧٠٦- Z هو ، أو NHL-؛ L هو جسم مضاد؛ R2 هو C1-C8 alkyl ،hydrogen أو C1-C8 haloalkyl؛ 5 يتحدد R3A وR3B من أي مما يمي: )1( R3A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl، aralkyl ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو halogen؛ و R3B هو C1- ،C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl halogen ،heteroaralkyl ،aryl ،C10 heterocyclyl أو aralkyl؛ أو 10 )2( R3A وR3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ يتحدد R4A وR4B من أي مما يمي: )1( R4A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen، heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و R4B هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl 15 heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو )2( R4A وR4B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ ٤٠٦٩ -٧٠٧- R 12 R R5 هو 5 carbocyclyl وC6-C14 aryl مستبدلين اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1- ،-C1-C8 alkyl-N(R’)2 ،-C1-C8 alkyl- ،C8 alkyl-C(O)R’ - ،-OC(O)R' ،-C(O)R' ،-C1-C8 alkyl-C(O)OR’-O-(C1-C8 alkyl) ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' 10 S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 ؛heterocyclyl ٤٠٦٩ -٧٠٨- R12 R 13 مستبدل اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1-C8 alkyl-C(O)R’ ،-C1-C8 alkyl-N(R’)2 ،C1-C8 alkyl-، - ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،-C1-C8 alkyl-C(O)OR’ ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' -SR' ،-S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3 و’arylene-R، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1- ،C1-C8 alkyl ،hydrogen 10 ،C8heterocyclyl C1-C10alkylene-C3-C8heterocyclyl وaryl، أو يمكن أن يشكل اثنين من ’R، معا 15 مع nitrogen المرتبط معهما، C1-C10 heterocyclyl؛ R6 هو C2-C8 alkynyl ،-C2-C8 alkenyl ،-C1-C8 alkyl ،hydrogen-أو C1-C8 haloalkyl-؛ R12 هو C1-C10 heterocyclyl ،C1-C4 alkyl ،hydrogen أو C6-C14 aryl؛ R13 هو C1-C10 heterocyclyl؛ و X هو O.
- 25- مركب الصيغة :IIIb 20 ٤٠٦٩ -٧٠٩- IIIb أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، حيث، كل عمى حدة في كل حالة، يكون: 5 R1 هو C1-C8 alkyl ،hydrogen، أو C1-C8 haloalkyl؛ R2 هو C1-C8 alkyl ،hydrogen أو C1-C8 haloalkyl؛ يتحدد R3A وR3B من أي مما يمي: )1( R3A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl، aralkyl ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو halogen؛ و 10 R3B هو C1- ،C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl halogen ،heteroaralkyl ،aryl ،C10 heterocyclyl أو aralkyl؛ أو )2( R3A وR3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ يتحدد R4A وR4B من أي مما يمي: )1( R4A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen، 15 heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و R4B هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو )2( R4A وR4B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ ٤٠٦٩ -٧١٠- اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من ،-C(O)OR' ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،C1-C8 alkyl 5 ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،-C(O)NHR' ،-C(O)NH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-NH(R') ،-NH2 ،-N3 ،halogen ،-OH S(=O)2R' ،-NHCONH2- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل؛ 10 R11 هو ٤٠٦٩ -٧١١- Y هو -C3-C8 ،-C2-C20 heteroalkylene- ،-C2-C20 alkylene ،-arylene- ،carbocyclo- -arylene-Cl- ،-Cl-C10alkylene-arylene- ،-C3-C8heterocyclo- ،Cl0alkylene- -(C3-C8carbocyclo)-Cl- ،-Cl-Cl0alkylene-(C3-C8carbocyclo)- 5 ،C10alkylene- -(C3-C8 heterocyclo)-Cl- أو -Cl-Cl0alkylene-(C3-C8heterocyclo)- -Cl0alkylene؛ Z هو 10 L هو جسم مضاد؛ أو NHL-؛ X هو O. IIc 15 أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، حيث، كل عمى حدة في كل حالة، يكون: ٤٠٦٩ -٧١٢- Y O N H O Y هو -C3-C8 ،-C2-C20 heteroalkylene- ،-C2-C20 alkylene ،-arylene- ،carbocyclo- -arylene-Cl- ،-Cl-C10alkylene-arylene- ،-C3-C8heterocyclo- ،Cl0alkylene- 5 -(C3-C8carbocyclo)-Cl- ،-Cl-Cl0alkylene-(C3-C8carbocyclo)-،C10alkylene- -(C3-C8 heterocyclo)-Cl- أو -Cl-Cl0alkylene-(C3-C8heterocyclo)- -Cl0alkylene؛ 10 Z هو O ، ،O H N أو -NH-؛ 15 L هو جسم مضاد؛ D هو -(’C(R4A’)(R4B– أو غائب؛ ’R2 هو C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen، أو غائب إذا كان موجودا؛ يتحدد ’R3A و’R3B من أي مما يمي: ٤٠٦٩ -٧١٣- )1( ’R3A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl، aralkyl ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو halogen؛ و R3B’ هو C1- ،C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl halogen ،heteroaralkyl ،aryl ،C10 heterocyclyl أو aralkyl، أو ’R3B هو -C2 5 C4 alkylene ويشكل حمقة ذات 5-7 أعضاء كما هو مشار في ؛ أو )2( ’R3A و’R3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ يتحدد ’R4A و’R4B من أي مما يمي: )1( ’R4A هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl 10 heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و ’R4B هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو )2( ’R4A و’R4B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ ٤٠٦٩ -٧١٤- C3-C8 ،C1-C10 heterocyclyl ، carbocyclyl وC6-C14 aryl مستبدلين اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من -C1- ،-C1-C8 alkyl-N(R’)2 ،-C1-C8 alkyl ،C8 alkyl-C(O)R’ - ،-OC(O)R' ،-C(O)R' ،-C1-C8 alkyl-C(O)OR’-O-(C1-C8 alkyl) 5 ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 ؛heterocyclyl 10 R 13 مستبدل اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1-C8 alkyl-C(O)R’ ،-C1-C8 alkyl-N(R’)2 ،C1-C8 alkyl-، - ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،-C1-C8 alkyl-C(O)OR’ 15 ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' -SR' ،-S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3 و’arylene-R، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1- ،C1-C8 alkyl ،hydrogen ٤٠٦٩ -٧١٥- ،C8heterocyclyl C1-C10alkylene-C3-C8heterocyclyl وaryl، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 heterocyclyl؛ R6 هو C2-C8 alkynyl ،-C2-C8 alkenyl ،-C1-C8 alkyl ،hydrogen- أو C1-C8 haloalkyl-؛ R12 هو C1-C10 heterocyclyl ،C1-C4 alkyl ،hydrogen أو C6-C14 aryl؛ R13 هو C1-C10 heterocyclyl؛ و X هو O. 10
- 37- مركب الصيغة IIIc:أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، حيث، كل عمى حدة في كل حالة، يكون: 15 R1 هو C1-C8 alkyl ،hydrogen، أو C1-C8 haloalkyl؛ R2 هو C1-C8 alkyl ،hydrogen أو C1-C8 haloalkyl؛ يتحدد R3A وR3B من أي مما يمي: ٤٠٦٩ -٧١٦- )1( R3A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl، aralkyl ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو halogen؛ و R3B هو C1- ،C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl halogen ،heteroaralkyl ،aryl ،C10 heterocyclyl أو aralkyl؛ أو 5 )2( R3A وR3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ يتحدد R4A وR4B من أي مما يمي: )1( R4A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen، heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و R4B هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl 10 heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو )2( R4A وR4B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ ٤٠٦٩ -٧١٧- مستبدل اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C(O)OR' ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،C1-C8 alkyl-، ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،-C(O)NHR' ،-C(O)NH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-NH(R') ،-NH2 ،-N3 ،halogen ،-OH S(=O)2R' ،-NHCONH2- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل؛ 'R11 هو O Y أو O NH2 Y هو -C3-C8 ،-C2-C20 heteroalkylene- ،-C2-C20 alkylene ،-arylene- ،carbocyclo- 10 -arylene-Cl- ،-Cl-C10alkylene-arylene- ،-C3-C8heterocyclo- ،Cl0alkylene- -(C3-C8carbocyclo)-Cl- ،-Cl-Cl0alkylene-(C3-C8carbocyclo)-،C10alkylene- -(C3-C8 heterocyclo)-Cl- أو -Cl-Cl0alkylene-(C3-C8heterocyclo)- 15 -Cl0alkylene؛ Z هو ،O أو -NH-؛ ٤٠٦٩ -٧١٨- L هو جسم مضاد؛ X هو .O IId أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، حيث، كل عمى حدة في كل حالة، يكون: L هو جسم مضاد؛ [linker] هو وصمة ثنائية التكافؤ؛ D هو -(’C(R4A’)(R4B– أو غائب؛ 10 ’R2 هو C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen، أو غائب إذا كان موجودا؛ يتحدد ’R3A و’R3B من أي مما يمي: )1( ’R3A هو C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl، aralkyl ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو halogen؛ و 15 ’R3B هو C1- ،C3-C8 carbocyclyl ،C1-C8 haloalkyl ،C1-C8 alkyl halogen ،heteroaralkyl ،aryl ،C10 heterocyclyl أو aralkyl، أو ’R3B هو -C2 C4 alkylene ويشكل حمقة ذات 5-7 أعضاء كما هو مشار في ؛ أو )2( ’R3A و’R3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ يتحدد ’R4A و’R4B من أي مما يمي: 20 )1( ’R4A هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و ٤٠٦٩ -٧١٩- ’R4B هو C3-C8 ،C1-C8 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو )2( ’R4A و’R4B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene؛ R5 هو R 12 R 5 ، 10 عمى حدة من المجموعة المتكونة من C1- ،-C1-C8 alkyl-N(R’)2 ،-C1-C8 alkyl- ،C8 alkyl-C(O)R’ - ،-OC(O)R' ،-C(O)R' ،-C1-C8 alkyl-C(O)OR’-O-(C1-C8 alkyl) ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3- و'SR-، 15 حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 ؛heterocyclyl ٤٠٦٩ -٧٢٠- R12 R 13 مستبدل اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة من C1-C8 alkyl-C(O)R’ ،-C1-C8 alkyl-N(R’)2 ،C1-C8 alkyl-، - ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،-C1-C8 alkyl-C(O)OR’ 5 ،halogen ،-OH ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،C(O)OR' -SR' ،-S(=O)2R' ،-NHCONH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-N3 و’arylene-R، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1- ،C1-C8 alkyl ،hydrogen ،C8heterocyclyl 10 C1-C10alkylene-C3-C8heterocyclyl وaryl، أو يمكن أن يشكل اثنين من ’R، معا مع nitrogen المرتبط معهما، C1-C10 heterocyclyl؛ R6 هو C2-C8 alkynyl ،-C2-C8 alkenyl ،-C1-C8 alkyl ،hydrogen-أو C1-C8 haloalkyl-؛ 15 R12 هو C1-C10 heterocyclyl ،C1-C4 alkyl ،hydrogen أو C6-C14 aryl؛ R13 هو C1-C10 heterocyclyl؛ و X هو O.
- 49- مركب الصيغة :IIId ٤٠٦٩ -٧٢١- 11 او ملح أو مادة منحلة مقبولة دوائيا من ذلك، حيث، كل على حدة في كل حالة، يكون: ٥ RI هو C1-C8 alkyl ،hydrogen، أو C1-C8 haloalkyl؛ 52 هو 01-08 alkyl ،hydrogenأو 01-08 haloalkyl؛ يتحدد R3Bj R3A من أي مما يلي: (١ ) R3A هو 03-08 carbocyclyl ،01-08 haloalkyl ،01-08 alkyl، aralkyl ،heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو halogen؛ و ٠ ١ R3B هو Cl- ،03-08 carbocyclyl ،01-08 haloalkyl ،01-08 alkyl halogen ،heteroaralkyl ،aryl ،CIO heterocyclyl أو aralkyl؛ أو (٢ ) R3A وR3B معا هما 02-08 alkyleneأو 01-08 heteroalkylene؛ يتحدد R4A وR4B من أي مما يلي: (١ ) R4A هو 03-08 carbocyclyl ،01-08 haloalkyl ،01-08 alkyl ،hydrogen، ه ١ heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ و R4B هو C3-C8 ،01-08 haloalkyl ،C1-C8 alkyl ،hydrogen ،carbocyclyl heteroaralkyl ،aryl ،C1-C10 heterocyclyl أو aralkyl؛ أو (٢ ) R4A وR4B معا هما 02-08 alkyleneأو 01-08 heteroalkylene؛ ٢٠ R5 هو: ٤٠٦٩ -٧٢٢- مستبدل اختياريا مع 1، 2، 3، 4 أو 5 مجموعات مختارة كل عمى حدة من المجموعة المتكونة 5 من C(O)OR' ،-OC(O)R' ،-C(O)R' ،-O-(C1-C8 alkyl) ،C1-C8 alkyl-، ،-S(O)R' ،-S(O)2R' ،-NHC(O)R' ،-C(O)N(R')2 ،-C(O)NHR' ،-C(O)NH2 ،-NHC(=NH)NH2 ،-CN ،-N(R')2 ،-NH(R') ،-NH2 ،-N3 ،halogen ،-OH S(=O)2R' ،-NHCONH2- و'SR-، حيث ينتقى كل 'R عمى حدة من المجموعة المتكونة من C1-C8 alkyl ،hydrogen وaryl غير مستبدل؛ 10 [linker] هو وصمة ثنائية التكافؤ؛ L هو جسم مضاد؛ X هو O.
- 510- المركب، الممح أو المادة المنحمة من أي من عناصر الحماية 1-9، حيث:W هو ٤٠٦٩ -٧٢٣-
- 611- المركب، الممح أو المادة المنحمة من أي من عناصر الحماية 9-1، حيث W هو
- 712- المركب، الممح أو المادة المنحمة من أي من عناصر الحماية 1-9، حيث يكون R2 هو hydrogen، أو C1-C8 alkyl.
- 85 13- المركب، الممح أو المادة المنحمة من أي من عناصر الحماية 1-9، حيث يكون R3A هو C1-C8 alkyl، يفضل methyl.
- 914- المركب، الممح أو المادة المنحمة من أي من عناصر الحماية 1-5، 7 و9، حيث يكون R3A وR3B معا هما C2-C8 alkylene أو C1-C8 heteroalkylene.
- 1015- المركب، الممح أو المادة المنحمة من أي من عناصر الحماية 1-2، 4، 6 و8، حيث يكون . R5 هو
- 1116- المركب، الممح أو المادة المنحمة من أي من عناصر الحماية 5-9 حيث ينتقى الجسم 10 المضاد من cetuximab ،edrecolomab ،oregovomab ،trastuzumab، جسم مضاد أحادي النسخ مكتسب لمسمة الآدمية إلى المستقبل αvβ3) vitronectin)؛ alemtuzumab؛ جسم مضاد ضد HLA-DR مكتسب لمسمة الآدمية من أجل معالجة ورم ليمفاوي غير 15 Hodgkin؛ 1-131I Lym؛ جسم مضاد ضد HLA-Dr10 فأري من أجل معالجة ورم ليمفاوي غير Hodgkin؛ mAb ضد CD2 مكتسب لمسمة الآدمية من أجل معالجة مرض Hodgkin أو ورم ليمفاوي غير Hodgkin؛ labetuzumab؛ bevacizumab؛ ibritumomab tiuxetan؛ ofatumumab؛ panitumumab؛ rituximab؛ tositumomab؛ ipilimumab؛ gemtuzumab؛ جسم مضاد ضد IL13؛ وجسم مضاد ضد Notch.
- 1220 17- مركب، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، مختار من:٤٠٦٩ -٧٢٤- H 2 N NH S H2NO H N O N O O N O O NH S ,, H2N HN O O , HN O N O O N O O H2N , , H 2 N O HNON OO N OOO HN OH H2NOHNON N N O O O N O O O O , HN O N N HN O OO O O , O HN O N O O N O O HN SN ,5 H2N O HN O N O O N O OO HN O ,, NH HNO H N O N N OO O O HN O N N OO O O HN HN O N N O OO O O , , N O O N O NHO H2N O HN O N O O N O O H N OO NH O HN O , HN HN O N N O O O O O , NH O HN , 10 ٤٠٦٩ -٧٢٥- HN HN O N N O O O O NH OH HN H N O N NH H N O N OO N OO N O O O N O O H N OO OO H N O O O O H S N N OO , H2N O HN O N O O N O O HN O O , HN , O O H N OH , O N O H N O N OO O N O O O N H , HN F H N O O , NH HN O N OH O O N OH O , N O O O N O O , H N O OO , O H N OH , O N HO , N OH OH O , N H O H N O N O O N O O H N N H O H N O N O O N O O H N HN FHN O N N HN , , HN N HO HNON OO N OO HNNS , OH N H N N N N H O OOO H O N O O N HN N O HN F H N O N OO HN HN O N OO N O O O N OO N O O O NH 2 O N H O , H N O O OH N O N O N O O H N O O N H O , NH 2 O N H NHOOH H2N O HNO , N O O N O H2N O H N O O , O N H O O, O O, 10 H N O N O O N O O HN O O, H2N O H N O N , H O O O O O O , ٤٠٦٩ -٧٢٦- O HN O , N O O N O HN SN , , N O O N O HN NN O N O O H N HN O O N S HN O HN O N O O N O HN F , O O HN O , HN O N H O HN HN O , N OO O O O N H O N O O O H N O O HN , HN HN O , , 5 N N NH , OH , N OO O O O H N O NH . 10
- 1318- مركب، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، مختار من:٤٠٦٩ -٧٢٧- ٤٠٦٩ -٧٢٨- 10 ٤٠٦٩ -٧٢٩-
- 1410 19- وصمة- حمل نافع (payload-linker) أو مادة اقت ارن عقار- جسم مضاد -antibody) (drug-conjugate تشتمل عمى شق من المركب من عنصر الحماية 17 أو 18.
- 1520- مادة اقت ارن عقار وجسم مضاد (antibody drug conjugate) تشتمل عمى شق من المركب من عناصر الحماية 1-3.
- 1621- مركب، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، مختار من:٤٠٦٩ -٧٣٠- N O O N H N O N OON H O HN ON O O N O O HN O H O H SN NH , O NH2 NO ON H O HN ON O O N O H O O N O O O O O O O N H O H N O N O O N O H O N OH , N O O NH O HN O O N O NH H NH O NH 2 N O O N H O HN O N H NH O NH2 O N H N O N O H O H NH O NH 2 O HNON OON O NHO OH OON HO HNONOON OONHO 5 O NH H N O N N H N N O O NH H N O NH OONHOHNONOONO ONHOH , O NH2 OH ٤٠٦٩ -٧٣١- NN O N O O N O HN O N O O N O OH , O HN O NN OOO O NH O N O O N H N O N O N O O NH S N O O NHO H N O N O O N O O NH NS N H O HN ON O O N O O HN N N O O N H N O N O O N H O H N O N O O N O O NH S NH O NH2 NO O , N O O N H N O N O O NH O O O O O O O HN O HN O N O O N O N O H O H O N H S NH H 2 N O ٤٠٦٩ -٧٣٢- O , , NH H2N O O O N HN O , O H N O O HN ON OO N OO HN SN O N O O O O N HN N HH HN O O OOOO OO , O ٤٠٦٩ -٧٣٣- O N O , 10 ٤٠٦٩ -٧٣٤- ٤٠٦٩ -٧٣٥- ٤٠٦٩ -٧٣٦- 10 ٤٠٦٩ -٧٣٧- ٤٠٦٩ -٧٣٨- 10 ٤٠٦٩ -٧٣٩- HN O O O O NH O HN O N O O N O O HN N S HN O N H O OO N N H N N S OO OO H2N O 10 ٤٠٦٩ -٧٤٠- H N O O N H N O N O H O H NH H2N O N ,O O N ,O O H N O O O N H N O N N HN OH O H O OO H N O N N HN OH O OO H N O O N
- 175 22- مادة اقت ارن عقار- جسم مضاد (antibody-drug-conjugate) تشتمل عمى شق من المركب من عنصر الحماية 21.
- 1823- مركب من عنصر الحماية 1، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، وهو
- 1924- مركب من عنصر الحماية 1، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، وهو ٤٠٦٩ -٧٤١-
- 2025- مركب من عنصر الحماية 1، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، وهو
- 2126- مركب من عنصر الحماية 1، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، وهو
- 2227- مركب من عنصر الحماية 1، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، وهو
- 2328- مركب من عنصر الحماية 1، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، وهو ٤٠٦٩ -٧٤٢-
- 2429- مركب من عنصر الحماية 1، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، وهو
- 2530- تركيبة دوائية (pharmaceutical composition) تشتمل عمى المركب من أي من عناصر الحماية 1-29، أو ممح أو مادة منحمة مقبولة دوائيا من ذلك، ومادة مسوغة 5 (excipient) مقبولة دوائيا.
- 2631- تركيبة دوائية (pharmaceutical composition) تشتمل عمى المركب من أي من عناصر الحماية 1-30، لعلاج سرطان. ٤٠٦٩ شكل١
Independent claims26
6,722 paragraphs in 203 sections, as filed
Full description
The hidden invention
The most important factor relates to new peptide-based compounds (peptide-based compounds) that are used to trace the body Additives and drugs (ADC's) drug-conjugates, and salaries for our money - link to our payload- linker)
<p dir="rtl">5 (compounds) with respect to an ADC. The invention also relates to arrangements comprising liquid liquids, nano-connections and ADCs, and to methods of using such compounds Treatment, treatment of diseases including cancer.</p>
If drugs are conjugated with antibodies, whether directly or via cross-links, it is necessary to consider, by considering various factors, including the structure and location of the chemical group for conjugation of the drug, the mechanism
<p dir="rtl">10 Property launch, planned structural elements, property launch, and constructive changes to the launch property. In addition, if the drug is released after the antibody has been neutralized, the mechanism of drug release must be consistent with the transfer of a substance into the cell.</p>
While a number of different drug classes have been experimented with for delivery via antibodies, only a few drug classes have proven to be highly effective. Substances that create the name antibody drug have a toxic form.
<p dir="rtl">15 suitable. The oldest class is auristatins, which are derivatives of the natural product dolastatin. The analogue auristatins include -N-methylvaline-valine-dolaisoleuine)</p>
dolaproine-norephedrine)
And (N-methylvaline-valine-dolaisoleuine-dolaproine-phenylalanine). However, there is still a need for additional auristatins with soothing properties.
20 General description of the invention
٤٠٦٩
-٣-
You may need to know the ingredients for cell-toxic pentapeptides, antibody-tracing substances, and an immunoprecipitating drug.
L represented by the formula:
<img file="SA4069B1_D0001.tif" />
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
R<sup>1</sup>
؛
<img file="SA4069B1_D0002.tif" />
O
<img file="SA4069B1_D0003.tif" />
W is
R1 is a C1-C8 alkyl hydrogen, or C1-C8 haloalkyl, or R1 is a link or
It is added to the yearly- ػ
<img file="SA4069B1_D0004.tif" />
GSCGCGCGCGCGCGCGCGCGCGCGCG
<img file="SA4069B1_D0005.tif" />
Y is -C3-C8,-C2-C20 heteroalkylene-,-C2-C20 alkylene
-arylene-,carbocyclo-
-arylene-Cl-,-Cl-C10alkylene-arylene-,-C3-C8heterocyclo-
,Cl0alkylene-
-(C3-C8carbocyclo)-Cl-, -Cl-Cl0alkylene-(C3-C8carbocyclo)-
,C10alkylene-
10
٤٠٦٩
-٤-
-(C3-C8 heterocyclo)-Cl- or -Cl-Cl0alkylene-(C3-C8 heterocyclo)-
-Cl0alkylene;
<img file="SA4069B1_D0006.tif" />
،
<img file="SA4069B1_D0007.tif" />
،
<img file="SA4069B1_D0008.tif" />
<img file="SA4069B1_D0009.tif" />
5
or NHL-;
G is SH,-OH,halogen- or S-C1-C6 alkyl–;
L is antibody;
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
10 R3A and R3B resonate with which of the following:
(1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,
aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; And
٤٠٦٩
-٥-
O
<sup>R</sup>12
R5 hglo
,C1-C10 heterocyclyl,
C3-C8
15 Carbocyclyl and C6-C14 aryl are optionally substituted with 1, 2, 3, 4 or 5 selected groups.
R3B is C1-, C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl halogen, aralkyl, heteroaralkyl, aryl, C10 heterocyclyl or hydrogen; or
<p dir="rtl">(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
R4A and R4B resonate from which of the following:
<p dir="rtl">5 (1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,</p>
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; And
R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
<p dir="rtl">1 0 (2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
٤٠٦٩
-٦-
On the side of the group formed from C1-,-C1-C8 alkyl-N(R')2,-C1-C8 alkyl-
,C8 alkyl-C(O)R'
<p>-,-OC(O)R',-C(O)R',-C1-C8 alkyl-C(O)OR'-O-(C1-C8 alkyl)</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR'
S(=O)2R', -NHCONH2, -NHC(=NH)NH2, -CN, -N(R')2, -N3- and 'SR-', so that the tail of 'R' is selected one by one from the group consisting of C1 -C8 alkyl, hydrogen and aryl are not substituted, or two R's can be formed, together with the nitrogen bonded to them, C1-C10
;heterocyclyl
<img file="SA4069B1_D0010.tif" />
10
15
20
Total GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK C1-C8 alkyl-C1-C8 alkyl-C1-C8 alkyl-C(O)R',-C1-C8 alkyl-N(R')2,
<p>-,-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),-C1-C8 alkyl-C(O)OR'</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR' -SR ',-S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3
And 'ARYLENE-R, for the year, for A. ػ ػ ,hydrogen
,C8heterocyclyl
C1-C10alkylene-C3-C8heterocyclyl and aryl, or two M'R, with the associated nitrogen, C1-C10 heterocyclyl;
٤٠٦٩
-٧-
R6 is C2-C8 alkynyl, -C2-C8 alkenyl, -C1-C8 alkyl, hydrogen- or C1-C8 haloalkyl-;
R12 is C1-C10 heterocyclyl, C1-C4 alkyl hydrogen or C6-C14
aryl;
R13 is C1-C10 heterocyclyl; And
R7 is CN,NO2,Br,I,Cl,F and CF3;
h is 1, 2, 3, 4 or 5; And
X is O or S;
Provided that when R3A is hydrogen, X is S.
10
These are the inventions of the words: pentapeptides, a compound for cells, tracers, an antigen, and a drug, represented by the formula:
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
3A
R<sup>1</sup>
W Shatt, O, or
R3A
R1N
1-2
15
R1 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
٤٠٦٩
-٨-
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
R3A and R3B resonate with which of the following:
(1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; and
<p dir="rtl">5 R3B is C1-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl.</p>
aralkyl, heteroaralkyl, aryl, C10 heterocyclyl or halogen; or
<p dir="rtl">(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
R4A and R4B resonate from which of the following:
<p dir="rtl">(1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,</p>
<p dir="rtl">10 heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; And</p>
R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
<p dir="rtl">(2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p><img file="SA4069B1_D0011.tif" />
٤٠٦٩
-٩-
<img file="SA4069B1_D0012.tif" />
<img file="SA4069B1_D0013.tif" />
Replacing
Optionally 1, 2, 3, 4 or 5 different feed sets for each feeding group. GF
,-C(O)OR',-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),C1-C8 alkyl
,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O) NH2,-NHC(=NH)NH2,-CN,-N(R')2,-NH(R'),-NH2,-N3,halogen,-OH
S(=O)2R', -NHCONH2- and 'SR-', the lithyl 'R' is transferred to the group consisting of C1-C8 alkyl, hydrogen and an unsubstituted aryl;
R11 is a C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, or R11 is a link or
Satably: ػ
<img file="SA4069B1_D0014.tif" />
<img file="SA4069B1_D0015.tif" />
10
15
Y is -C2-C20 alkylene- or -C2-C20 heteroalkylene-;9 C3-C8
arylene-,carbocyclo--,
-arylene-Cl-,-Cl-C10alkylene-arylene-,-C3-C8heterocyclo-
,Cl0alkylene-
<p dir="rtl">-(C3-C8carbocyclo)-Cl-, -Cl-Cl0alkylene-(C3-C8carbocyclo)-</p>
,C10alkylene-
<p dir="rtl">-(Cl-Cl0alkylene-(C3-C8heterocyclo-) or --(C3-C8 heterocyclo)-Cl</p>
-Cl0alkylene;
٤٠٦٩
-١٠-
<img file="SA4069B1_D0016.tif" />
<img file="SA4069B1_D0017.tif" />
ΝΗ2- or NHL-;
eG is SH,-OH,halogen- or S-C1-C6 alkyl-;
L is antibody;
R7 is Cl,F,A,CN,ΝΟ2,Br and CF3;
Mahu 4, 3, 2, 1 or 5; and
<p dir="rtl">X is 0 or s.</p>
<p dir="rtl">» 1 Another aspect of the invention is directed to medicinal compositions comprising a significant amount of any of the aforementioned compounds and/or any one of the aforementioned antibody-drug conjugates and a pharmaceutically acceptable carrier or carrier.</p>
٤٠٦٩
-١١-
Another aspect of the experiment refers to a method of using an effective dose of any of the components of the drug, and/or any of the antigen-antibody-drug conjugate substances, to treat a cancer by giving a patient who needs treatment an effective amount of the product. /Or a substance that has been aggravated by the harm, torah.
Another aspect of the project leads to a method for treating leukoma cancer, which includes tumors, metastasis (secondary growth of a malignant tumor), or another disease or disorder characterized by undifferentiated cell growth, so that tumor cells are selected from the pool of tumors. Cancerous such as the bladder, breast, cervix, colon, brain tissue, lining of the colon, tumour, lung, esophagus, ovaries, prostate, pentecostal, melanoma, stomach, and testicles.
Brief explanation of the drawings
<p dir="rtl">10 Figure 1 shows a graph of the antitumor activity of several known substances (each of which is given at 1 mg/vol, 4 ml per day) in a plot of tumor suppression against time.</p>
Figure 2 shows a diagram of the antitumor activity of arginine extracting agents (all of which are given at 1 mg/mg, 4 meters per day) Drawing of the treatment of the tumor treated with the drug/the treatment of the tumor treated with a mask In exchange for time.
Figure 3: Test results for H(C)-#D54 and H(C)-vcMMAE are required for each test. گگگVD 1 mg/15 ml/sec.
Figures 4(a), 4(b) and 4(c) show the test results for H(C)-#D54 and H(K)-MCC DM1, an external patch for MDA-MB-361-DYT 2 km growth, Isolated from the body; and the results of the test for H(C)-vcMMAE and H(C)-mcMMAF from internal patches. MDA-MB 361-DYT2 Growth, isolation of the body, compared to the T/C removed from it For Article 20, the people will receive 4 marts daily, starting from day 1.
Figures 5(a), 5(b), 5(c), 5(d), 5(e) and 5(f) show dose-response results for EH(C)-#D54, EH(C) -vcMMAE, H(C)-mcMMAF, and -H(K)-MCC DM1 is an internal patch for the N87 root of the NMS H(C)-#D54
٤٠٦٩
-١٢-
and H(C)-vcMMAE; It shows a comparison between the T/C and the other items. Treat patients with 4 marts daily, starting on day 1.
Figure 6 shows the dose-response results for H(C)-#A115 at 1 mpk, 3 mpk and 10 mpk, an internal patch of the N87 root, a different particle Br. Four hundred square meters should be treated daily, starting on day 1.
Figure 7 shows data for hu08 conjugation of the human toxin-conjugated antibody 0101-vc or 3377-mc, in vitro growth, a replacement patch, antibody to PC3MM2 cells, a human prostate cancer cell line, showing the IL-13Rα2 receptor.
Detailed description:
<p dir="rtl">10 It relates to cell-toxic pentapeptides, which relate to antibody-drug conjugates, including pentapeptides that are toxic to the blood, and in a way that is commonly used in medicine. Treatment of cancer and other illnesses. The brother of the horse is also attached to the Tarkalda, for the salaries and materials that were used to see the perfection, the sign and the body that is not available, the diagnosis or the formation of breast cells, or the illness of the disease.</p>
15 Stripteases and abbreviations
Unless otherwise stated, the following terms and phrases used herein have the following meanings. When using trade names, the commercial name includes the product formula, the experimental drug, and the permanent active ingredient(s) of the commercial product, unless otherwise stated in the text.
The term antibody (or “Ab”) is used here meaningfully and covers
<p dir="rtl">20 In view of the properties of the multi-copy antigen, the multi-copy antibody, the specificity of the multi-copy antibody, the specificity of the multi-copy antigen The multi-specific antigen (eg, di-specific antigen), and the phosphorylation of the antibody A tumor showing the desired affinity activity for an essentially intact antibody Two regions: a variable region and a constant region. The variable region is connected to and interacts with</p>
٤٠٦٩
-١٣-
A new generation, an additional target, a target. The variable region includes a Complementary New Region (CDR) that is defined and linked to a special link location on the previous generated site They are exempt. The constant zone may be managed by, and interacts with, the immune system (see, for example:
(Janeway et al., 2001, Immuno. Biology, 5th Ed., Garland Publishing,
New York). 5
The antibody may come from any species or class (for example, IgD, IgM, IgE, IgG, and IgA) or class (for example, IgA1, IgG4, IgG3, IgG2, IgG1, and IgA2). The antibody may be derived from any suitable species. In some embodiments, the antibody may come from a human or offspring origin. The antibody may, for example, come from a human or a fermenter.
<p dir="rtl">10 Marking terms will be specifically bound.</p>
(specific binding) to an antibody that binds to a pre-polymerized antigen. Growth: The antigen binds to at least 1 x 710 gm-1, and the antigen binds to at least 1 x 710 gm-1 How many times do you have to bind to a non-specific antigen (for example, casein, BSA) other than a pre-antigen or a related antigen.
<p dir="rtl">15 The term stands for monoclonal antibody.</p>
It is used here to refer to an antibody resulting from a group of antibodies that are substantially homologous, meaning that the antibody containing the group is identical. Except for natural, proprietary aircraft that exist in small quantities. Antibodies provide highly specific copies and are directed against the site of nascent antigen. The modified suffix of a monoclonal denotes a property
<p dir="rtl">20 An antibody is produced from a substantially homogeneous complex of antibodies, and is therefore considered to require the production of the antibody by a special method.</p>
The term monoclonal antibodies includes chimeric antibodies that will be provided by a homologous or homologous section of the heavy chain and/or homolog of the corresponding order of the recombinant antibody. A group of special types or belonging to
٤٠٦٩
-١٤-
A row or a row of a special compound, which may contain the same or similar head of the chain(s). Homologous to the corresponding antibody arrangements derived from other species or belonging to another class or class of antibody, and thus tagged with these antibodies, As long as you show the desired muscle activity.
<p dir="rtl">5 You can use it there, it means “-(H(C”) to Trastuzumab</p>
HERCEPTIN® is an anti-transcriptional antibody that interferes with the HER2/neu receptor, and is bound to the HER2-specific cysteine in a double-stranded manner This is used here. “H(K)” stands for trastuzumab and is used here. Added Thousands of Thousands My Austrian people are in the process of entering the country. It is precursor to HER2/neu, and is linked through the parent of its lysines in a different sequence.
<p dir="rtl">10 The intact antibody is one that includes a variable binding region</p>
M, M, Additive, and Tf, a constant control region for the heavy chain (CL) and a constant region for the heavy chain, CH3, CH2, CH1 and CH4, which is suitable for the antibody class. Fixed control plants may consist of fixed control plants of a land arrangement (e.g., fixed control plants of a land order) or seedlings of a non-amino acid arrangement thereof.
<p dir="rtl">15 An intact antibody may have an effector function or effect,</p>
The symbols indicate the contributing fibrinoid activities of the Fc region (e.g., the Fc region of a mutant arrangement or the Fc region of a non-amino acid arrangement) of an antibody. Examples of effector functions of an antibody include complement-dependent cytotoxicity, cross-linking cytotoxicity, etc Antibody-dependent cell (ADCC) and antibody-dependent cell-mediated phagocytosis.
<p dir="rtl">20 An antibody fragment includes a section of an intact antibody, which is preferably</p>
It includes binding to the antigen or variant region of the antigen. Examples of tsauers include F(ab')2, Fab', Fab', and Fv, dimers, tetramers, tetramers, linear antibodies, and tetramers. multiple plural chain, scFv-Fc, scFv, multiple plural chain Specificity consists of the detection of an antibody, the detection of an antibody resulting from a subsequent method. Show
٤٠٦٩
-١٥-
Fab, or trace binding to the epitope of any parent, gene, or disease that is specifically immunologically linked to a target antigen (for example, a cancer cell antigen, a virus antigen, or a mitoblast antigen).
The term variable refers to the context of a body that refers to specific parts of a body.
<p dir="rtl">5 The variable structure of the double-coiled strand differs significantly in terms of the order and arrangement The specificity and specificity of the specific antigen body used in this study is to explain the specificity of the specific antigen being generated. This difference is based on three parts called hypervariable regions.</p>
Variable for the heavy chain and the heavy chain. If the divisions include an area of variable control, they are called frame areas (FRs). The ever-changing levels of control over heavy and innovative chains
<p dir="rtl">10 It includes FR regions connected by three highly variable regions.</p>
The term hypervariable region used here refers to amino acid residues of an antibody that are responsible for binding to an antigen. The hypervariable region generally includes amino acid residues from the complementary determining region (or “CDR”) (e.g., residues 24-34 (L2), 56-50 (L1) and 89-97
15 (L3) Variable control unit for the series etc. 31-35 (H2) 50-65 (H1) and 95-95
102 (L3) M variable control field of the heavy chain;
Kabat et al. (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991))
and/or residuals from a hypervariable loop (e.g., residuals 26-32 20 (L2) 52-50 (L1) and 91-96 (L3) in the variable control area R for the series etc. and 26-32
(142) 53-55 (H1) and 96-101 (H3) m variable control field of the heavy chain;
Chothia and Lesk, 1987, J. Mol. Biol. 196:901-917).
The FR variables are the variables of the variable control domain, unlike the variables of the highly variable region as specified here.
٤٠٦٩
-١٦-
The sequence of a single-chain Fv antibody or “scFv” includes the control domains V.sub.H and V.sub.L of an antibody, Lv Thus, there are probes to control the nascent polypeptide chain. Growth: The Fv polypeptide also includes a polypeptide link between the V.sub.H and V.sub.L control sequences, enabling scFv to activate the desired linkage construct.
<p dir="rtl">5 M antigen. For scFv reference, see:</p>
Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315
(1994).
The term diabody refers to the engraving of a small diagonal body having two locations.
<p dir="rtl">10 To bind to an antigen, it includes a variable heavy (VH) control domain connected to a variable heavy (VL) control domain of the polypeptide chain. By using a very short link to allow duplication between the control domains on one chain, the control domains force the complementary control domains to be duplicated to another chain, creating two generated linkage sites Additive. Binary objects are described more specifically, for example, m:</p>
EP 0 404 097; WO 93/11161; and Hollinger et al., 1993, Proc. Natl. 15 academic. Sci. USA 90:6444-6448.
The derivatives of the humanized trait from non-human antibodies (eg, rodents) are chimeric antibodies that contain the lowest derivative of non-human immunoglobulins Because of the predominant portion, the antigens containing the human antigen are globulins.
<p dir="rtl">20 Human immunity (receptor antibody) in which wastes from the immune system are replaced by non-human antigens (body). An antidote (such as an atom, a rat, a rabbit, or a non-human primate, for specificity, quality, etc.) In some cases, the desired ability is to exchange FR residues of human tissue globulin for non-human residues. In addition, human antibodies may contain residues that are not present.</p>
٤٠٦٩
-١٧-
Anti-recipient antibody or anti-donor antibody. These modifications are made in order to improve the performance of the antibody. The time, it is necessary for the human being, the human being, and the growth of the changing control, and the changing control of the changing control, and it is essentially or fundamental to the change. Bulin Al -Manahir Al -Naqir Al -Adam and the essential or essential Human tissue globulin. It also includes the antigen that is voluntarily released into the human body.
The smallest section of the fixed area of globulin tissue (Fc), growth, generation of globulin tissue, Adam. For more details, see:
Jones et al., 1986, Nature 321:522-525; Riechmann et al., 1988, Nature 332:323-329; and Presta, 1992, Curr. Op. Structure. Biol. 2:593-596.
<p dir="rtl">10 As used here, “isolated” will mean as a result of other forms of (a)</p>
(b) a natural source, such as a plant cell, tissue or cell culture, or (b) an artificial mixture of organic compounds. As used here, purified means that when isolated, the isolate is twisted at least 95%, and Another, at least 98:, of an ordered item (for example, a trace item) by weight of the isolated item.
<p dir="rtl">15 If your body is in the dark, you will hear it. (isolated) dale and syfa and/or</p>
Retrieval from a dead body in its natural environment. Contaminated components of the natural environment are toxic substances. tttttttttttttttttttttttttttttttttttttttf GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than Diagnostic uses Or therapeutic treatments for the weakened body, and may include enzymes, hormones, and other proteins, whether protein or non-protein. From false incarnations, the antibody is purified
<p dir="rtl">20 (1) To more than 95: by weight of the antibody that has been neutralized by the Lowry method, it is still more effective.</p>
From 99: by weight, (2) to a degree that at least 15 residues of amino acid arrangement are obtained inside or N-terminally using a continuous compound, or (3) to be evacuated Gance by means of SDS PAGE. These conditions differ, remove or change the difference. Coomassie BLUE or, in the face of the parts.
٤٠٦٩
-١٨-
It was found in the natural environment of a multi-faceted body. However, the antigenic antibody isolated is usually replicated by at least the original purification step.
An anti-body that induces apoptosis is an antibody that induces apoptosis by binding to annexin V. Not DNA,
<p dir="rtl">5 Cell proliferation, endoplasmic reticulum, cell turnover, and/or formation of membrane junctions (called programmed cell death bodies). Tumor cells are, for example, a breast cell, ovary, stomach, endothelium, salivary gland, lung, tumour, colon, thyroid gland, pituitary gland or bladder There are various methods available to evaluate the cellular effects of programmed cell death, for example, by measuring transduction. Phosphatidyl serine (PS) is synthesized by annexin binding; DNA binding can be evaluated.</p>
<p dir="rtl">10 Through DNA progression; Nuclear condensation/chromatin can be assessed through which DNA is transmitted through any increase in diploid cells.</p>
The term “therapeutically effective amount” refers to an effective amount of a drug to treat a disease or disorder associated with a breast cancer. In the case of cancer, a therapeutically effective version of the drug may reduce the number of cancer cells. Measure your waist size; Discourage (Yanaam), Tabatdha to Lad
<p dir="rtl">15 It also stops (i.e., slows down) the spread of cancer cells into the organs; inhibits (i.e. slows down) the invasion of the tumor; inhibits, to some extent, the growth of the tumor; Or you are afraid to go to your father or father, or you are affected by it. Anticancer symptom: The extent to which a drug inhibits the growth and/or kills existing cancer cells, whether it is cytostatic and/or cytotoxic for the treatment of cancer, is measured, for example, by a progression time test. disease (TTP) and/or response rate (RR).</p>
<p dir="rtl">20 The term substantial amount refers to a majority, meaning it is affected by</p>
<p dir="rtl">50: MF Tgm, MF mixture or sample.</p>
The term intracellular metabolite refers to a system resulting from a metabolic process or reaction within a cell on an antibody-drug conjugate (ADC). The process or process may include the addition of an enzymatic process such as proteolytic cleavage of the ADC-coated peptide link.
٤٠٦٩
-١٩-
Intracellular adducts include, for example, antibodies and a drug for exposure to intracellular cleavage after entry, penetration, specialization or metastasis of a cell.
The terms intracellularly cleaved and intracellular cleavage refer to the process or reaction of digestion inside a cell on an ADC, etc.
<p dir="rtl">5 Thus, the covalent substance, for example, the linker, can be linked between the drug part and the antibody, thus resulting in the full drug, or another substance used to distinguish the separate edges of the body shell The oppressor is inside the caliph. B, because the inhaled portion of the ADC is metabolized within the cell.</p>
The term bioavailability refers to the systemic metabolism (meaning, blood/plasma levels) of a given amount of drug given to a patient. Bioavailability is a term
<p dir="rtl">10 Absolute refers to a measure of the time (rate) and total distribution (range) of the drug per global cycle of a given dose.</p>
The term cytotoxic activity refers to a cell killing, cytotoxic or anti-mitotic effect of an ADC or an intracellular metabolite of an ADC. It is permissible to express the peaceful activity of the cell by the value IC50, which is the concentration (in grams or by weight) of each kilogram generated.
15 No, then half of the cells continue to survive.
Disorder is any instrument that prevents treatment with a drug or substance that is attached to an antibody and a drug. Thus, it includes the lowest line of land in the country and the land of the country, for all the chronic diseases Makes the breast gallbladder vulnerable to stress. Examples of common treatment risks include lymphoma and malignant cancers; Lutemia and malignant lymphoma,
<p dir="rtl">20 It regulates neuronal, glial, astrocytic, and phalangeal sensitivities, and glandular, phagocytic, endothelial, and stromal sensitivities.</p>
And inside another soul; It undergoes inflammatory, angiogenic, and immunogenic reactions.
The terms cancer and cancerous refer to or describe the uterus or groin of a mammalian organism that is characterized by irregular growth of cells. A tumor includes a birth or affected cancer cell.
٤٠٦٩
-٢٠-
Examples of patient include, limited to, human, rat, guinea pig, monkey, pig, goat, cow, horse, falcon, cat, and bird And DJ. As an embodiment of your representation, the patient is a human being.
The term means to treat or treat, unless otherwise defined.
<p dir="rtl">5 In the context, there is a general treatment and preventive measures for those with circumcision, with the purpose being to inhibit or slow down unwanted fibroid changes or stress, such as the development or spread of cancer. How much money can you achieve, what is the most important thing, what is the best way to achieve it, including the desired or beneficial clinical results, limited to, what is the best way to get money Purpose, fixation of the intended purpose (meaning, due to poor language), delaying or delaying the progress of the disease Fear or concealment of the word sickness, and abbreviation (whether partial or limited), whether noticeable or not.</p>
<p dir="rtl">10 Speechless. Treatment also means a prolongation of the gel compared to the gel that was stopped when the treatment was not received. What is needed includes treatment that is afflicted with a defect in the language or a defect in the language and that is subject to the defect or a defect in the language.</p>
In the context of cancer, the term treatment includes any inhibition of the growth of tumor cells, cancer cells, or a tumor; Inhibiting the division of tumor cells or cancer cells, reducing the tumor burden.
<p dir="rtl">15 The sulcus or the number of cancer cells are reduced, and the risk of showing the father or the most common effects of the disease.</p>
In the context of an immune disease, the term includes the treatment or suppression of cell transcription of an immune disease, which includes, or is limited to, a cell It does not produce an antibody , it increases immunity, reduces the antibody burden of the immune system, and reduces If the child is suffering from or is affected by an autoimmune disease.
<p dir="rtl">20 In the context of an infectious disease, the term includes treating any or all of these: inhibiting</p>
Growth, influencing or copying of the pathogen that causes the infectious disease and imagining the presentation of a parent or being affected by the infectious pathogen.
The term package insert is used to refer to instructions usually found on commercial packaging for therapeutic products, which distort information for reasons of shame Take it,
٤٠٦٩
-٢١-
Use, dosage, administration, conditions, wear and/or damage related to the use of these therapeutic products.
It was used here, the incorporates are used, Cell Cell Culture Culture S. The primary cell and a culture or offspring derived from it, regardless of the number of cells, include 5 transformants and transformed cells. They are also concerned that these offspring may have been circumcised with an exact identical DNA level, due to intentional or accidental changes. The mutant progeny also enter, with the same function or fibrous activity as the original successive cell. When referring to distinct additions, it is
It will become clear from the context.
<p dir="rtl">10 Unless otherwise indicated, the term "alkyl" refers to countries, or is part of another term.</p>
To a doped hydrocarbon, straight or branched-chain for the numbers indicated, carbon (for example, C1-C8 "alkyl" refers to an alkyl group with 1 to 8 carbon parts). When the number of carbon molecules is not indicated, Its alkyl group ranges from 1 to 8 carbons. The representative straight-chain C1-C8 alkyls include, but are limited to, ethyl, methyl, and alkyls.
15 n-heptyl, n-hexyl, n-pentyl, n-butyl, n-propyl and n-octyl; While the C1-C8 alkyls are increased, the chain includes, and is limited to, isobutyl, -sec-butyl, -isopropyl-, -
,tent-butyl
isopentyl-, 2-methylbutyl-; C2-C8 unsaturated alkyls include, limited to, 2-pentenyl, isobut ylenyl,2-butenyl,1-butenyl,allyl,vinyl
2,3-dimethyl-2-,2-methyl-2-butenyl,3-methyl-1-butenyl,pentenyl 20,1-butynyl,propynyl,acetylenyl,3-hexyl,2-hexyl,1-hexyl,butenyl
2-pentynyl, 1-pentynyl, 2-butynyl and 3-methyl-1-butynyl.
Unless otherwise indicated, “alkylene” refers to, or is a part of another term, a compound hydrocarbon agglutinin, a precursor or a circular compound of the compound GF, Tor MDF, Art 25 carbon, Growth, GIA 1-18 Carbon, the centerpiece of my children's longing to find a way to remove it.
٤٠٦٩
-٢٢-
Homogeneous or disordered carbon compounds, hydrogen molecules, solid alkane compounds. The growth of alkylene cracks includes, to trap, limited to: (-1,2-ethylene, methylene (-CH2).
,(-CH2CH2-)
(-1,4-butylene (-CH2CH2CH2CH2-), 1,3-propylene (-CH2CH2CH2, etc.
<p dir="rtl">5 The alkylene of the chain "C1-C10" is a saturated hydrocarbon group, the chain of which has the formula -10-1(CH2)-. The optimal feed additive for C1-C10 alkylene is added to</p>
hexylene, pentylene, butylene, propylene, ethylene, methylene
Nonylene,ocytylene, heptylene and decalene.
Unless, in other words, the term “heteroalkyl” means a fixed or straight-chain hydrocarbon Ladders for mfn, lfk, mishbab tliva Or it is twisted from 1 to 3 degrees of uncrossing. It consists of several numbers of carbon and 1 to 3 hetero-electrons selected from the group consisting of N, O, Si and S, which may optionally corrode, nitrogen and sulfur. Nitrogen contains four elements. The discrepancy between N, O and S may appear at any position within a group.
<p dir="rtl">15 heteroalkyl. The heteroalkyl gas (Si) may be used at any location in the heteroalkyl group, including the subject When an alkyl group is attached to the rest of the molecule, up to two heterogeneous molecules may form in succession.</p>
Unless otherwise indicated, the term "heteroalkylene", derived from or derived from another alternative, means a heteroalkyl group derived from a heteroalkyl (which is not the word here). 20% of heteroalkylene groups. Or the children of the chain have changed.
Unless otherwise indicated, "aryl" means a substitute or non-substituted aromatic carbocyclic acid. For 6-20, 6-14, carbon Mashattaq Afaf Road The sealant is removed from the hydrogen and the seal is wrapped in carbon.
<p dir="rtl">25 A clean and elegant room with a romantic, authentic touch. Aryl groups include growth, geography, folding, and shortening.</p>
٤٠٦٩
-٢٣-
On, derivative derivatives of benzene, substituted benzene, anthracene, naphthalene, biphenyl, etc. A substituted carbocyclic aromatic group (for example, an aryl group) can be replaced by one or more parent groups, preferably 1 to 5, of the following: - C1-C8 alkyl groups
,-C(O)R',O-(C1-C8 alkyl)
-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O)NH2,-C(O)OR',-OC(O)R '5
'N(R')2,-NH(R'),-NH2,-N3,halogen,-OH,-S(O)R',-S(O)2R- and CN-; Lithium glycopyrite is transferred to a non-substituted C1-C8 alkyl, H-aryl and non-substituted aryl. In some embodiments, it may also include one or more parent-substituted carbocyclic aromatic groups: S(=O)2R', -NHCONH2, -NHC(=NH)NH2- and 'SR-'. “arylene” is the corresponding 10th part.
Substituted alkyl means an alkyl that is substituted or affected by the hydrogen of a substitute. Alternative growth options include, but are limited to,
,-OCN,-CN,-CX3,=NR,-NR3,-NR2,-S-,-SR,-OR,-O-,-R,-X,-NRC(=O)R,-N3, =N2,-NO2,-NO,-NCS,-N=C=O,-SCN
-S(=O)2NR,-OS(=O)2OR,-S(=O)2R,-SO3H,-SO3-,-C(=O)NR2 15
PO3H2,-AsO2H2,-PO32-,-P(=O)(OR)2,-OP(=O)(OR)2,-S(=O)R,-C(=O)SR,-C (=S)OR,-CO2-,-CO2R,-C(=S)R,-C(=O)X,-C(=O)R
C(=S)NR2,-C(=O)NR2,-C(=S)SR-, or C(=NR)NR2-, Perhaps for the year ػ ػ ػ ػ
<p dir="rtl">20 Br, Cl, F, halogen, or I-; This R is based on the C1-C20 alkyl, C1-C20 heterocyclyl, C1-C20 aryl, C1-C20 heterocyclyl, a group of the first alkyl molecule. GFGF. You will also be replaced as a new employee The combination of alkylene, aryl and heteroalkylene is as described above.</p>
Unless otherwise indicated, “aralkyl” is a derivative of, or part of, another term, meaning 25 alkyl groups, which form elements, replaced by an aryl group, which form elements.
٤٠٦٩
-٢٤-
It is not indicated, for the "C1-C10 HETEOCYCLE", which is not the case Agreement of an aromatic or change or change in the course of the consequences of this 10, which adds 3 to 8, carbon (also referred to as a term for the power) and 1 to 4 members of the power, a different choice of 5 from P, O, N or S, and is derived by removing the hydrogen from the , a moment for the word From the original shot system. The substance can be absorbed or affected by the C, N or S of the heterocyclyl. If the final note includes the heterozygous substance, it may be aromatic or non-aromatic. Unless, otherwise, a heterocyclyl is attached to a dangling group at any heterocyclic or carbon position that results in a stable structure. Representative examples of C1-C10 heterocyclyls include, but are limited to,
,piperazinyl,piperidinyl,pyrrolidinyl,pyranyl,oxetanyl,tetrahyrofuranyl 10,benzopyrazolyl,indolyl,benzothiazolyl,benzothiophene,benzofuranyl,pyrazolyl,imidazolyl,thiazolyl,furanyl,thiophenyl (thiopene),pyrrolyl
quinolinyl, triazolyl, an additive similar to yours. 1,2,3,4-tetrshyhro-quinolinyl,
isothiazolyl, pyridazinyl, pyrazinyl, pyridonyl, pyridinyl, pyrimidinyl
<p dir="rtl">15 oxetane, epoxide, tetrazolyl, isoxazolyl and BODIPY (substituted or non-substituted). The C1-C10 heterocyclyl can be replaced with up to 7 groups included C(O)R',aryl,-OR',C1- C8 heteroalkyl,C1-C8 alkyl-,</p>
-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O)NH2,-C(O)OR',-OC(O)R '
'N(R')2,-NH(R'),-NH2,-N3,halogen,-S(O)R',-S(=O)2R- and CN-; Lithium 20 selects Tel 'R on the C1-C8 heteroalkyl, C1-C8 alkyl, -H and aryl moieties. With some espionage, the HETEROCYCLEL الالال: s (= o = o) 2R ',-nhconh2, -nhc (= nh) nh2- and' s-. F-heterocyclo “C1” “C10” heterocyclo is the corresponding dimer.
٤٠٦٩
-٢٥-
"heteroaralkyl" refers to another term, meaning an alkyl group, with multiple nouns, replaced by a heterocyclic group yl Aromatic, which causes ailments. The heteroaralklo is the corresponding dual part.
Unless otherwise indicated, “C3-C8 carbocyclyl” comes from or is part of.
<p dir="rtl">5 Another term is the term carbocyclic, circular or dicyclic, non-aromatic, saturated or unsaturated, substituted or unsubstituted, 3-, 4-, 5-, 6-, 7-, or 8-membered derivative Remove, hydrogen and iron A copy of the story from the original shot system. C3-C8 carbocyclyl methylation GFGF, cyclobutyl, cyclopropyl,</p>
<p>1,3- cyclohexenyl, cyclohexyl, cyclopentadienyl, cyclopentyl</p>
1,3-cycloheptadienyl, cycloheptyl, 1,4-cyclohexadienyl, cyclohexadienyl 10, cyclooctadienyl, cyclooctyl, 1,3,5-cyclohexadienyl
bicyclo(1.1.1.)pentane, and bicyclo(2.2.2.)octane. The C3-C8 carbocyclyl group may be unsubstituted or substituted with up to 7 groups involved, limited to, C1-, -OC(O)R', -C(O)R', aryl, -OR'. C8 heteroalkyl,C1-C8 alkyl
,-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O)NH2,-C(O)OR' 15
-N(R')2,-NH(R'),-NH2,-N3,-halogen,-OH,-S(=O)R',-S(=O)2R'
and CN-; Let the 'R' be transferred to the C1-C8 heteroalkyl, C1-C8 alkyl, -H and aryl. “C3-C8 carbocyclo” is the corresponding dimer.
The term chiral refers to molecules that have absolute chirality over 20 conformations, while the term small chiral refers to molecules that are absolutely chiral with each other. An identical picture.
The term stereoisomers refers to arrangements that have a similar conformational arrangement, but differ with respect to the arrangement of the empty parts or groups.
٤٠٦٩
-٢٦-
A diastereomer refers to a stereoisomer of central chirality or dimerization, the molecules of which are not exactly identical together. Diastereomers have different physical properties, for example, melting points, boiling points, folding properties, and reactants. It is permissible to formulate complex mixtures of diastereomers to avoid high-clarity analytical opinions, such as the terms of evasion and distortion 5 Traumatology RM.
The definitions and organic chemistry techniques generally used here are:
S. P. Parker, Ed., McGraw-Hill Dictionary of Chemical Terms, McGraw-Hill Book Company, New York (1984); and Eliel and Wilen, Stereochemistry of Organic Compounds, John Wiley & Sons, Inc., New
York (1994). 10
There are many organic structures that are optically active structures, that is, they have the ability to rotate the surface of a plane light pole. When describing a chemically active compound, the prefixes D and L, or R and S, are used to symbolize the absolute conformation of the molecule to the chiral center(s) of the chemical. The prefixes d and l or (+) and (-) are used to distinguish the sign of a rotating light of a plane pole by the collimator (-) or 1 means that the 15th order is to the left of the rotations. (+) or d is to the right of the rotations. In order to build a certain fit, stereoisomers are identical except that they are not exactly identical to each other. A stereoisomer combined with an enantiomer, and often called a mixture of isomers, may also be referred to as an enantiomeric mixture. A 50:50 mixture of enantiomers is referred to as a racemic or racemate mixture, which may be activated when there is forced selection, enantiomer specificity, or a chemical process. The terms racemic mixture x racemate x refer to an enantiomeric mixture of 20 racemic mixtures, devoid of optical activity.
A amino acid is a mini -aids, or an amendment to a funny, a matter of affection. . What is included in the definition?
٤٠٦٩
-٢٧-
Synthetic acid is, for example, the product of or enriched with amino acid analogues of a substituted connection, and any other known modifications.
Natural amino acid refers to glutamine, arginine,
, histidine, alanine, glycine, lysine, tryptophan, tyrosine, phenylalanine, cysteine, threonine, aspartic acid, glutamic acid, proline, serine 5
Isoleucine, asparagine, leucine, methionine, and valine, unless otherwise indicated, in the context.
The term protecting group refers to a part of the molecule, which, when attached to a protective group, evacuates the molecule, lowering or improving the molecule. There may be examples of
<p dir="rtl">10 Lamination groups:</p>
<p>T. W. Greene and PGM Wuts, Protective Groups in Organic Synthesis, 3rd edition, John Wiley & Sons, New York, 1999, and Harrison and Harrison et al., Compendium of Synthetic Organic Methods, Vols. 1</p>
8 (John Wiley and Sons, 1971-1996),
<p dir="rtl">15 The integration here is moving in contemplation. Representative hydroxy groups include acyl groups,</p>
allyl and trialkylsilyl ethers, tetrahydropyranyl ethers, trityl ethers and benzyl
ethers. Representative amino groups include trifluoroacetyl, acetyl, and formyl.
trimethyl silyl, tert-butoxycarbonyl (Boc), benzyloxycarbonyl (CBZ), benzyl (TMS)
<p dir="rtl">20 (2-trimethylsilyl-ethanesulfonyl (SES), trityl group and trityl substituent,</p>
nitro-veratryloxy, 9-fluorenylmethyloxycarbonyl (FMOC), allyloxycarbonyl
carbonyl (NVOC, etc.)
Examples of a hydroxyl protecting group (hydroxyl) include, but are limited to, 2-methoxyethoxymethyl ether, methoxymethyl ether,
٤٠٦٩
-٢٨-
p-methoxybenzyl ether, benzyl ether, tetrahydropyranyl ether
t-butyldimethyl,triisopropyl silyl ether,triethylsilyl ether,trimethylsilyl ether
acetate esters, acetate ester, triphenylmethyl silyl ether, substituted silyl ether, methanesulfonate, benzoate, pivaloate and p-toluenesulfonate.
<p dir="rtl">5 A leaving group refers to a function group that can replace a function.</p>
The group's way to work in another way. The group of Tartar is a well -being, and it is like it Halide, Halide)
trifluoromethylsulfonyl, p-toluenesulfonyl (tosyl), methanesulfonyl (mesyl) (triflate), and trifluoromethylsulfonate.
<p dir="rtl">10 The phrase “pharmaceutically acceptable salt” refers to</p>
There, it is used to refer to organic or inorganic salts that are acceptable as a medicinal product. The compound is wrapped around the amino group and the end, and according to the sequence, it allows additional salts to form To the end of the group, amino HK, L. Representative properties are added to, and are limited to, representative properties.
nitrate, iodide, bromide, chloride, oxalate, acetate, citrate, sulfate
, salicylate, lactate, isonicotinate, acid phosphate, phosphate, bisulfate 15, ascorbate, bitartrate, pantothenate, tannate, oleate, tartrate, acid citrate, glucuronate, gluconate, fumarate, gentisinate, malate, maleate, succinate, “mesylate” methanesulfonate, glut amate benzoate,formate,saccharate
p-toluenesulfonate, benzenesulfonate, ethanesulfonate, and pamoate (i.e., 20(1,1'-methylene-bis(2-hydroxy-3-naphthoate). An acceptable medicinal salt may include an additional molecule Another such as succinate ion, acetate ion or counter ion Another anti-ion may contain any organic or inorganic part that confirms the integrity of the original solution. In addition, the pharmaceutically accepted salt may have a chemical effect, such as the birth of several components of the accepted salt Pharmacologically multiple counter ions may be present. B, for, it may be available for acceptable salt
<p dir="rtl">25 Pharmacologically, it is a paralytic agent and/or an antibacterial ion.</p>
٤٠٦٩
-٢٩-
Refers to a pharmaceutically acceptable solvate or solvate derived from the substance or effect of molecules of a compound, compound or trace substance. Examples of substances that contain pharmaceutically acceptable soluble substances include, but are limited to, water, acetic acid, ethyl acetate, DMSO, methanol, ethanol, and isopropanol.
<p dir="rtl">5 acid, and ethanolamine.</p>
The terms are loading, drug loading, or drug loading.
Payload loading represents or refers to the average number of loads (payloads) and payloads are used interchangeably here. Thousands of drugs and drugs per kilogram of antibodies The ADC molecule is divided into 1 to 20 parts of the drug molecule.
<p dir="rtl">10 Antibody drug. This is referred to as DAR, or the drug-to-antibody ratio. The ADC arrangements described herein have a DAR range of 1-20, and certain embodiments of 1-8, 8-2, 2-6, 2-5 and 2-4. The DAR values are in Git 2, 4, 6 and 8. The average number of drug contracts can be characterized to cover a new mass, or DAR value, by a conventional method Such as UV/visible spectrophotometer, ELISA, and HPLC. It is also possible to create a DAR value</p>
<p dir="rtl">15 Tamiya. In some cases, it is permissible to obtain, purify, and characterize homogeneous ADCs with a particular DAR value by HPLC of a normal phase or their escape fugue. The DAR may be limited by the number of binding sites on the antibody. For example, when the ligand is cysteine thiol, it may Throughout ػ ػ ػ A It is possible to see the confusion of the thief. In some embodiments, a cysteine thiol is a thiol group of a cysteine residue, which occupies the disulfide bonds of an interfacial chain. In some embodiments, the cysteine thiol is the thiol group of the cysteine residue, which constitutes a disulfide bond in the interstitial chain. Growth, Jeeva, commits the lowest cost of the country's maximum cleansing of the drug from an anti-body during the operation of the kidnapping. An antibody might twist, for example,</p>
٤٠٦٩
-٣٠-
It contains many different lysine residues, which are used as a formula or as a recipe intermediate. Only lysine groups that affect the activity of a trace factor of an active linkage are involved.
In general, antibodies contain several active cysteine thiol groups, if present, which may contact a drug via a linker. Most cysteine metabolites are present
<p dir="rtl">5 Thiol Disoulfide, and the sister of his sister, I want to do it. And the adultery of the corner of the corner of the semester of the semester of the Nisheeh, such as the lysine or Cysteine. The ADC coil (antibody/antibody ratio) can be regulated in several different ways, including: (1) the lining of the back end of the adhesive-junction In relation to the damaged body, (2) the body is packed together or in a different way, and (2) 3) Fractionation or laceration. 10 conditions were chosen to modify the cysteine thiol.</p>
Drug-Conjugation Then, the resulting product is a mixture of the ADC mixed with the parent drug portion or trace of each antibody. The average drug concentration is characterized by the number of antibodies extracted from the mixture by, for example, a dual antibody test ELISA, specifically for Every body that is specific and specific for the term of the drug. The reaction of the ADC of the mixture may be determined by a spectral analysis, connected by HPLC, for example, 15 chromatography while leaving water.
The following is a list of abbreviations and definitions that may define or describe without dispute the request: DMSO (indicates HRMS), dimethyl sulfoxide (indicates a double-cell mass spectrometry), and high resolution mass spectrometry (DAD). Float (TFA), (diode array detection) refers to - 2,2,2 20 TFF, trifluoroacetic acid or trifluoroacetic acid (refers to tangential flow filtration (EtOH), tangential flow filtration (refers to MW), ethanol (refers to molecular weight (HPLC), m olecular weight (indicates To analyze the thermometers, the questions of the world of performance prep HPLC, preparative high performance liquid chromatography (etc.), trityl. 0000 -1,1', 1''-ethane
٤٠٦٩
-٣١-
10
15
20
1,1,1-triyltribenzene (THF), tetrahydrofuran (1,1,1-triyltribenzene), Hydroxy-2,5-pyrrolidinedione (refers to eq. Carboxybenzyl (refers to n-BuLi), equivalent (refers to OAc), n-butyllithium (refers to acetate MeOH). Sincely) ػ ػ ػ (methanol) (which refers to isopropyl or NMM), (propan-2-yl) (which refers to 4-methylmorpholine), “-” is a table that refers to... In the absence of any data at this time, rt (indicates the degree of uncertainty Lawesson reagent, Lawesson reflux, catalytic, M (grammatical particle), quant., presumed to be a mixture of rotamers (characteristic signals). distinct), major rotamer, protocol, assumed, partially obscured by water signal, total, deprotected (indicates debuffing), (indicates microwave), multiplets, partially obscured by solvent peak, base, 2 microwave steps (indicates two steps), wt (indicates weight), water (indicates water), separation (indicates to arrive), aq (indicates acclimatization), optical rotation (indicates optical rotation), and salt (indicates salt).
Arrangements and materials for antibody-drug conjugation of, for
The most important aspect of the formula is I:
<img file="SA4069B1_D0018.tif" />
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
٤٠٦٩
W is
<img file="SA4069B1_D0019.tif" />
-٣٢-
<img file="SA4069B1_D0020.tif" />
،
R1 is C1-C8 alkyl, hydrogen, or C1-C8 haloalkyl;
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
R3A and R3B resonate with which of the following:
<p dir="rtl">5 (1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,</p>
halogen, heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; And
R3B is C1-, C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl aralkyl, heteroaralkyl, aryl, C10 heterocyclyl or halogen; or
<p dir="rtl">(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
<p dir="rtl">10 R4A and R4B resonate from which of the following:</p>
<p dir="rtl">(1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; and</p>
R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl
<p dir="rtl">15 heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or</p>
<p dir="rtl">(2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
٤٠٦٩
-٣٣-
<img file="SA4069B1_D0021.tif" />
<img file="SA4069B1_D0022.tif" />
C3-C8, C1-C10
Or 5 selected groups
<img file="SA4069B1_D0023.tif" />
5
On the side of the group formed from C1-,-C1-C8 alkyl-N(R')2,-C1-C8 alkyl-
,C8 alkyl-C(O)R'
<p>-,-OC(O)R',-C(O)R',-C1-C8 alkyl-C(O)OR'-O-(C1-C8 alkyl)</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR'
10 S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3- and 'SR-,
Let the 'R' be transferred to the group consisting of an unsubstituted alkyl, hydrogen and aryl, C1-C8, or two 'R's can be formed, together with the nitrogen attached to them, C1-C10.
;heterocyclyl
٤٠٦٩
-٣٤-
<img file="SA4069B1_D0024.tif" />
10
Total GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK C1-C8 alkyl-C1-C8 alkyl-C1-C8 alkyl-C(O)R',-C1-C8 alkyl-N(R')2,
<p>-,-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),-C1-C8 alkyl-C(O)OR'</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR' -SR ',-S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3
And 'ARYLENE-R, for the year, for A. ػ ػ ,hydrogen
,C8heterocyclyl
C1-C10alkylene-C3-C8heterocyclyl and aryl, or two M'R, with the associated nitrogen, C1-C10 heterocyclyl;
R6 is C2-C8 alkynyl, -C2-C8 alkenyl, -C1-C8 alkyl, hydrogen- or C1-C8 haloalkyl-;
15
R12 is C1-C10 heterocyclyl, C1-C4 alkyl hydrogen or C6-C14
aryl;
R13 is C1-C10 heterocyclyl; And
X is O or S;
Provided that when R3A is hydrogen, X is .S
٤٠٦٩
-٣٥-
Another aspect of the approach leads to the rank of Formula IIa:
<img file="SA4069B1_D0025.tif" />
IIa
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
<img file="SA4069B1_D0026.tif" />
R<sup>1</sup>
<img file="SA4069B1_D0027.tif" />
R1 HCFC GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFGFGFFU
؛
<img file="SA4069B1_D0028.tif" />
<img file="SA4069B1_D0029.tif" />
Y is -C3-C8,-C2-C20 heteroalkylene-,-C2-C20 alkylene
,carbocyclo-
,-arylene-
10
15
-arylene-Cl-,-Cl-C10alkylene-arylene-,-C3-C8heterocyclo-
,Cl0alkylene-
-(C3-C8carbocyclo)-Cl-, -Cl-Cl0alkylene-(C3-C8carbocyclo)-
,C10alkylene-
-(C3-C8 heterocyclo)-Cl- or -Cl-Cl0alkylene-(C3-C8 heterocyclo)-
-Cl0alkylene;
٤٠٦٩
-٣٦-
<img file="SA4069B1_D0030.tif" />
G is SH,-OH,halogen- or S-CJ-C6 alkyl-;
R2 is 01-08 alkyl,hydrogen or C1-C8 haloalkyl;
5 R3A and R3B are determined by which of the following:
<p dir="rtl">(1) R3A is 03-08 carbocyclyl, 01-08 haloalkyl, 01-08 alkyl, hydrogen, aralkyl, heteroaralkyl, aryl, 01-010 heterocyclyl or halogen; And</p>
R3B is Cl-,03-08 carbocyclyl,01-08 haloalkyl,01-08 alkyl heteroaralkyl,aryl,CIO heterocyclyl or aralkyl or halogen; or
<p dir="rtl">0 1 (2) R3A and R3B together are C2-C8 alkylene or 01-08 heteroalkylene;</p>
R4Bj R4A is determined by any of the following:
<p dir="rtl">(1) R4A is 03-08 carbocyclyl, 01-08 haloalkyl, 01-08 alkyl, hydrogen, heteroaralkyl, aryl, C1C10 heterocyclyl or aralkyl; And</p>
R4B is C3-C8,C1-C8 haloalkyl,01-08 alkyl,hydrogen
,carbocyclyl 15
heteroaralkyl,aryl,Cl-ClO heterocyclyl or aralkyl; or
<p dir="rtl">(2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
٤٠٦٩
-٣٧-
<img file="SA4069B1_D0031.tif" />
<img file="SA4069B1_D0032.tif" />
C3-C8, C1-C10
Or 5 selected groups
<img file="SA4069B1_D0033.tif" />
5
On the side of the group formed from C1-,-C1-C8 alkyl-N(R')2,-C1-C8 alkyl-
,C8 alkyl-C(O)R'
<p>-,-OC(O)R',-C(O)R',-C1-C8 alkyl-C(O)OR'-O-(C1-C8 alkyl)</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR'
10 S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3- and 'SR-,
Let the 'R' be transferred to the group consisting of an unsubstituted alkyl, hydrogen and aryl, C1-C8, or two 'R's can be formed, together with the nitrogen attached to them, C1-C10.
;heterocyclyl
٤٠٦٩
-٣٨-
<img file="SA4069B1_D0034.tif" />
10
15
Total GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK C1-C8 alkyl-C1-C8 alkyl-C1-C8 alkyl-C(O)R',-C1-C8 alkyl-N(R')2,
<p>-,-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),-C1-C8 alkyl-C(O)OR'</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR' -SR ',-S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3
And 'ARYLENE-R, for the year, for A. ػ ػ ,hydrogen
,C8heterocyclyl
C1-C10alkylene-C3-C8heterocyclyl and aryl, or two M'R, with the associated nitrogen, C1-C10 heterocyclyl;
R6 is C2-C8 alkynyl, -C2-C8 alkenyl, -C1-C8 alkyl, hydrogen- or C1-C8 haloalkyl-;
R12 is C1-C10 heterocyclyl, C1-C4 alkyl, hydrogen or C6-C14 aryl;
R13 is C1-C10 heterocyclyl; And
R7 is extracted from the polycarbonate group NO2, Br, I, Cl, F, CN and CF3;
٤٠٦٩
-٣٩-
R10 kgCl-,-aryl,-C3-C8carbocyclyl,-Cl-Cl0alkyl,hydrogen-
C10heteroalkyl,
-Cl-,-arylene-Cl-Cl0alkyl,-Cl-Cl0alkylene-aryl,-C3-C8heterocyclo
-Cl-,-(C3-C8 carbocyclo)-Cl-Cl0alkyl,Cl0alkylene-(C3-C8carbocyclo)
5 (Cl0alkylene-(C3-C8heterocyclo, and,-(C3-C8 heterocyclo)-Cl-Cl0alkyl)
Lith optionally replaces the aryl on R10 containing the aryl m R7[h];
h is 1, 2, 3, 4 or 5; And
X is O or S;
Provided that when R3A is hydrogen, X is .S
<p dir="rtl">10 Another aspect of the approach leads to the rank of Formula IIIa:</p><img file="SA4069B1_D0035.tif" />
IIIa
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
<img file="SA4069B1_D0036.tif" />
R1 is C1-C8 alkyl, hydrogen, or C1-C8 haloalkyl;
<img file="SA4069B1_D0037.tif" />
or
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
15
٤٠٦٩
-٤٠-
R3A and R3B resonate with which of the following:
<p dir="rtl">(1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; and</p>
R3B is C1-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl.
<p dir="rtl">5 halogen, heteroaralkyl, aryl, C10 heterocyclyl or aralkyl; or</p>
<p dir="rtl">(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
R4A and R4B resonate from which of the following:
<p dir="rtl">(1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; and</p>
10 R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
<p dir="rtl">(2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;</p><img file="SA4069B1_D0038.tif" />
٤٠٦٩
-٤١-
<img file="SA4069B1_D0039.tif" />
<img file="SA4069B1_D0040.tif" />
Replacing
Optionally 1, 2, 3, 4 or 5 different feed sets for each feeding group. GF
,-C(O)OR',-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),C1-C8 alkyl
,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O) NH2,-NHC(=NH)NH2,-CN,-N(R')2,-NH(R'),-NH2,-N3,halogen,-OH 5
S(=O)2R', -NHCONH2- and 'SR-', the lithyl 'R' is transferred to the group consisting of C1-C8 alkyl, hydrogen and an unsubstituted aryl;
<img file="SA4069B1_D0041.tif" />
<img file="SA4069B1_D0042.tif" />
R11 is
Y is -C3-C8,-C2-C20 heteroalkylene-,-C2-C20 alkylene
<p dir="rtl">10 -arylene-,carbocyclo-,</p>
arylene-Cl-,-Cl-C10alkylene-arylene-,-C3-C8heterocyclo--
,Cl0alkylene-
-(C3-C8carbocyclo)-Cl-, -Cl-Cl0alkylene-(C3-C8carbocyclo)-
,C10alkylene-
15 -(Cl-Cl0alkylene-(C3-C8heterocyclo-) or --(C3-C8 heterocyclo)-Cl
-Cl0alkylene;
٤٠٦٩
-٤٢-
<img file="SA4069B1_D0043.tif" />
CN and CF3;
<p dir="rtl">5 R10 kgCl-,-aryl,-C3-C8carbocyclyl,-Cl-Cl0alkyl,hydrogen-</p>
C10heteroalkyl,
<p dir="rtl">-Cl-,-arylene-Cl-Cl0alkyl,-Cl-Cl0alkylene-aryl,-C3-C8heterocyclo</p>
-Cl-,-(C3-C8 carbocyclo)-Cl-Cl0alkyl,Cl0alkylene-(C3-C8carbocyclo) (Cl0alkylene-(C3-C8heterocyclo), and,-(C3-C8 heterocyclo)-Cl-Cl0alkyl
10 Lith optionally replaces the aryl on R10 containing the aryl m R7[h];
h is 1, 2, 3, 4 or 5; And
X is O or S;
R6 is C1-C8 alkyl,hydrogen- or C1-C8 haloalkyl-; And
h is 1, 2, 3, 4 or 5.
15 Another aspect of the problem leads to the arrangement of formula IIb
<img file="SA4069B1_D0044.tif" />
٤٠٦٩
lib
-٤٣-
Or a pharmaceutically acceptable salt or dissolved substance thereof, where, individually in each case, it is:
<img file="SA4069B1_D0045.tif" />
<img file="SA4069B1_D0046.tif" />
<img file="SA4069B1_D0047.tif" />
7 is -C3-C8,-02-020 heteroalkylene-,-02-020 alkylene
arylene-,carbocyclo--,
-arylene-CI- -01-01010-0-, -C3-C8heterocyclo-
,ClOalkylene-
10 -(_(C3-C8carbocyclo)-CI-,-CI-CIOalkylene-(C3-C8carbocyclo)
ClOalkylene-,
-(03-0800000000)-0-000006 or --(C3-C8 heterocyclo)-CI
-ClOalkylene;
٤٠٦٩
-٤٤-
Z e
<img file="SA4069B1_D0048.tif" />
<img file="SA4069B1_D0049.tif" />
<img file="SA4069B1_D0050.tif" />
<img file="SA4069B1_D0051.tif" />
L is antibody;
ٻو
<img file="SA4069B1_D0052.tif" />
<img file="SA4069B1_D0053.tif" />
or NHL-;
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
10
15
R3A and R3B resonate with which of the following:
(1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; and
R3B is C1-, C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl halogen, heteroaralkyl, aryl, C10 heterocyclyl or aralkyl; or
(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;
R4A and R4B resonate from which of the following:
(1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; and
R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
(2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;
٤٠٦٩
-٤٥-
<img file="SA4069B1_D0054.tif" />
<img file="SA4069B1_D0055.tif" />
C3-C8, C1-C10
Or 5 selected groups
<img file="SA4069B1_D0056.tif" />
5
On the side of the group formed from C1-,-C1-C8 alkyl-N(R')2,-C1-C8 alkyl-
,C8 alkyl-C(O)R'
<p>-,-OC(O)R',-C(O)R',-C1-C8 alkyl-C(O)OR'-O-(C1-C8 alkyl)</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR'
10 S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3- and 'SR-,
Let the 'R' be transferred to the group consisting of an unsubstituted alkyl, hydrogen and aryl, C1-C8, or two 'R's can be formed, together with the nitrogen attached to them, C1-C10.
;heterocyclyl
٤٠٦٩
-٤٦-
<img file="SA4069B1_D0057.tif" />
10
15
Total GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK C1-C8 alkyl-C1-C8 alkyl-C1-C8 alkyl-C(O)R',-C1-C8 alkyl-N(R')2,
<p>-,-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),-C1-C8 alkyl-C(O)OR'</p>
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR' -SR ',-S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3
And 'ARYLENE-R, for the year, for A. ػ ػ ,hydrogen
,C8heterocyclyl
C1-C10alkylene-C3-C8heterocyclyl and aryl, or two M'R, with the associated nitrogen, C1-C10 heterocyclyl;
R6 is C2-C8 alkynyl, -C2-C8 alkenyl, -C1-C8 alkyl, hydrogen- or C1-C8 haloalkyl-;
R12 is C1-C10 heterocyclyl, C1-C4 alkyl hydrogen or C6-C14
aryl;
R13 is C1-C10 heterocyclyl; And
X is O or S;
Provided that when R3A is hydrogen, X is .S
٤٠٦٩
-٤٧-
Another aspect of the approach leads to the rank of Formula IIIb:
<img file="SA4069B1_D0058.tif" />
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
<img file="SA4069B1_D0059.tif" />
<img file="SA4069B1_D0060.tif" />
<img file="SA4069B1_D0061.tif" />
R1 is C1-C8 alkyl, hydrogen, or C1-C8 haloalkyl;
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
R3A and R3B resonate with which of the following:
10 (1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,
halogen, heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; And
R3B is C1-, C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl halogen, heteroaralkyl, aryl, C10 heterocyclyl or aralkyl; or
(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;
15 R4A and R4B resonate from which of the following:
٤٠٦٩
-٤٨-
(1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; and
R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl
5 heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
(2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;
<img file="SA4069B1_D0062.tif" />
10 Optionally 1, 2, 3, 4 or 5 different feed sets for each feeding group. GF
,-C(O)OR',-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),C1-C8 alkyl
,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O) NH2,-NHC(=NH)NH2,-CN,-N(R')2,-NH(R'),-NH2,-N3,halogen,-OH
S(=O)2R', -NHCONH2- and 'SR-', the lithium oxide 'R' is transferred over the 15-member group of C1-C8 alkyl, hydrogen and unsubstituted aryl;
٤٠٦٩
-٤٩-
<img file="SA4069B1_D0063.tif" />
Y is -C3-C8,-C2-C20 heteroalkylene-,-C2-C20 alkylene
arylene-,carbocyclo--,
-arylene-Cl-,-Cl-C10alkylene-arylene-,-C3-C8heterocyclo-
<p dir="rtl">5 -Cl0alkylene</p>
C3-C8carbocyclo)-Cl-,-Cl-Cl0alkylene-(C3-C8carbocyclo)-)-
,C10alkylene-
-(Cl-Cl0alkylene-(C3-C8heterocyclo-) or --(C3-C8 heterocyclo)-Cl
-Cl0alkylene;
<img file="SA4069B1_D0064.tif" />
10
<img file="SA4069B1_D0065.tif" />
NHL-;
L is antibody;
X is O or .S
Another aspect of the approach to the rank of formula IIc:
٤٠٦٩
-٥٠-
<img file="SA4069B1_D0066.tif" />
1-20
IIc
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
<img file="SA4069B1_D0067.tif" />
O
NH
O
<img file="SA4069B1_D0068.tif" />
<img file="SA4069B1_D0069.tif" />
O
<img file="SA4069B1_D0070.tif" />
'R1 is
10
Y is -C3-C8,-C2-C20 heteroalkylene-,-C2-C20 alkylene
arylene-,carbocyclo--,
-arylene-Cl-,-Cl-C10alkylene-arylene-,-C3-C8heterocyclo-
,Cl0alkylene-
-(C3-C8carbocyclo)-Cl-, -Cl-Cl0alkylene-(C3-C8carbocyclo)-
,C10alkylene-
<p dir="rtl">-(Cl-Cl0alkylene-(C3-C8heterocyclo-) or --(C3-C8 heterocyclo)-Cl</p>
-Cl0alkylene;
٤٠٦٩
-٥١-
<img file="SA4069B1_D0071.tif" />
L is antibody;
D is -(48)(4)0- or absent;
E52 is C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, or absent if
'exists;
'R3A R3B6' is determined by any of the following:
(1) 'R3A is C3-C8,01-08 haloalkyl,01-08 alkyl,hydrogen
,carbocyclyl
0 1 aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; And
R3B' is Cl- 03-08 carbocyclyl, 01-08 haloalkyl, 01-08 alkyl halogen, heteroaralkyl, aryl, CIO heterocyclyl or aralkyl, or 'R3B' is a C2-C4 alkylene and forms a 5-7-membered ring as indicated in 4'0; or
(2) 53] R3B6 together are C2-C8 alkylene or C1-C8 heteroalkylene;
5 1 'R4A R4B6' is determined by any of the following:
٤٠٦٩
-٥٢-
(1) 'R4A' C1-C8 haloalkyl, C1-C8 haloalkyl hydrogen, C3-C8
,carbocyclyl
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; And
'R4B Halo C1-C8 haloalkyl, C1-C8 haloalkyl, hydrogen
,carbocyclyl 5
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
<img file="SA4069B1_D0072.tif" />
On the side of the group formed from C1-,-C1-C8 alkyl-N(R')2,-C1-C8 alkyl-
,C8 alkyl-C(O)R'
-,-OC(O)R',-C(O)R',-C1-C8 alkyl-C(O)OR'-O-(C1-C8 alkyl) 15
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR'
٤٠٦٩
-٥٣-
S(=O)2R', -NHCONH2, -NHC(=NH)NH2, -CN, -N(R')2, -N3- and 'SR-', so that the tail of 'R' is selected one by one from the group consisting of C1 -C8 alkyl, hydrogen and aryl are not substituted, or two R's can be formed, together with the nitrogen bonded to them, C1-C10
;heterocyclyl
<img file="SA4069B1_D0073.tif" />
<img file="SA4069B1_D0074.tif" />
<sup>R</sup>13 Optionally replaced with 1, 2, 3, 4 or 5 combinations depending on the choice.
Total
C1-C8 alkyl-C(O)R', C1-C8 alkyl-N(R')2,
<p>-,-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),-C1-C8 alkyl-C(O)OR'</p>
halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR' 10
<p>-SR',-S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3</p>
And 'arylene-R, levitra. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFGTH is moving on GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than TGGF. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GF
'R Your feed for a meal. C1-C8 alkyl hydrogen
,C8heterocyclyl
<p dir="rtl">15 C1-C10alkylene-C3-C8heterocyclyl and aryl, or two M'R can be formed, together</p>
The associated nitrogen, C1-C10 heterocyclyl;
R6 is C2-C8 alkynyl, -C2-C8 alkenyl, -C1-C8 alkyl, hydrogen- or C1-C8 haloalkyl-;
R12 is C1-C10 heterocyclyl, C1-C4 alkyl hydrogen or C6-C14
20 aryl;
٤٠٦٩
-٥٤-
R13 is C1-C10 heterocyclyl; And
X is O or S;
Provided that when R3A is hydrogen, X is S.
Another aspect of the approach leads to the rank of Formula IIIc:
<img file="SA4069B1_D0075.tif" />
L
IIIc
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
<img file="SA4069B1_D0076.tif" />
<img file="SA4069B1_D0077.tif" />
<img file="SA4069B1_D0078.tif" />
10 R1 is C1-C8 alkyl, hydrogen, or C1-C8 haloalkyl;
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
R3A and R3B resonate with which of the following:
(1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,
aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; And
٤٠٦٩
-٥٥-
R3B is C1-, C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl aralkyl, heteroaralkyl, aryl, C10 heterocyclyl or halogen; or
(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;
R4A and R4B resonate from which of the following:
5 (1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; And
R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl
aralkyl,aryl,C1-C10 heterocyclyl or heteroaralkyl; or
10 (2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;
R5 is:
<img file="SA4069B1_D0079.tif" />
<img file="SA4069B1_D0080.tif" />
<img file="SA4069B1_D0081.tif" />
<img file="SA4069B1_D0082.tif" />
<img file="SA4069B1_D0083.tif" />
Optional replacement with 1, 2, 3, 4 or 5 selected groups depending on part of the range.
C(O)OR',-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),C1-C8 alkyl-,
,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O) NH2 15
-NHC(=NH)NH2,-CN,-N(R')2,-NH(R'),-NH2,-N3,halogen,-OH
٤٠٦٩
-٥٦-
S(=O)2R', -NHCONH2- and 'SR-', the lithyl 'R' is transferred to the group consisting of C1-C8 alkyl, hydrogen and an unsubstituted aryl;
<img file="SA4069B1_D0084.tif" />
<img file="SA4069B1_D0085.tif" />
NH2
<img file="SA4069B1_D0086.tif" />
'R11 is
Y is -C3-C8,-C2-C20 heteroalkylene-,-C2-C20 alkylene
<p dir="rtl">5 -arylene-,carbocyclo-,</p>
arylene-Cl-,-Cl-C10alkylene-arylene-,-C3-C8heterocyclo--
,Cl0alkylene-
-(C3-C8carbocyclo)-Cl-, -Cl-Cl0alkylene-(C3-C8carbocyclo)-
,C10alkylene-
10 -(Cl-Cl0alkylene-(C3-C8heterocyclo-) or --(C3-C8 heterocyclo)-Cl
-Cl0alkylene;
<img file="SA4069B1_D0087.tif" />
-NH-;
<img file="SA4069B1_D0088.tif" />
<img file="SA4069B1_D0089.tif" />
L is antibody;
15 X is O or S.
٤٠٦٩
-20
-٥٧-
Another aspect of the approach to the rank of formula IId:
<img file="SA4069B1_D0090.tif" />
<img file="SA4069B1_D0091.tif" />
IId
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
<p dir="rtl">5 L is antibody;</p>
[linker] is a two-way link;
D is –(‘C(R4A’)(R4B)– or absent;
'R2 is C1-C8 haloalkyl, C1-C8 alkyl hydrogen, absent or absent, or present;
10 'R3A' and 'R3B' resonate with which of the following:
<p dir="rtl">(1) 'R3A' haloalkyl, C1-C8, C1-C8 haloalkyl hydrogen, C3-C8</p>
,carbocyclyl
aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; And
R3B' is C1-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl.
15 C10 heterocyclyl or aralkyl, or aralkyl, halogen, heteroaralkyl, or 'R3B' is a C2 C4 alkylene and has 5-7 members as indicated; or
<p dir="rtl">(2) 'R3A' and 'R3B' together are C2-C8 alkylene or C1-C8 heteroalkylene;</p>
'R4A and 'R4B resonate from which of the following:
٤٠٦٩
-٥٨-
(1) 'R4A' C1-C8 haloalkyl, C1-C8 haloalkyl hydrogen, C3-C8
,carbocyclyl
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; And
'R4B Halo C1-C8 haloalkyl, C1-C8 haloalkyl, hydrogen
,carbocyclyl 5
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
<img file="SA4069B1_D0092.tif" />
On the side of the group formed from C1-,-C1-C8 alkyl-N(R')2,-C1-C8 alkyl-
,C8 alkyl-C(O)R'
-,-OC(O)R',-C(O)R',-C1-C8 alkyl-C(O)OR'-O-(C1-C8 alkyl) 15
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR'
٤٠٦٩
-٥٩-
S(=O)2R', -NHCONH2, -NHC(=NH)NH2, -CN, -N(R')2, -N3- and 'SR-', so that the tail of 'R' is selected one by one from the group consisting of C1 -C8 alkyl, hydrogen and aryl are not substituted, or two R's can be formed, together with the nitrogen bonded to them, C1-C10
;heterocyclyl
<img file="SA4069B1_D0093.tif" />
<img file="SA4069B1_D0094.tif" />
<sup>R</sup>13 Optionally replaced with 1, 2, 3, 4 or 5 combinations depending on the choice.
Total
C1-C8 alkyl-C(O)R', C1-C8 alkyl-N(R')2,
<p>-,-OC(O)R',-C(O)R',-O-(C1-C8 alkyl),-C1-C8 alkyl-C(O)OR'</p>
halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,C(O)OR' 10
<p>-SR',-S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3</p>
And 'arylene-R, levitra. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFGTH is moving on GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than TGGF. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GF
'R Your feed for a meal. C1-C8 alkyl hydrogen
,C8heterocyclyl
<p dir="rtl">15 C1-C10alkylene-C3-C8heterocyclyl and aryl, or two M'R can be formed, together</p>
The associated nitrogen, C1-C10 heterocyclyl;
R6 is C2-C8 alkynyl, -C2-C8 alkenyl, -C1-C8 alkyl, hydrogen- or C1-C8 haloalkyl-;
R12 is C1-C10 heterocyclyl, C1-C4 alkyl hydrogen or C6-C14
20 aryl;
٤٠٦٩
-٦٠-
R13 is C1-C10 heterocyclyl; And
X is O or S;
Provided that when R3A is hydrogen, X is S.
Another aspect of the approach leads to the rank of Formula IIId:
<img file="SA4069B1_D0095.tif" />
[linker]
1-20
IIId
Or a salt or medicinally acceptable substance made from, etc., obtained by a machine such as:
W is
<img file="SA4069B1_D0096.tif" />
،
O
<img file="SA4069B1_D0097.tif" />
،
10
15
R1 is C1-C8 alkyl, hydrogen, or C1-C8 haloalkyl;
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
R3A and R3B resonate with which of the following:
(1) R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; and
R3B is C1-, C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl halogen, heteroaralkyl, aryl, C10 heterocyclyl or aralkyl; or
(2) R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;
٤٠٦٩
-٦١-
R4A and R4B resonate from which of the following:
(1) R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen, heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; and
R4B haloalkyl, C1-C8, C3-C8 haloalkyl, hydrogen
,carbocyclyl 5
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; or
(2) R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;
R5 is:
<img file="SA4069B1_D0098.tif" />
<img file="SA4069B1_D0099.tif" />
or
<img file="SA4069B1_D0100.tif" />
<img file="SA4069B1_D0101.tif" />
10 Optional custodian, M1, 2, 3, 4 or 5, a sealed collection of time for the semester of the semester of the c (O) or ', -OC (O) R', -C (O) R ', -o-(C1- C8 alkyl), C1-C8 alkyl-,
,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,-C(O)NHR',-C(O) NH2,-NHC(=NH)NH2,-CN,-N(R')2,-NH(R'),-NH2,-N3,halogen,-OH
S(=O)2R', -NHCONH2- and 'SR-', the lithium oxide 'R' is transferred over the 15-member group of C1-C8 alkyl, hydrogen and unsubstituted aryl;
[linker] is a two-way link;
٤٠٦٩
-٦٢-
L is antibody;
X is O or .S
In certain embodiments, the number of names culminates in any of the different ranks, terms and definitions, such that the rank is represented by the formula:
<img file="SA4069B1_D0102.tif" />
<img file="SA4069B1_D0103.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Laith Yatuf W is
<img file="SA4069B1_D0104.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<img file="SA4069B1_D0105.tif" />
10
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Laith Yatuf W is
<img file="SA4069B1_D0106.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<img file="SA4069B1_D0107.tif" />
٤٠٦٩
-٦٣-
<img file="SA4069B1_D0108.tif" />
In certain embodiments, the present invention addresses any of the foregoing compounds and accompanying definitions, wherein the RI is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl.
<p dir="rtl">5 In certain embodiments, the present invention refers to any of the aforementioned compounds and accompanying definitions, where RI is hydrogen.</p>
In certain embodiments, the present invention addresses any of the aforementioned compounds and accompanying definitions, wherein the RI is a C1-C8 alkyl.
In certain embodiments, the present invention refers to any of the aforementioned compounds and the accompanying definitions 10, where the RI is methyl.
In certain embodiments, the present invention addresses any of the foregoing compounds and accompanying definitions, where 82 is a C1-C8 alkyl,hydrogen or a C1-C8 haloalkyl.
In certain embodiments, the present invention addresses any of the aforementioned compounds and accompanying definitions, where R2 is hydrogen.
<p dir="rtl">5 1 In certain embodiments, the present invention addresses any of the aforementioned compounds and accompanying definitions, wherein R2 is a C1-C8 alkyl.</p>
In certain embodiments, the present invention addresses any of the aforementioned compounds and accompanying definitions, wherein R2 is methyl.
٤٠٦٩
-٦٤-
In certain embodiments, the R1 is culminated in any of the ranks of the series L, R, and other metamorphoses, such that R1 is hydrogen; The R2 is methyl.
In certain embodiments, the R1 is methyl; The R2 is methyl.
<p dir="rtl">5 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.</p>
Morocco, Lith Yatov R3A is C3-C8, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen heteroaralkyl, aryl, C1-C10 heterocyclyl, carbocyclyl or aralkyl; And R3B is
,C1-C8 alkyl
aryl, C1-C10 heterocyclyl, C3-C8 carbocyclyl, C1-C8 haloalkyl
<p dir="rtl">10 halogen, heteroaralkyl or aralkyl.</p>
In certain embodiments, the nickel of the alkyl is culminated to any of the tertiles and derivatives, the lithium of R3A is C1-C8 haloalkyl, C1-C8 haloalkyl, aryl, C1-C10 haloalkyl, C1-C10 haloalkyl, aryl. ,carbocyclyl or aralkyl; And R3B is
,C1-C8 alkyl
aryl, C1-C10 heterocyclyl, C3-C8 carbocyclyl, C1-C8 haloalkyl 15
aralkyl, heteroaralkyl or halogen.
In certain embodiments, the R3A is halogen.
In certain embodiments, the R3A is hydrogen.
In certain embodiments, the alkyl alkyl is cleaved to any of the alkyl compounds, such as R3A, where R3A is a C1-C8 alkyl.
٤٠٦٩
-٦٥-
In certain embodiments, the label is culminated to any of the derivatives of the series L, T, and rogue metabolites, whereby R3A is methyl.
In certain embodiments, the alkyl alkyl is coupled to any of the alkyl compounds, such as R3B, where R3B is a C1-C8 alkyl.
<p dir="rtl">5 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.</p>
Please note that R3B is methyl.
In certain embodiments, the label is culminated in any of the stranded grades and strips, whereby R3B is isopropyl.
In certain embodiments, the R3B is a C3-C8 carbocyclyl.
In certain embodiments, the label is culminated in any of the derivatives of the series, the transposition and the rogue definitions, whereby R3B is a cylohexyl.
In certain embodiments, the alkyl alkyl is coupled to any of the alkyl compounds, such as R3A, where R3A is a C1-C8 alkyl; The R3B is a C1-C8 alkyl.
<p dir="rtl">15 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.</p>
Note: R3A is methyl; The R3B is methyl.
In certain embodiments, the R3A is hydrogen; The R3B is a C1-C8 alkyl.
In certain embodiments, the R3A is hydrogen; The R3B is isopropyl.
٤٠٦٩
-٦٦-
In certain embodiments, the light is culminated in any of the above-mentioned grades and strips, consisting of fibers consisting of R3A and R3B, together with C2-C8 alkylene or C1- C8
heteroalkylene
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
5 Note: R3A and R3B together are C2-C8 alkylene.
In certain embodiments, the lamin is culminated in any of the series series, L, and rogue definitions, such that R3A and R3B together are –CH2CH2–.
In certain embodiments, the lamin is culminated in any of the series series, L, and rogue definitions, such that R3A and R3B together are –CH2CH2CH2–.
<p dir="rtl">10 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.</p>
The thief, let R3A and R3B together are –CH2CH2CH2CH2–.
In certain embodiments, the alkyl nickel is coupled to any of the three heteroalkylenes, such that R3A and R3B together are C1-C8 heteroalkylene.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
15 The thief, Lith Yof R3A and R3B together are –CH2OCH2–.
In certain embodiments, the nickel of the alkyl is culminated to any of the tertiles and derivatives, and the R4A lithium is C1-C8 haloalkyl, C1-C8 haloalkyl, C1-C8 haloalkyl, aryl, C1-C10 haloalkyl, aryl. ,carbocyclyl or aralkyl; And R4B is
,C1-C8 alkyl
aryl, C1-C10 heterocyclyl, C3-C8 carbocyclyl, C1-C8 haloalkyl 20
heteroaralkyl or aralkyl.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The trick is that R4A is hydrogen.
٤٠٦٩
-٦٧-
In certain embodiments, the alkyl alkyl is cleaved to any of the alkyl compounds, such as R4A, which is a C1-C8 alkyl.
In certain embodiments, the label is attached to any of the derivatives of the series L, TR and rogue metabolites, whereby R4A is methyl.
<p dir="rtl">5 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.</p>
The thief, R4B is hydrogen.
In certain embodiments, the alkyl alkyl is cleaved to any of the alkyl compounds, such as R4B, where R4B is a C1-C8 alkyl.
In certain embodiments, the label is added to any of the ranks of the series, the 10 strands, where R4B is methyl.
In certain embodiments, the alkyl alkyl is culminated to any of the alkyl compounds, such as R4A, where R4A is a C1-C8 alkyl; The R4B is a C1-C8 alkyl.
In certain embodiments, the label is culminated to any of the derivatives of the series L, T, and rogue metabolites, whereby R4A is methyl; The R4B is methyl.
<p dir="rtl">15 In certain embodiments, the R4A is hydrogen; And R4B is hydrogen.</p>
In certain embodiments, the R4A is hydrogen; The R4B is a C1-C8 alkyl.
In certain embodiments, the light is culminated in any of the 20 grades of carbon fibers, consisting of R4A and R4B, including C2-C8 alkylene C1-C8
heteroalkylene
٤٠٦٩
-٦٨-
In certain embodiments, the lamination is culminated to any of the cyclic positions, such that R4A and R4B are together C2-C8 alkylene.
In certain embodiments, the lamin can be culminated to any of the series series, L, and rogue definitions, such that R4A and R4B together are –CH2CH2–.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, let R4A and R4B together are –CH2CH2CH2–.
In certain embodiments, the lamin switch is culminated in any of the rogue ranks and definitions, such that R4A and R4B together are –CH2CH2CH2CH2–.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<p dir="rtl">10 MARCH, LITH YETOV R4A and R4B together are C1-C8 heteroalkylene.</p>
In certain embodiments, the name is culminated in any of the rogue ranks and definitions, such that R4A and R4B together are –CH2OCH2–.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
15
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
٤٠٦٩
-٦٩-
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<img file="SA4069B1_D0109.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The rogue, Lith Yatov R5 is.
5 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The rogue, Lith Yatov R5 is.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0110.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
10
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0111.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0112.tif" />
٤٠٦٩
-٧٠-
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0113.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0114.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0115.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
10
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0116.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0117.tif" />
٤٠٦٩
-٧١-
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<img file="SA4069B1_D0118.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Lith Ytuv R5 is
<img file="SA4069B1_D0119.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<img file="SA4069B1_D0120.tif" />
In certain embodiments, the letter "R6" culminates in any of the ranks of the R series and the rogue definitions, whereby R6 is hydrogen.
10
15
In certain embodiments, the R6 alkyl is culminated to any of the strands of L, R and cyclic ligands, where R6 is a C1-C8 alkyl.
In certain embodiments, the R6 is methylated.
In certain embodiments, the superstition of the word culminates in any of the ranks of the lineage, the Q, and the rogue definitions, such that X is O.
In certain embodiments, the name is culminated in any of the ranks of the lineage of L, S, and rogue definitions, such that X is S.
٤٠٦٩
-٧٢-
In certain embodiments, the selection of the product culminates in any of the levels being a liquid, liquid, salt or pharmaceutically acceptable substance of, type, and other definitions, whereby the level is selected from the group consisting of:
N-Methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{ [(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}- 5 3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl ]-N-methyl-L-valinamide;
N2-[(1-Aminocyclopentyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4 -10yl]-N-methyl-L-valinamide;
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S) -2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl -L-valinamide; 15
N-Methyl-L-valyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-[ (2-phenylethyl)amino]-3-thioxopropyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide;
N-Methyl-L-valyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3- 20 thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
N-Methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-
methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-
٤٠٦٩
-٧٣-
methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}- 1-methoxy-2-methyl-3-
thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]- 5
N-methyl-L-valinamide;
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy -1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide; 10
N2-[(1-Aminocyclopentyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide;
N2-[(1-Aminocyclopropyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)- 15 2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-
thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide;
1-Amino-N-[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-
methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2- 20
yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]cyclohexanecarboxamide;
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-
methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-
٤٠٦٩
-٧٤-
yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-Methylalanyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[ (2-phenylethyl)amino]propyl}pyrrolidin-1-
yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide; 5
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-
methoxy-2-methyl-3-oxo-3-{[(1-
phenylcyclopropyl)methyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-10)
2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4- yl]-N-
methyl-L-valinamide;
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}- 1-methoxy-2-methyl-3-15
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy -1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N- 20
methyl-L-valinamide;
N2-[(3-Aminoxetan-3-yl)carbonyl]-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy- 2-methyl-3-oxo-3-[(2-
٤٠٦٩
-٧٥-
phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide;
N,2-Dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1 -methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N- 5 methyl -L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino }-1-methoxy-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide; 10
N,2-Dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[( 1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N -methyl-L-valinamide;
N,2-Dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1- 15
methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5- methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
N2-(3-Amino-2,2-dimethylpropanoyl)-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2 -methyl-3-oxo-3-{[(1S)-2-phenyl-1- 20
(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
N2-(3-Amino-2,2-dimethylpropanoyl)-N-{(3R,4S,5S)-3-methoxy-1-
[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-
٤٠٦٩
-٧٦-
phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide;
2-Methyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo -3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl ]-N- 5
methyl-L-vaLinamide;
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[1-(bicyclo[4.2.0]octa-1,3, 5-trien-7-yl)-2-methoxy-2-oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-
oxoheptan-4-yl]-N-methyl-L-valinamide; 10
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[bicyclo [4.2.0]octa-1,3,5-trien -7-yl(carboxy)methyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide;
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1- 15
hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}- 1-methoxy-2-methyl-3-20
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide;
2-methyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-
methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-
٤٠٦٩
-٧٧-
methyl-3 oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-5 methyl-L-valinamide;
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo-3 -phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide; 10
Methyl N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-(3-amino-2,2-
dimethylpropanoyl)-L-valyl](methyl)amino}-3-methoxy-5-
methylheptanoyl]pyrrolidin-2-yl}-3-methoxy-2-methylpropanoyl]-L-phenylalaninate;
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert- 15
butoxy-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-methyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S) -1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2- 20 methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N -
methyl-L-valinamide;
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-
hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٧٨-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-(methylamino)-2 -oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- 5 oxobutyl}-N-methyl -L-valinamide;
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-2-amino-
1-benzyl-2-oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide; 10
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-
2-oxo-2-(propylamino)ethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide;
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl- 15
2-(diethylamino)-2-oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- oxobutyl}-N-methyl-L-valinamide;
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-(tert-butylamino) -2-oxoethyl]amino}-1-methoxy-2-methyl-3- 20 oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N -methyl-L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-
hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٧٩-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
3-methyl-D-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2 -oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- 5 oxobutyl}-N-methyl -L-valinamide;
3-methyl-L-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2 -oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl- L-valinamide; 10
L-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2-oxoethyl]amino }-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide;
D-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2- 15
methoxy-2-oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide;
1,2-dimethyl-L-prolyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3- 20 oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-
oxobutyl}-N-methyl-L-valinamide;
1,2-dimethyl-D-prolyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٨٠-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide;
N~2~-[2,2-dimethyl-3-(methylamino)propanoyl]-N-{(1S,2R)-2-methoxy-4-{(2S)-2-[(1R,2R)-1 -methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-1 -[(1S)-5 1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide;
Methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[{N-[2,2-dimethyl-3-
(methylamino)propanoyl]-L-valyl}(methyl)amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate; 10
Methyl N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-{[( 2S)-2-methylpiperidin-2-yl]carbonyl}-L-valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalaninate;
Methyl N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5- 15
methyl-4-[methyl(N-{[(2R)-2-methylpiperidin-2-yl]carbonyl}-L-valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalaninate;
N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-{[(2S) )-2-methylpiperidin-2-yl]carbonyl}-L- 20 valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalanine;
N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-
4-[methyl(N-{[(2R)-2-methylpiperidin-2-yl]carbonyl}-L-
٤٠٦٩
-٨١-
valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalanine;
Methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-
fluoropyrrolidin-3-yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L- 5 phenylalaninate;
Methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-
fluoropyrrolidin-3-yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate; 10
(2S)-N-[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-
2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4- yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide; 15
(2R)-N-[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-
2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4- yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide; 20
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6- trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl -L-valinamide;
٤٠٦٩
-٨٢-
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl] amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N~2~-{[(3R)- 3-fluoropyrrolidin-
3-yl]carbonyl}-N-methyl-L-valinamide;
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1- 5
yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N~2~-{[ (3S)-3-fluoropyrrolidin-
3-yl]carbonyl}-N-methyl-L-valinamide;
(2S)-N-[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2- 10 yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1- oxoheptan-4-
yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide;
(2R)-N-[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2- 15 yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1- oxoheptan-4-
yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide;
N-2-{[(3R)-3-fluoropyrrolidin-3-yl]carbonyl}-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) )-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1- 20
(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-
oxoheptan-4-yl]-N-methyl-L-valinamide;
N-2-{[(3S)-3-fluoropyrrolidin-3-yl]carbonyl}-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) )-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-
٤٠٦٩
-٨٣-
(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(4- aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan- 5
4-yl]-N-methyl-L-valinamide;
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(4- aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide; 10
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[( 2S)-1-methoxy-1-oxo-3-(1,2,3,4-tetrahydroquinolin-6-yl)propan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl }-5-methyl-
1-oxoheptan-4-yl]-N-methyl-L-valinamide;
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3- 15
(4-aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1- oxoheptan-
4-yl]-N-methyl-L-valinamide;
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-
1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2- 20 methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl -1-oxoheptan-4-yl]-N-
methyl-L-valinamide;
N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-fluoropyrrolidin-3-
yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-
٤٠٦٩
-٨٤-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalanine;
N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3S)-3-fluoropyrrolidin-3-yl]carbonyl}- L-valyl)(methyl)amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L- 5 phenylalanine;
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2R,4S)-4-carboxy-1-phenylpentan-2 -yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide; 10
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-(bicyclo[1.1.1]pent-1-ylamino)-1-methoxy -2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1- 15
methoxy-3-{[(1R)-2-methoxy-2-oxo-1-(1-phenylcyclopropyl)ethyl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-
methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(1S)-2-methoxy -2-oxo-1-(1- 20
phenylcyclopropyl)ethyl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-
methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(1R)-1-[(7R)-
bicyclo[4.2.0]octa-1,3,5-trien-7-yl]-2-methoxy-2-oxoethyl}amino)-1-
٤٠٦٩
-٨٥-
methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(1S)-1-[(7S)-bicyclo[4.2. 0]octa-1,3,5-trien-7-yl]-2-methoxy-2-oxoethyl}amino)-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy -5-methyl-1- 5
oxoheptan-4-yl]-N-methyl-L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1 -methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl- L-valinamide; 10
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(1S)-1-[(7R)-bicyclo[4.2. 0]octa-1,3,5-trien-7-yl]-2-methoxy-2-oxoethyl}amino)-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy -5-methyl-1-
oxoheptan-4-yl]-N-methyl-L-valinamide;
N,N,2-trimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)- 15
1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl- 1-oxoheptan-4-yl]-N-
methyl-L-valinamide;
N,N,2-trimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3- 20
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(R)-carboxy(1-phenylcyclopropyl)methyl]amino}- 1-methoxy-2-methyl-3-
٤٠٦٩
-٨٦-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
difluoro{2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(3R,4R,7S)-7-benzyl-15-{2-[(3,5- dimethyl-1H-pyrrol-2-yl-kappaN)methylidene]-2H-
pyrrol-5-yl-kappaN}-4-methyl-5,8,13-trioxo-2-oxa-6,9,12- 5
triazapentadecan-3-yl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamidato}boron;
2-methyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo -3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl ]-N- 10
methyl-L-valinamide;
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[{N-[(3-aminooxetan-3-
yl)carbonyl]-L-valyl}(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-
phenylalaninate; 15
2-methylalanyl-N-{(3R,4S,5S)-1-[(2S)-2-{(3R,4R,7S,12S)-7-benzyl-14-[3-chloro-4-(propan) -2-yloxy)phenyl]-4-methyl-12-[4-(8-methylimidazo[1,2-a]pyridin-2-yl)benzyl]-5,8,14-trioxo-2,9-dioxa -6,13-diazatetradecan-3-yl}pyrrolidin-1-yl]-3-methoxy-5-methyl-1-
oxoheptan-4-yl}-N-methyl-L-valinamide; 20
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-{[4-(5-
fluoro-1,3-benzothiazol-2-yl)-2-methylphenyl]amino}-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1 -yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
٤٠٦٩
-٨٧-
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[( 2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]- N-
methyl-L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(1H- 5
indol-3-yl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1 -oxoheptan-4-yl]-
N-methyl-L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -{[(2S)-1-oxo-3-phenyl-1-(prop-2-en-1- 10
yloxy)propan-2-yl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide;
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1 -oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N- 15 methyl-L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -({(2S)-1-oxo-3-phenyl-1-[(1H-1,2,3-triazol-4-ylmethyl)amino]propan-2-yl}amino)propyl]pyrrolidin-1-yl }-5-
methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide; 20
N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -{[(2S)-1-oxo-3-phenyl-1-(prop-2-yn-1-ylamino)propan-2-yl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1 -
oxoheptan-4-yl]-N-methyl-L-valinamide;
٤٠٦٩
-٨٨-
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(1H-imidazol-4- yl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-
methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(4- 5
hydroxyphenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide;
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1R)-1-carboxy-2-phenylethyl]amino }-1-methoxy-2-methyl-3-10
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide;
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3 -oxo-3-{[(2S)-1-oxo-3-phenyl-1-(piperazin-1-yl)propan-2-yl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1 -oxoheptan-4- 15
yl]-N-methyl-L-valinamide;
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-amino-3 -phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide; and 20
2-methyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6- trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide.
٤٠٦٩
-٨٩-
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Laith Yatov R1 is
<img file="SA4069B1_D0121.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Laith Yatov R1 is
<img file="SA4069B1_D0122.tif" />
5 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
The thief, Laith Yatov R1 is
<img file="SA4069B1_D0123.tif" />
In certain embodiments, the L is culminated to any of the ranks of the series L, T and the corresponding metabolites, where Y is C2-C20alkylene.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
10 Morocco, Lith Ytuv Y is -CH2)p)-; And p is 1-10.
In certain embodiments, the name is culminated in any of the different ranks and definitions, so that p is 1. In certain embodiments, the name is culminated in any of the different ranks and definitions In this case, p is 2. In certain embodiments, it culminates in any of the ranks and rogue definitions, so that p is 3. In certain embodiments,
15 The definition of the term refers to any of the above-mentioned ranks and definitions, so that p is 4. In certain embodiments, the definition of the term refers to any Salaries, taxes, and fraudulent tariffs, so that the p is 5. In certain incarnations, the highest number of names is culminated in any number of ranks.
٤٠٦٩
-٩٠-
The lineage of God and the rogue definitions, so that p is 6. m certain embodiments, culminates in any of the ranks of the lineage of the gods and rogue definitions, so that p is 7. m certain embodiments, The definition of the term refers to any of the above-mentioned ranks and definitions, so that p is 8. In certain embodiments, the definition of the term refers to any Salary pay for electricity bills and tariffs 5, Leith If p is 9. In certain embodiments, the top of the world is culminated in any number of ranks.
The dynasty of God, and the rogue denunciations, so that p is 10.
In certain embodiments, the Lam is culminated to any of the series Y, T and the above-mentioned metabolites, where Y is C2-C20 heteroalkylene.
In certain embodiments, the process of Y is culminated in any of the following 10 series of ranks, terms and definitions, such that Y is –CH2CH2O)qCH2CH2)–; And q is 1-10.
In certain embodiments, the name is culminated in any of the different ranks and definitions, so that q is 1. In certain embodiments, the name is culminated in any of the different ranks and definitions. 2. In certain embodiments, 15 in certain embodiments, in any of the ranks of the dynasty and rogue definitions, in certain embodiments, in certain embodiments, 15 in all ranks. The lineage of the letter and the accompanying definitions, so that q is 4. As for certain incarnations, the letter of the word is directed to any salary file, the question of the letter, and the rogue definitions, so that q is 5. m of certain embodiments, the letter of the letter is crowned To what extent are the salaries, prices and tariffs applicable? 6. In certain embodiments, the name of God is assigned to any of the ranks of the lineage and rogue definitions, so that q is 7. In certain embodiments, 20 of the ranks are assigned to any of the ranks. The lineage of the letter and the accompanying definitions, so that q is
<p dir="rtl">8. As for certain incarnations, the letter of the word is directed to any file of salaries, the question of rogue letters and definitions, so that q is 9. It is crowned by the letter of the word To what extent are the salaries, prices and tariffs applicable? Q, Lith Yatuv q is 10.</p>
٤٠٦٩
-٩١-
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatov Z is
<img file="SA4069B1_D0124.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatov Z is
<img file="SA4069B1_D0125.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatov Z is
<img file="SA4069B1_D0126.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatov Z is
<img file="SA4069B1_D0127.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<img file="SA4069B1_D0128.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<img file="SA4069B1_D0129.tif" />
٤٠٦٩
-٩٢-
In certain embodiments, the R7 culminates in any of the series of ranks, R, and rogue definitions, such that R7 is F or Cl; And h is 4 or 5.
In certain embodiments, the letter R7 culminates in any of the ranks of the lineage of L, R, and rogue definitions, whereby R7 is F; And h is 3, 4 or 5.
5 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatuv R7 is F; And h is 5.
In certain embodiments, the number of names culminates in any of the ranks of the series L, Z, and different definitions, whereby Z is NH2-.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
<p dir="rtl">10 Morocco, Lith Yatuf G is Cl. In certain embodiments, the letter of the word is culminated in any of the following grades, letters, and definitions, such that G is Br. With certain incarnations, the disappearance of the word leads to any of the orders of the lineage, the literal meaning, and the different definitions, so that G is I.</p>
In certain embodiments, the number of salaries is culminated in any of the different grades, grades, and rogue definitions, so that the salary is selected from the set of salaries in Table 18(b).
<p dir="rtl">15 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.</p>
Deception, so that the salary is selected from the group consisting of:
<p><sup>H2NO6ON</sup>HO<sup>HN ON</sup>O.O<sup>N</sup>O.O<sup>HN</sup></p>
<sup>O.O</sup>NS
،
H2NO<sub>6</sub><sup>O</sup>N<sub>HO</sub><sup>H</sup>N<sup>O</sup>N<sub>O.O</sub>N<sub>O.O</sub><sup>H</sup>N
،
<p>H2N<sub>O6</sub><sup>O</sup><sub>N</sub><sup>H</sup>N<sup>O</sup><sub>N</sub>N<sup>H</sup>N</p>
٤٠٦٩
-٩٣-
H2N<sub>O</sub><sup>O</sup><sub>N</sub><sup>H</sup>N<sup>O</sup><sub>N</sub>N<sup>H</sup>N
6 H<sub>OOOOO</sub>
<img file="SA4069B1_D0130.tif" />
<sup>H2N</sup>O<sup>O</sup>N<sup>H.N.O</sup>N<sup>NHN</sup>
<sup>6 H</sup>OOOOO
<img file="SA4069B1_D0131.tif" />
H2N<sub>O</sub><sup>O</sup><sub>N</sub><sup>H</sup>N<sup>O</sup><sub>N</sub>N
<sup>6</sup>OOOOO
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
5 Morocco, Lith Yatov Z is
<img file="SA4069B1_D0132.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatov Z is
<img file="SA4069B1_D0133.tif" />
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatov Z is
<img file="SA4069B1_D0134.tif" />
10 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Moroccan, Leith Yatov Z is NHL-.
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
Morocco, Lith Yatov Z is
H
L
<img file="SA4069B1_D0135.tif" />
O
O
٤٠٦٩
-٩٤-
With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.
O
L<sup>H</sup>N
O
Morocco, Lith Yatov Z is<sup>NH</sup>2 .
In certain embodiments, the letter L is culminated in any of the ranks of the lineage of L, L, and rogue definitions, such that L is -(H(C).
<p dir="rtl">5 With certain embodiments, the meaning culminates in any of the ranks, meanings, and definitions.</p>
Morocco, Leviathin L is a specific antibody that contains a specific antigen for the treatment of ovarian cancer, such as oregovomab (OVAREX). Chimeric IgG2a antibody for the treatment of colon cancer, such as edrecolomab (PANOREX®);
EGFR IgG in order to treat epidermal growth factor positive cancers, such as head and neck cancer,
<p dir="rtl">10 For example, cetuximab (ERBITUX®) The IgG1 antigen is related to the human antigen.</p>
Treatment of chronic lymopathy (CLL) such as alemtuzumab® (CAMPATH I/H; SMART ID10). Tumor treatment
<p dir="rtl">15 I don't care about Hodgkin; 131I Lym-1 (ONCOLYM) is an antibody against HLA Dr10, a marker for the treatment of Hodgkin lymphoma; CD2 is due to a genetic trait for the treatment of Hodgkin's disease or a non-Hodgkin's lymphoma, such as ALLOMUNE®; labetuzumab (CEACIDE®) is a human-derived antibody against CEA for the treatment of colorectal cancer; bevacizumab (AVASTIN®) is</p>
<p dir="rtl">20 Mab VEGF-A T-Vegf-A Distinguished for the Administration of the Advancement of the Department of the Hitton, the Cross, the Cross, the Talk, or the lung; Ibritumomab tiuxetan (ZEVALIN®) is an anti-replication antibody</p>
٤٠٦٩
-٩٥-
Add a comment GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK CD20 gland for your processor. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than Lyme Lyrics Lyrics Lyme Lyrics Lyrics Lyrics Lyrics GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFGFFFGFGFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF ofatumumab (ARZERRA®) is an antigenic antibody against CD20. I would like to treat Lotemia for chronic illness; (panitumumab® (VECTIBIX).
In other words, the fodder of your body and your children’s immune system is against EGFR golovov;
<p dir="rtl">5 rituximab (RITUXAN®) is a chimeric anti-CD20 antibody.</p>
Treatment of chronic acute lymphoma and non-Hodgkin lymphoma; (Tositumomab (Bexxar) Hodgkin;
<p dir="rtl">10 Genetic antibody against CTLA4 for the treatment of skin cancer; gemtuzumab</p>
inotuzumab and ozogamicin
Embodiment of another meaning, L comprising various antibodies against the opposite antibodies 13-I, including opposite antibodies against 13-I Used in the treatment of cancer, such as antibodies against IL-13Rα2.
<p dir="rtl">15 It also embodies two other meanings, comprising L of selected additive bodies and several other opposite bodies.</p>
Notch, including antibodies against Notch used in the treatment of cancer.
In certain embodiments, the antibody L is attached to the linker via sulfur bonds or via sulfur-sulfur bonds.
The last aspect of the compound refers to a tracer that contains an antibody and a drug that contains any of the following compounds:
Jean, the most important, is the most honest, to the use of the arms of the body, and the subject of the body, and the one who is the one who has been said.
In certain embodiments, the drug is subjected to any of the antibody-conjugating substances and the drug.
The LTR strain and the rogue antigens, so that the ordered antibody is covalently bound.
٤٠٦٩
-٩٦-
In certain embodiments, the drug is attached to any of the antibody-drug conjugate materials, the strain and definitions above, so that the compound can be navigated to a new location Find out the missing body and the wrong drug from the group consisting of the ranks of Table 18(b). (:
<sup>H</sup>2<sup>N</sup>
10
15
In certain embodiments, the term is derived from any of the antibody-drug conjugate substances of the strain and the following definitions, such that the antibody-drug conjugate substance includes 2, 3, 4, 5, 6, 7, 8. 9 or 10 salaries from the farms.
In certain embodiments, the tracer refers to any of the antibody-drug coupling materials, the corresponding definitions, so that it comprises a term for coupling the antibody and drug to the strain Up to 3 or 4 mattresses.
The birth of the antibody (Ab) (The Antibody Unit)
٤٠٦٩
-٩٧-
It is a declaration, the term is an antibody (ANTIBODY) or "AB" (here it is taken by the obsession of the bonds and the privatization of the discipline is to the one who is the one who is the one who is the one who is the one who is the one who is the one. The subsequent subordination of the private, approved by the sublime The specificity (for example, the multiplicative body of the two-specificity), and the two opposite bodies of the multiplicative body appear.
<p dir="rtl">5 Desired biological activity. So, while explaining certain aspects of the difference described here, in the case of conjugation of a drug with an antibody, it is an additional picture However, the division of an antibody from a source may be replaced by anything that is specifically associated with, creates a known form, or is associated with in the future. A antigen, or part of another receptor, generated from a set of distinct derivatives. For example, by twisting an antibody, conjugates may twist on a target molecule that binds to, complexes with, or interacts with.</p>
<p dir="rtl">10 A receptor, antigen or other receptor part of a cell population that may have been modified therapeutically or otherwise biologically. As an example of this, the molecules include proteins, a small molecule called glucose. Polypeptide or glycoproteins, lectins, peptides, peptides, vitamins, nutritional transport molecules (e.g., transferring), or any other molecule or protein material Khalifa . In certain aspects, the antibody or other target molecule acts to communicate</p>
<p dir="rtl">15 The drug belongs to a group of multiple target successors, which are linked to an antigen or any other target molecule.</p>
F. The majesty, the majesty, the direction of the one, the one, the SULFUR) Carboxyl, Carbonyl or Hydroxyl Grands of the Gs. and Nitrogen
<p dir="rtl">20 Embodiments, such as a primary or secondary amino group of the antibody. Such variant may exist on the antibody due to the natural antibody, for example a naturally occurring antibody, or may be introduced into the antibody from The appropriate amendment.</p>
In the following embodiments, the antibody is attached to a sulfhydryl group and the antibody is linked through a sulfur link to the sulfhydryl group.
٤٠٦٩
-٩٨-
المرال المريل المريل المر الم الم الم الم الم الم الم ال afterhest body is seen by the lysine. ػ
,pentafluorophenyl
And p-nitrophenyl esters (which form amide bonds, which are formed by nitrogen, thus generating
<p dir="rtl">5 Antibody and carbonyl.</p>
On the other hand, the antibody generation requires a lysine residue that can be chemically modified by the introduction of a sulfhydryl group. The simple factors that may be used to modify lysines include: گگافد, -N-succinimidyl S
SATA (acetylthioacetate) and 2-Iminothiolane hydrochloride (a drying agent)
<p dir="rtl">10 )Traut</p>
In another embodiment, the antibody may have a parent carbohydrate group or trace that can be chemically modified to yield a sulfhydryl group or trace.
In another embodiment, the antigen may contain a carbohydrate group or be oxidized to form an aldehyde group (see, for example). For example,
The corresponding aldehyde is Laguzza, et al., 1989, J. Med. Chem. 32(3):548-55 15
It is possible to do so. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK He is the one who is the one who is the one who is the one who connects him In this case, for example, hydrazine and hydroxylamine. The original proteins are used to replace different proteins. Ghadad Al-Aqqafakqaqir Yafiqafat Asfafaqfaqhafaqfaqam
Coligan et al., Current Protocols in Protein Science, vol. 2, John Wiley &
20 (2002) Sons (incorporated here: swaying).
When the genes include a non-immunoconductive protein, polypeptide, or peptide conjugate from the antibody, the non-immunogenic protein, polypeptide, or peptide conjugate is added, to create a compound , transferrin, factors that increase my knowledge (,) Bombesin, gastrin, EGF peptide releases gastrin, a naturally derived growth factor, IL-2.
٤٠٦٩
-٩٩-
<p dir="rtl">6, soluble growth factors (“TOP”), such as TGF-α and TGF-β, penile growth factor (“VGF”), insulin, insulin, lectins, somatostatin II, and apoprotein from low-fat protein.</p>
The derived antigens are heterogeneous groups of 5 molecules The blood serum is from immunized yuan. Antibodies are homologous groups of antibodies to a specific antigen (e.g., antigen for Mycobacterium leukemia, antigen). Ghadad Mhadjadjad yrussovlovkm, Mollykvad mdjadgadjad metroplovkla gram, peptide, protein, carbohydrate, chemical substance, nucleic acid, or parts M, L (. A replicon antibody (mAb) can be labeled with a antigen of interest using any known technique in the production process.
<p dir="rtl">10 Antibody molecules from cultured cell lines.</p>
The additive bodies of the human copying machine are added, to wrap a new world, the added bodies of the human copying machine. In other words, replication antibodies similar to the human trait, an antibody fragment, or chimeric replication antibodies. Human copies may be manufactured by any of several techniques known to humans, for example:
Teng et al., 1983, Proc. Natl. Acad. Sci. USA. 80:7308-7312; Kozbor et 15 al., 1983, Immunology Today 4:72-79; and Olsson et al., 1982, Meth.
Enzymol. 92:3-16.
It is possible that the additive body also contains the duality of privacy. If bispecific antibodies are described, their names are defined and discussed later.
<p dir="rtl">20 An antibody may contain a functionally active part, derived from or similar to the antibody, which</p>
Particularly immunologically associated with target cells (eg, cancer cell antigens, viral antigens, or antigens) or antibodies Another thing that is connected to the cells of the tumor or intercellular tissue, the peritoneum, will be functionally activated. active means that the part, derivative or similar is capable of producing antibodies against the same pattern.
٤٠٦٩
-١٠٠-
The origin of the antigen of the antigen is the derivative of the antigen derived from the same part, derivative, or similar part, which is considered as the same. In particular, it is possible to enhance the productivity of the antibody from the complete type of the immunoglobulin molecule, but rather, the CDR framework and arrangements, which consist of the CDR arrangement, which specifically recognizes the antigen. To determine which CDR configuration binds which antigen,
<p dir="rtl">5 The use of synthetic peptides that bend CDR sequences can be tested for binding to antigen by any known binding test method. (e.g., BIA test), for the description of CDR arrangements, see, for example:</p>
Kabat et al., 1991, Sequences of Proteins of Immunological Interest, Fifth
Edition, National Institute of Health, Bethesda, MD.; Kabat E et al., 1980,
J. Immunology 125(3):961-969. 10
The other added additions are added to the envelope part of the added objects, for example, in order to complete part 2 ('F(ab), parts of Fvs, Fab, red chain antibodies, binary bodies, triple bodies, Quadrosomes, scFv-FV, scFv, or any other molecule for the specificity of the antibody.
<p dir="rtl">15 In addition to the synthetic additive bodies, such as the replicative additive bodies</p>
Hybrids and human variants, including both human and non-human variants, which can be classified using standard synthetic DNA techniques, constitute useful antibodies. A hybrid antibody is a molecule that is derived from different parts of different types of antigens, for example, one that has a variable region derived from constant regions of human immunoglobulin globulin. My children and I are the original copyists.
<p dir="rtl">20 (See, for example, 4816567; According to the National Security Council No. 4816397, which are combined herein, the human toxin-resisting antibodies are antibody molecules from non-human species that have a specific area Complementary glands or traces (CDRs) of non-human species and framing regions of the globulin molecule. Adam. (Look, as an example, I am looking forward to seeing you, No. 5585089, and I am looking forward to it.) Production</p>
<p dir="rtl">25 Antibodies Replicating copies of the human and chimeric antigen by means of synthetic DNA techniques</p>
٤٠٦٩
-١٠١-
Known to others, for example, using methods described in World Publication No. WO 87/02671; Published in Arabic, European No. 0184187; Published with a copy of the European Union No. 0171496; Published by your partner in Europe, No. 0173494; Mansour, Dolphin No. WO 86/01533; If you want to see your secrets, please visit the number 4816567; Menshevik, where you can see the most beautiful Europeans, the thinnest of Europe 5 012023;
Berter et al., 1988, Science 240:1041-1043; Liu et al., 1987, Proc. Natl. Acad. Sci. USA 84:3439-3443; Liu et al., 1987, J. Immunol. 139:35213526; Sun et al., 1987, Proc. Natl. Acad. Sci. USA 84:214-218; Nishimura et al., 1987, Cancer. Res. 47:999-1005; Wood et al., 1985, Nature 314:446-449; and Shaw et al., 1988, J. Natl. Cancer Inst. 10 80:1553-1559; Morrison, 1985, Science 229:1202-1207; Oi et al., 1986, BioTechniques 4:214; US Pat. No. 5,225,539; Jones et al., 1986, Nature 321:552-525; Verhoeyan et al., 1988, Science 239:1534; and
Beidler et al., 1988, J. Immunol. 141:4053-4060;
<p dir="rtl">15 Many of them merge here and you can meditate.</p>
Human antigen antibodies are highly desirable in India and can be produced using genetically modified strains that are not available. It is able to express human heavy chain and heavy chain genes within the culture. Genetically modified genes are characterized by a naturally occurring selected antigen, for example, a strand or section of a 20-fold polypeptide. The sleuths are lining up against the world's frogs, the Adi-Academies of the clones directed against the world's frogs. ghadad
Using traditional chimeric tumor technology. The genetically engineered genes are rearranged in human bone globulin cells, which are housed in genetically modified cells during B-cell differentiation, and are then further developed. Alternative gender and physical condition. Using this technique, it is possible to produce therapeutically specific IgG, IgM, IgA and IgE antibodies. For an overview of the technique of producing antibodies
Lonberg and Huszar, 1995, Int. Rev. Immunol. 13:65-93 25 Adamia, see
٤٠٦٩
-١٠٢-
A technical description of this technology, the production of additive human bodies and artificial additive bodies For human replication and production of these antibodies, see, for example, US patent number 5625126; 5633425; 5569825; 5661016; 5545806; Every aspect of it is integrated into the meditation. Other human antibodies may be accessed commercially, for example,
Abgenix, Inc. (now Amgen, Freemont, Calif.) and Medarex (Princeton, 5 .NJ)
Human antibodies are generated following the recognition of a selected epitope using a technique referred to as guided selection. This is a method that uses a non-human copying antibody, e.g., a nuclear antibody, to guide the selection of a human antibody that recognizes the NS 10 epitope (see, e.g., 12:899, Jespers et al., 1994, Biotechnology 903 (. It is also possible to produce the embrace of the human, the human being, with a variety of techniques, a variety of technology.
Hoogenboom and Winter, 1991, J. Mol. Biol. 227:381; Marks et al., 1991, J. Mol. Biol. 222:581; Quan and Carter, 2002, The rise of monoclonal antibodies as therapeutics, In Anti-IgE and Allergic Disease, 15 Jardieu and Fick, eds., Marcel Dekker, New York, NY, Chapter 20, pp.
427-469.
In other embodiments, an antigen is a protein fusion of an antigen, or a functionally active part of, for example, an antibody fused to an antibody through covalent bonds 20 (e.g., peptide bonds), at either N-terminal or C-terminal To arrange an amino acid from another protein (or at least 10, 20 or 50 amino acids from another protein), which constitutes an antibody. In a simple way, the flow of the antigen or part of another protein at the N end of the constant control domain.
٤٠٦٩
-١٠٣-
Antibody antibodies contain analogues and derivatives of the antibody that are modified, that is, by covalent attachment to a type of molecule, as long as the covalent attachment allows the antibody to remain The specificity of immunity binding its antigen. For example, but not exclusively, the multiplicity of companies and representatives of the multilateral body adds 1000000000000000000000000000000000000000000000mg
<p dir="rtl">5 Amidation, phosphorylation, pegylation, acetylation, glycosylation, derivatization by known chemical/disruption groups, protein cleavage, specialization A cellular antibody gland or other protein, etc. It is not possible to see any technical modifications with the technical moderation of the technology of the technique Lebanon, Formylation, the fee does not include the presence of tunicamycin, etc. In addition, the similar or</p>
<p dir="rtl">10 The derivative may contain an unnatural amino acid or a defect.</p>
Modifications can be made to antibodies (eg, substitutions, modifications or additions) to any amino acid residues that interact with Fc receptors. Extensive modifications can be made to residues. Amino acids are cross-linked to interact with each other. between the anti-Fc control domain and the FcRn receptor (see, for example, International Publication No. 97/34631 WO, incorporated herein
<p dir="rtl">15 (.</p>
Immune-specific antibodies to a cancer cell antigen may be obtained commercially or produced by a method known to the skilled master, for example, tailoring techniques or techniques for demonstrating the synthesis of a cancer cell antigen. Yes. The class contains many nutritional supplements The formula for synthesis of a nucleotide, based on methylene methylene methylene, is based on the GenBank data base or base Similar information section,
<p dir="rtl">20 Publications or literature, or by routine copying and arrangement.</p>
In addition to special embodiment, it is possible to use additional materials known for the fiberglass processor. Rataf. Immune-specific antibodies to a cancer cell antigen may be obtained commercially or may be produced by a method known to those skilled in, for example, synthetic demonstration techniques. Immune-specific antibodies detect a nucleotide arrangement, for example, from a base
<p dir="rtl">25 GenBank data or similar data base, a copy of a literature, or by transcription and arrangement</p>
٤٠٦٩
-١٠٤-
Routinem. Examples of non-specific antibodies for treating cancer include OVAREX®, which is a synthetic antibody for treating ovarian cancer; PANOREX® (Glaxo Wellcome, NC) is a synthetic antigen called IgG2a for the treatment of colorectal cancer. Cetuximab ERBITUX® (Imclone Systems Inc., NY)
<p dir="rtl">5 The vena, in the year Persistent general stages, such as the rituals of the Ars and the necks; MedImmune, Inc., Vitaxin® (Med Immune) Leukosite MA (CAMPATH I/H®) is a human immunoglobulin IgG1 antibody for the treatment of chronic lymphoma (CLL); (Protein SMART ID10</p>
<p dir="rtl">10 Design Labs, Inc., CA, which provides a DR antibody against HLA for the treatment of cancer</p>
Hodgkin glands; ONCOLYM® (Techniclone, Inc., CA)
The yearly ػ ػ ػ A F. BioTransplant®, CA (ALLOMUNE)
<p dir="rtl">15 CD2 is a drug used to treat Hodgkin's glandular cancer or lymphoma Hodgkin's language; Immunomedics, NJ (CEACIDE®), which means an antibody against CEA used for human use. How much is needed for your treatment? AVASTIN® (Genentech/Roche, CA), which consists of an anti-VEGF-A mAb that is suspected of being safe.</p>
Advantageous for the treatment of the crab, the colon, the colon, the telegraph, or the lung; ®(Spectrum ZEVALIN
<p dir="rtl">20 (Pharmaceuticals, NV), which provides an anti-CD20 antibody to treat cancer.</p>
Non-Hodgkin lymph nodes; ARZERRA (GSK, UK®)
Anti-CD20 antibody for the treatment of chronic lymphoma; VECTIBIX® (Amgen, CA), which is an antibody that has anti-EGFR replication antibodies for treatment.
Colon cancer; RITUXAN® (Genentech/BioGen, CA) which is called “your body”
<p dir="rtl">25 Chimeric anti-CD20 antibody for the treatment of chronic non-Hodgkin lymphoma and non-Hodgkin lymphoma; BEXXAR® (GSK, UK)</p>
٤٠٦٩
-١٠٥-
Alade anti-CD20 transcription for the treatment of non-Hodgkin lymphoma; HERCEPTIN® (Genentech, CA) is an anti-HER2 receptor transcription antibody for the treatment of breast and stomach cancer; (BMS, NJ) YERVOY®, which consists of an antibody that replicates human blood against CTLA4 for the treatment of skin cancer; (Wyeth/Pfizer®, MYLOTARG)
<p dir="rtl">5 (NY), which is a CD33-replicating antigenic antibody conjugated to calicheamicin for the treatment of skin cancer of the skin; inotuzumab ozogamicin (Wyeth/Pfizer, NY) It is a recombinant antibody that qualifies for human safety. Anti-CD22 adjuvant calicheamicin for the treatment of skin cancer, skin cancer and non-Hodgkin lymphoma.</p>
<p dir="rtl">10 In another particular embodiment, antibodies against IL13, including an antibody, can be used.</p>
Antibodies against IL13 are used to treat carcinomas.
Another special embodiment includes anti-Notch antibodies, including anti-Notch antibodies used in the treatment of cancer.
In order to identify potential uses of cell lines for the diagnosis and treatment of cancer, 15-cells sought to identify transmembrane or otherwise tumor-containing polypeptides that specifically appear on the surface of the antigen(s) type(s). A cancerous cell compared to a non-cancerous cell(s) Normal or affected, these tumor-associated polypeptides appear to a much greater extent on the surface of cancerous cells than on the surface of non-cancerous cells. Identification of tumor-staining cell surface antigen polypeptides has led to an increased susceptibility of targeted cancer cells in particular to destruction by antibody-based therapies.
Classification of the ranks of antibody-drug conjugates, from...
The components and couplings are manufactured using advanced manufacturing procedures as shown in the representative section.
٤٠٦٩
-١٠٦-
As described in detail below, salaries can be cross-coded and different ring codes are created using a cross-section of a link that has a specific location for linking to the salary.
The link
The link (some of the fibers here are referred to as the link question ([linker])) is 5 in the same order It can be used to connect a drug and an antibody to activate a drug-antibody-coupled antibody (ADC) to create an antigen For example, immunoglobulins directed against FSA antigens have not been created The creation of nanoparticles allows for the convenient delivery of cytotoxic drugs into tumor cells.
In the worst embodiments, the link has the formula:
<img file="SA4069B1_D0136.tif" />
<p dir="rtl">10 Or Laith</p>
YHFO C2-C20 alkylene or C2-C20 heteroalkylene; C3-C8
<p>-Cl-C10alkylene-arylene-,-C3-C8heterocyclo-,-arylene-,carbocyclo-</p>
<p>-,-Cl-Cl0alkylene-(C3- C8carbocyclo)-,-arylene-Cl-Cl0alkylene-,</p>
<p>-Cl-Cl0alkylene-(C3-,(C3-C8carbocyclo)-Cl-C10alkylene-</p>
15 -(C8heterocyclo, or -C3-C8 heterocyclo)-Cl-Cl0alkylene)-;
Z is
٤٠٦٩
-١٠٧-
<img file="SA4069B1_D0137.tif" />
O
R10<sub>O</sub>
، ،
<img file="SA4069B1_D0138.tif" />
<img file="SA4069B1_D0139.tif" />
2
10
15
R7 is selected on a multi-liter basis from the composing group of CN, NO2, Br, I, Cl, F and CF3;
R10 HCFC-Cl-aryl,-C3-C8carbocycle,-Cl-Cl0alkyl,hydrogen-
arylene-Cl-,-Cl-Cl0alkylene-aryl,-C3-C8heterocyclo,C10heteroalkyl--(C3-C8 carbocyclo)-Cl-,-Cl-Cl0alkylene-(C3-C8carbocyclo) ,Cl0alkyl Cl-Cl0alkylene-(C3-C8heterocyclo) ), Cl0alkyl-, and -(-(C3-C8 heterocyclo
Cl-Cl0alkyl, an optionally substituted aryl on R10 containing an aryl m R7[h]; And
H is 1, 2, 3, 4 or 5.
The ADC connects the antibody to the antibody.
On the other hand, the second section is inserted from the link generator, which has an eighth position, for example, a trophozoite group that interacts with a nucleus group located on the body - Antigen (for example, antibody). E. Nuclear groups The material on the antibody includes sulfhydryl, hydroxyl, sulfhydryl and amino groups. The heteroplasmy of the nucleophilic group interacts with the antibody with a telomeric group at the junction site and forms a ligand This is an important cost for you and for the recipe. Useful endothelial groups include, without limitation, maleimide and haloacetamide groups. The nucleotide-binding group provides a suitable site for antibody binding.
٤٠٦٩
-١٠٨-
In another embodiment, the linker has a nucleophilic group attached to the tautotroph group located on the antibody. The necessary cover-filling kits found on the double-sided body are added, to be wrapped God willing, the groups of aldehyde and ketone carbonyl. It is possible to interact with the heterogeneous group of the nucleus from a connected generator
<p dir="rtl">5 A group made to wrap around the counterfeit body and includes the important connections of the counterfeit body. Suitable combinations for the core located on the link base include:</p>
hydrazine carboxylate, thiosemicarbazone, hydrazine, amino, oxime
and arylhydrazide. The tetrophic group on an antibody provides a suitable site for binding to generate a link.
<p dir="rtl">10 These functional groups are also the most important parking spots for the country you are accessing here.</p>
Carboxylic acid, or activated esters, react with the matrix to functionalize the amide link. It is possible to change the salaries based on the hidden envelope peptide A peptide is linked to two or more amino acids and/or parts of the peptide. Such peptide bonds can be cleaved, for example, according to the method of liquid phase preparation (see, e.g.,
Schroder and Lubke, "The Peptides", volume 1, pp 76-136, 1965, 15
Academic Press) is a well-known field of peptide chemistry.
It is described as a description of the Adenial thickener, and it can be used to connect the rings using a section of the joint file The location of the link is arranged by selecting a speed and inserting another section from the link's origin to the location of the opposite body. Wherever the sides are born, the link can be born with a position that has been established for each group.
<p dir="rtl">20 A nucleophile group is a nucleophilic group present on the surface of an antibody, such as an antibody. The electrophilic group provides a suitable site for antibody binding. The groups that are necessary for the nucleus found on the antibody include the following compounds: sulfhydryl, hydroxyl and amino groups. The heterochromatin group is treated with a group of hemoglobin cells called the antigen group, which is used to treat the antigenic group. The connection unit creates important connection connections to and from the connection unit. F</p>
٤٠٦٩
-١٠٩-
The total number of packages is added to the packages in India maleimide
haloacetamide
In another embodiment, the link generator has a function location in a set of nuclei given above the set of the set of manifolds given above The gland of the wrinkled body. If the group is in charge
<p dir="rtl">5 To ensure that the opposite body is located in a suitable position for connection to the connection terminal. The bundles of grommets placed on the double frame are added together to wrap the whole frame In India, the combination of aldehyde and ketone carbonyl. The heteroplasmy of the nucleophilic group of the linker can interact with the nucleophilic group on the antibody and form covalent bonds with the antigen. Suitable combinations for the core located on the link base include:</p>
<p dir="rtl">10 hydrazine carboxylate, thiosemicarbazone, hydrazine, amino oxime, and arylhydrazide.</p>
"-mc" is known as "Maslaf". Therefore, “-MalC” means something to you.
<img file="SA4069B1_D0140.tif" />
MTKKKKKKKKKKKKKKKKKKKKKKKKKKKKUK “-mcValCitPABC” is used accordingly GFGF
<img file="SA4069B1_D0141.tif" />
Indicates “MalCValCitPABC-” 15
As used here, “-MalPegXC2” refers to
As used here, “-AmPegXC2” refers to...
<img file="SA4069B1_D0142.tif" />
<img file="SA4069B1_D0143.tif" />
٤٠٦٩
-١١٠-
tumfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfk “-mcValCitPABCAmPegXC2” will help you very much.
<img file="SA4069B1_D0144.tif" />
<img file="SA4069B1_D0145.tif" />
<img file="SA4069B1_D0146.tif" />
You can use it here “-MalPegXC2ValCitPABC”
O
N<sub>OX</sub><sup>O</sup><sub>N</sub>H.N.O<sub>N</sub>O
NH
ONH2
Done
He is used
Here, F
<img file="SA4069B1_D0147.tif" />
2“BrAcPegXC2 indicates”
Done
He is used
Here, F
“-mv” refers to
<img file="SA4069B1_D0148.tif" />
Done
He is used
Here, F
-mb” refers to
<img file="SA4069B1_D0149.tif" />
Done
He is used
Here, F
“-me” refers to
<img file="SA4069B1_D0150.tif" />
Done
It is used here, f
“-MalC6” indicates
٤٠٦٩
-١١١-
MF “-PF”. “PCOPegXC2ValCitPABC”
FO
F
<img file="SA4069B1_D0151.tif" />
FO F
F
NH
ONH2
F
<img file="SA4069B1_D0152.tif" />
F.
F<sub>O</sub>
" “PFPCOPegXC2AmPegYC2”
F
H
N
X
O
If you are a user there, “PFPCOPegXC2AlaAlaAsnPABC” means “PFPCOPegXC2AlaAlaAsnPABC”.
F
F
<img file="SA4069B1_D0153.tif" />
tumfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfk CV “-PFPCOPegXC2” is very important to you.
F
F
<img file="SA4069B1_D0154.tif" />
<sup>O</sup>O<sub>X</sub><sup>O</sup>
F.O.<sup>F</sup>
F
It is used there, so “PFPCOPegXC2AmPegYC2PABC” stands for...
<img file="SA4069B1_D0155.tif" />
10
O
N
As used here, “-mcGly” refers to<sup>O</sup>
٤٠٦٩
-١١٢-
“-A”. zCOC2Ph4AmCOPeg2C2”
You are here to help you Yes, “-AzCOC2Ph4AmPeg1C1” heals you.
O
N<sup>HN</sup>O<sup>O</sup>O<sup>NH</sup>O<sup>HN ONHO</sup>
<sup>O</sup>O NH
H2NO
<p dir="rtl">5 Satably a ValcitPabc “</p>
.
Akhtarq M Transglutaminase
Each of the given expressions is arranged in a different intersecting array A cost-effective method: A polypeptide folded over an Fc or Fab folded, with a geometric structure that is folded over an Fc Yes
<p dir="rtl">10 Glutamine is an acyl donor (such as glutamine, peptide, or Gln). Glucolate (Q) or glutamine within the plant is synthesized (i.e., the ability to function acyl-donating covalent bonds from the presence of amine and transglutaminase) by engineering the polypeptide (e.g., through removal, reduction, Substitution, fluorescence of an amino acid, or any addition of a polypeptide, in the absence of a transglutaminase, provided that the arrangement includes an amine donor agent.</p>
<p dir="rtl">15 (For example, a single class molecule that includes or is linked to the amine above), in order to form a homogeneous group Coupling of a geometrically treated Fc-twisted polypeptide with the amine donor agent is particularly conjugated to an Fc-twisted polypeptide or a T-twisted polypeptide. Fab through the attachment attached to the acyl donor glutamine or glutamine within the product indicated/available/reactive. For example, different amounts of the above may be described as requested.</p>
20 Dolom Patent Serial No. PCT/IB2011/054899, whose twists and turns merge here swaying
٤٠٦٩
-١١٣-
Completely. المرال A certain embodiment, to delete the recovery of the dealer, the most horrible, the Polypeptide on the FC or the mortal on the processor, the processor, the engineering, it will be twisted, the glutamine, the Acyl, or the Glutamine, inside the faculty. Polypeptide engineering processor, and the Z, and transglutaminase is NH2.
<p dir="rtl">5 I have created a fixed area for the Kappa series human control domain</p>
In certain embodiments, the order of the MF may be connected to a different point of the side chain MF K188 in the fixed region The kappa control domain of the CLκ chain (complete Kappa chain numbered according to Kabat). K188 may also be called CLκ K80, When the human kappa constant region is drawn, for example, the definitions of the order are numbers: 1, 2, 3 and 4).
<p dir="rtl">10 For example, you may be charged a different salary, which is what you are required to apply for. A vision</p>
Find out more about the serial number 13/180,204, or WO2012/007896 English
Their contortions here sway in contemplation. In certain embodiments, to facilitate the creation of CLκ-K188 CLκ)
(K80, Ytv Z Hvu
<img file="SA4069B1_D0156.tif" />
; R7 Selects one to one of the machine in the group.
Composed of CN, NO2, Br, I, Cl, F and CF3; And h is 1, 2, 3, 4 or 5.
<p dir="rtl">15 In certain embodiments, to facilitate identification of K188 CLκ-K80, the TYPE Z is</p>
؛
In addition, the antibody-drug conjugates include an antibody, or antigen-binding sections of the antigen, that include a fixed kappa control domain covalently coupled to the antibody xin Their contribution is 100 K80, 20 Definition of Ranking No.: 1, Definition of Ranking No.: 2, Definition of Ranking No.: 3 or Definition of Ranking No.: 4 (Table
<p dir="rtl">1). In some aspects, a number of toxins may be covalently conjugated to K80 toxins.</p>
٤٠٦٩
-١١٤-
The child selects the lowest dynasty in the group consisting of 1.5 liters, 1.6 liters, 1.7 liters, 1.8 liters, 1.9 liters, and 2 liters The highest of them is from the group consisting of Lam 2, Lam 2.1, Lam 2.2, Lam 2.3, Lam 2.3. 2.4, Lawalm 2.5. In some aspects, it is necessary to protect people 2.
<p dir="rtl">5 If the toxin is located within the control field, a fixed fear of the antibody becomes desirable.</p>
To reduce, or eliminate, any interference with the binding of the Fc portion of the antibody to the Fc receptors (such as FcγR and FcRn) or the binding of the antibody to its target. Arbitrarily, Tracing the specific toxin from the Fc portion of the antibody may reduce its half-life. The antibody is the opposite body
And/or is able to interact with the immune system (effector function). If the toxin comes into contact with an area
<p dir="rtl">10 Variable heavy chain (VH) or variable heavy chain (VL) Antibody envelope The danger of the binding of the antibody to the conjugate.</p>
Moreover, when the CLκ-K80 protein disappears, the lysines disappear on the palpable surface - Other antibodies, some of which have a different reaction rate and pI, which may result in a heterogeneous sample of antibodies. Conjugated molecules can be released
<p dir="rtl">15 Inappropriate or irregular times, such as during circulation and before the effector fragment is delivered to the target by administering the antibody.</p>
In addition, there are several types of known polymorphisms of the V/A kappa series at position 45 and A/L at position 83 (differentiated). The three symmetrical kappa fixed cartridges (1) V45/L83 Km (definition of arrangement No.: 2), (1,2)A45/L83Km (Definition)
<p dir="rtl">20 Arrangement No.: 3), and (3) A45/V83 Km (Definition of Arrangement No.: 4). The ability to change the inputs at positions 45 and 83 m, Definition of Arrangement No.: 1, may be selected so that only one or two of them are available. The three polychaetes are (1)Km(1,2), Km(3), and (3)Km.</p>
Table 1
٤٠٦٩
-١١٥-
<tr><td><p dir="rtl">Ranking</p></td><td><p dir="rtl">Description</p></td><td><p dir="rtl">Definition Ranking No.</p></td></tr><tr><td><p>TVAAPSVFIF PPSDEQLKSG TASVVCLLNN</p><p>FYPREAKVQW KVDNxLQSGN</p><p>SQESVTEQDS KDSTYSLSST</p><p>LTLSKADYEK HKxYACEVTH</p><p>QGLSSPVTKS FNRGEC</p></td><td><p dir="rtl">GENUS Logic</p><p dir="rtl">Fixed hLC</p></td><td><p>1</p></td></tr><tr><td><p>TVAAPSVFIF PPSDEQLKSG TASVVCLLNN</p><p>FYPREAKVQW KVDNVLQSGN</p><p>SQESVTEQDS KDSTYSLSST</p><p>LTLSKADYEK HKLYACEVTH</p><p>QGLSSPVTKS FNRGEC</p></td><td><p dir="rtl">(1)Km to your area Fixed Fixed Fixed hLC</p><p>(V45/L83)</p></td><td><p>2</p></td></tr><tr><td><p>TVAAPSVFIF PPSDEQLKSG TASVVCLLNN</p><p>FYPREAKVQW KVDNALQSGN</p><p>SQESVTEQDS KDSTYSLSST</p><p>LTLSKADYEK HKLYACEVTH</p><p>QGLSSPVTKS FNRGEC</p></td><td><p dir="rtl">(1,2)Km for your area hLC</p><p>(A45/L83)</p></td><td><p>3</p></td></tr>
٤٠٦٩
-١١٦-
<tr><td><p>TVAAPSVFIF PPSDEQLKSG TASVVCLLNN</p><p>FYPREAKVQW KVDNALQSGN</p><p>SQESVTEQDS KDSTYSLSST</p><p>LTLSKADYEK HKVYACEVTH</p><p>QGLSSPVTKS FNRGEC</p></td><td><p dir="rtl">(3)Km to your area Fixed Fixed Fixed hLC</p><p>(A45/V83)</p></td><td><p>4</p></td></tr>
Let x at mode 45 be A or V, and x at mode 83 be L or V.
In certain embodiments, there is an arrangement comprising an arrangement of four different components whose contribution is coupled to the antibody (or the antigen-binding portion of the antibody), such that it is at least 50:, or at least 60:, or at least 60:. Say “Lolam” 70:, or at least “Lolam” 80:, or at least “Lolam” 80:
5 90: The arrangement of the antibody or the antigen-binding section of the
κ at K188 CLκ.
In certain embodiments, salaries may be derived from schemes
<img file="SA4069B1_D0157.tif" />
،
،
<img file="SA4069B1_D0158.tif" />
10
٤٠٦٩
-١١٧-
From a site where the antigenic antibody, such as an aldolase antibody, or the antigen-binding section of the antibody, is generated. Aldolase antibodies coated on sections of the site, when they are non-blocking (for example in a tube), represent an additional link between the aliphatic ketone donor and the ALDE receptor hyde
5 No. 2006/205670 US Here, the links 78-118 linking the connections, and the stop 0153-0233 linking the additives, are combined, the next part Ghada, changes and modifications to, for, h38C2, local locations and localization areas Complementary classifiers (CDRs), antibody technology, and relevance (Table 2, representative ranks below):
N<sup>HN</sup>O<sup>OOON</sup>O<sup>HN ON</sup>O.O<sup>N</sup>O.O<sup>HN OOH</sup>
10
NH
H2NO
<sup>O</sup>
O.O
NH
H<sub>2</sub>NO
<sub>O</sub><sup>O</sup><sub>N</sub><sup>H</sup>N<sup>O</sup><sub>N</sub>N<sup>HN</sup>S
<sup>OH</sup>OOO<sup>O.O</sup>
The term “combining site” includes CDRs and neighboring residues involved in antigen binding.
15 Table 2
٤٠٦٩
-١١٨-
<tr><td><p dir="rtl">Ranking</p></td><td><p dir="rtl">Description</p></td><td><p dir="rtl">Definition Ranking No.</p></td></tr><tr><td><p>ELQMTQSPSS LSASVGDRVT</p><p>ITCRSSQSLL HTYGSPYLNW</p><p>YLQKPGQSPK LLIYKVSNRF</p><p>SGVPSRFSGS GSGTDFTLTI</p><p>SSLQPEDFAV YFCSQGTHLP</p><p>YTFGGGTKVE IK</p></td><td><p>h38C2 VL</p></td><td><p>5</p></td></tr><tr><td><p>EVQLVESGGG LVQPGGSSLRL</p><p>SCAASGFTFS NYWMSWVRQS</p><p>PEKGLEWVSE IRLRSDNYAT</p><p>HYAESVKGRF TISRDNSKNT</p><p>LYLQMNSLRA EDTGIYYCKT</p><p>YFYSFSYWGQ GTLVTVSS</p></td><td><p>h38C2VH</p></td><td><p>6</p></td></tr>
٤٠٦٩
-١١٩-
<tr><td><p>ELQMTQSPSS LSASVGDRVT</p><p>ITCRSSQSLL HTYGSPYLNW</p><p>YLQKPGQSPK LLIYKVSNRF</p><p>SGVPSRFSGS GSGTDFTLTI</p><p>SSLQPEDFAV YFCSQGTHLP</p><p>YTFGGGTKVE IKRTVAAPSV FIFPPSDEQL</p><p>KSGTASVVCL LNNFYPREAK</p><p>VQWKVDNALQSGNSQESVTE</p><p>QDSKDSTYSL SSTLTLSKAD</p><p>YEKHKVYACE VTHQGLSSPV</p><p>TKSFNRGEC</p></td><td><p>h38C2 LC</p></td><td><p>7</p></td></tr>
٤٠٦٩
-١٢٠-
<tr><td><p>EVQLVESGGG LVQPGGSSLRL</p><p>SCAASGFTFS NYWMSWVRQS</p><p>PEKGLEWVSE IRLRSDNYAT</p><p>HYAESVKGRF TISRDNSKNT</p><p>LYLQMNSLRA EDTGIYYCKT</p><p>YFYSFSYWGQ GTLVTVSSAS</p><p>TKGPSVFPLA PSSKSTSGGT</p><p>AALGCLVKDY FPEPVTVSWN</p><p>SGALTSGVHT FPAVLQSSGL</p><p>YSLSSVVTVP SSSLGTQTYI</p><p>CNVNHKPSNT KVDKRVEPKS</p><p>CDKTHTCPPC PAPELLGGPS</p><p>VFLFPPKPKD TLMISRTPEV TCVVVDVSHE</p><p>DPEVKFNWYV DGVEVHNAKT</p><p>KPREEQYNST YRVVSVLTVL</p><p>HQDWLNGKEY KCKVSNKALP</p><p>APIEKTISKA KGQPREPQVY TLPPSREEMT</p><p>KNQVSLTCLV KGFYPSDIAV</p><p>EWESNGQPEN NYKTTPPVLD</p><p>SDGSFFLYSK LTVDKSRWQQ</p><p>GNVFSCSVMH EALHNHYTQK SLSLSPGK</p></td><td><p>h38C2 HC</p></td><td><p>8</p></td></tr>
I have created a number of links that include succinimides, including modified versions of the compound.
In certain embodiments, it includes a group of laminates arranged in a group coupled by a succinimide-base linker or a succinimide-base linker to the ring. The question of succinimide-cysteine binding has become an area of increasing interest. Succinimides can take over
٤٠٦٩
-١٢١-
Both in vitro and in vivo to exogenous thiol nucleophiles, likely through the preceding Michael reaction that produces maleimide that is successively attacked by thiol. Hydrolysis of the ring is thought to produce species resistant to the previous Michael reaction. This makes the resulting conjugate more stable and potentially more effective. Conditions may be improved for the succinimide • ring to open by force on the conjugate. The basic conditions cause easy hydrolysis of the ring. For example, can
Linkages containing the PEG chain (polyethylene glycol) can be hydrolyzed at pH 9.2 and 537°C for approximately 1-2 hours, and linkers containing an alkyl chain, such as ME, may require a higher temperature and longer reaction time to complete the ring opening.
<img file="SA4069B1_D0159.tif" />
Payload
001
"m(H2O)c"
50 mM borate buffer, pH 9.2
378 c, 12h
50 mM borate buffer, pH 9.2 45° C. 48h
<img file="SA4069B1_D0160.tif" />
<img file="SA4069B1_D0161.tif" />
0 1 Example of force hydrolysis of maleimide base conjugates
To evaluate the stability of these conjugates and prioritize samples for in vivo evaluation, an assay is being developed that involves treating the maleimide-conjugated conjugates with further aqueous glutathione (GSH) or plasma. Decompose the incomplete divisors of the reaction mixture at different time points to determine the coupling load, using the method described above. The results (Table 24) indicate that
<p dir="rtl">5 1 Antibody contact with a drug is slowly cleaved in a GSH-dependent manner. As expected, the rate of cleavage is highly dependent on hydrolysis of the succinimide ring. Importantly, these results appear to be explained by improved PK detection, as measured by increased AUC of the conjugate and by increased conjugate/Ab detection ratio.</p>
Method for evaluating the stability of ADCs
٤٠٦٩
-١٢٢-
Mix the sample with 30 ml of ADC (30 ml of PBS) and 1 ml of GSH (glutathione) to produce a suitable synthetic compound containing GSH in the amount of 0.5 ml of GSH Protein is 3 mg/ml. A comparison sample (without GSH) was also added with 30 μM ADC diluted to 3 mg/mL PBS. The ADC sample treated with GSH and the comparison ADC sample were added at 37°C for 5 days, sample at 3, and 6 days. The imperfect divisors were further mixed with TCEP, diluted with the addition of 0.1 mM formic acid: 10 mM acetonitrile, and eluted by LC/MS as described below.
Sample analysis: Analysis is performed using an Aglient 1100 capillary HPLC coupled to a Waters Xevo G2 Q-TOF sample analysis spectrometer. Filled materials onto a Zorbax 10 column (Poroshell 300SB C8 0.5 mm x 75 mm, formic at 80°C) 0.1 ml
acid, and are described using a graded compound containing 20-40: hydrogen peroxide (80) B : 1,2-propanol: 18 acetonitrile: water 0.1 m: formic acid) at a flow rate of 20 ml/min over 5.5 minutes. The continuous measurement of the hill is detected by a positive capillary voltage method set at 3.3 TV. The data are analyzed by a function of 1 MaxEnt 15 m MassLynx, and the intensities are used to calculate the values according to the previously described formula.
Arrangements and methods of administration
In other embodiments, another aspect of the drug relates to drug arrangements comprising an active ingredient in the arrangement of the drug and/or an antibody drug adduct coated with the drug It is an acceptable compound as a medicine or a carrier medium. In certain embodiments, arrangements are available suitable for veterinary or human administration.
<p dir="rtl">20 Non-pharmaceutical arrangements may be arranged in any form that allows the arrangement to be given to an individual Yes</p>
The discriminator. For example, the composition may consist of either a solid or a liquid. If there are ways to give growth, a group that includes, in India, unconventional fodder, intestinal fodder, both inside and outside the country -. Administration other than the enteral route includes intradermal, intravenous, intramuscular, or intravenous administration.
٤٠٦٩
-١٢٣-
In-cut or impregnation techniques. In most cases, arrangements are not given in a non-intestinal manner. In a special embodiment, arrangements are given in a vein.
Drug arrangements may be formulated to allow for the arrangement to be provided from a different drug and/or antibody-drug conjugate, such as the drug when the arrangement is given to the patient. The arrangements may be 5, and the birth may be affected by the dose generation, so that, for example, the pill may be discontinued for the birth of a replacement dose, and a portion of the salary may be diverted from the schedule and/or temporarily An antibody drug containing a liquid seedling on Set of dose generators.
It is possible that the ingredients used may be unsafe to alter drug arrangements with the ingredients used. The </s> ؼ ؼ ؼ ػ ػ ػ M. Select the drug and/or antibody drug conjugate, the method of administration, and the order used.
The pharmaceutically acceptable substance or carrier may be a solid or particulate matter, and the arrangements may consist, for example, in the form of a tablet or a powder. 15 Non-toxic substance(s) can exist in various forms of liquids A particle is a particulate matter.
The composition may consist of a liquid form, for example, a syrup, liquid or suspension. In order for oral administration, it is also possible to include a solution containing surfactant, sticky substance, wetting agent, dispersing agent, suspending agent, pH stabilizer, stabilizing agent and equalizing agent 2 0 tension.
Liquid arrangements, whether liquids, suspensions or other mixtures, may also contain one or more of the following: sterile liquids, such as sterilizing water, mixed liquids, etc. ml silolog, ml sodium chloride, isotonic ringer, zilote Stabilizers such as synthetic monogylcerides or digylcerides that can be used as, or in suspension,
٤٠٦٩
-١٢٤-
Propylene glycol, cyclodextrin, glycerin, polyethylene glycols or other ingredients; Antibacterial agents such as benzyl alcohol or methyl paraben; Antioxidants such as ascorbic acid or sodium bisulfite; Reducing agents such as ethylenediaminetetraacetic acid; Hydrogen stabilizers such as phosphates, citrates, acetates or amino 5 acids and frequency control agents such as sodium chloride or dextrose. The procedure for administering non-enteral medication may be an ampoule, intended for use in a single vial or multi-dose vial made of glass, plastic or another material . The cellulose molecule is a representative additive. It is preferable that the latchable arrangement be sterile.
The cost of the drug and/or antibody-drug conjugate, which may be used to treat a disorder or a prolonged illness, will depend on the nature of the disorder or illness, and may be determined by standard technical techniques. In addition, it is optionally possible to use the laboratory equipment and pulp mass to help establish a range The ideal dose. The exact dose to be used will also depend on the method of administration, the birth of the patient or the patient's advice, and should be determined by the physician and the circumstances of the patient.
<p dir="rtl">15 The arrangements include a potent morphology of an arrangement of a drug and/or a drug conjugate to an antibody.</p>
With Blythe, we get the right dose. The growth rate is at least 0.01: a different compound and/or an adjuvant of a similar drug The weight of the arrangement. As an embodiment of their representation, the drug arrangements of Blythe vary the birth dose for administration other than the enteral route to: 0.01 ml to: 2 ml per dose, in the same order /or having a drug attached to your body
20 Antidote to M, L.
To give the intravenous, the arrangement is used to the extent of the world 0.01 to the 100 maximums of the time of the time of the semester, and/or the identification of the realization of the body that has been done, for the sake of the body. In all aspects, the arrangement may include 1 to 100 mg of the drug and/or an antibody-drug conjugate, per liter gm The patient's body weight. M
٤٠٦٩
-١٢٥-
On the other hand, the dose administered will consist of 0.1 to 25 mg/kg body weight per dose of the drug and/or an antibody-drug conjugate of the drug.
In general, the dose of a different compound of the drug and/or the drug's compound is compounded with a different amount 0.01 mg/ml to 20 mg/ml 20 mg/ml
<p dir="rtl">5 The body of the body. As often as possible, the dose given to the patient ranges from 0.01 mg/ml to 10 mg/ml on the patient’s body . On the other hand, the dose given to the patient is 0.1 mg/ml, 10 mg/ml and 1/2 mg/ml. Broad. On the other hand, the dose given to the patient is 0.1 mg per dose and 5 mg per dose and the patient’s body weight. On the other hand, the dose given to the patient varies depending on the patient</p>
<p dir="rtl">10 1.1 mg/kg to 3 mg/kg according to the patient’s body weight. On the other hand, the dose given to the patient ranges from 1 mg/ml to 3 mg/ml per 1 mg/ml and the patient’s body weight.</p>
A different compound may be administered and/or an additional drug may be administered to you in an appropriate manner Example: stopping a drink or medication tablet. It may be administered topically or systemically. F
<p dir="rtl">15 Various delivery systems are known, for example, liposomes, lipid particles, microparticles, microparticles, microparticles, etc., and may be used to deliver an arrangement of a compound and/or a drug conjugate. It is an antibody, mn, lv. In certain embodiments, a different antigen and/or antibody-drug conjugate is administered from a parent to the patient.</p>
In special embodiments, it may be desirable to administer to the child or affected by 20 doses of the drug and/or drug conjugate antibody, topically to the area where treatment is needed.
It is possible that he will be imprisoned in the same way, and he will be imprisoned in the same way, by means of the same means The lady; Local application, for example, immediately following the dressing of the wound after the excursion; By the way; by catheter; Or using a multi-purpose fluid, a non-cellular substance, or a gelatinous substance A membrane, including a membrane, such as a silastic membrane, or a fibre. However many incarnations I make, it may be difficult to give
<p dir="rtl">25 By direct contact with a site (or cauterized site) of cancer cells, tumors, tissue, tumors, or pre-cancerous cells.</p>
٤٠٦٩
-١٢٦-
The tumor. In any other embodiment, it may be administered by direct injection at the site (or late site) of the onset of autoimmune disease.
In another embodiment, the array may be connected to a different antigen and/or an encapsulated antibody-drug conjugate, in order to establish a recombinant release system, e.g In India, a pump or other materials may be used.
<p dir="rtl">5 polymeric variety. In another embodiment, the adjuvant release system may be provided next to the target of the drug and/or a drug adduct to a compound antibody, for example, dispersion, and thus accessing A fraction of the systemic dose, see, for example,</p>
Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp.
115-138 (1984)
<p dir="rtl">10 It is possible to use other prison systems that have been discussed in relation to the return of wages to their staff.</p>
Langer (Science 249:1527-1533 (1990)).
The term “carrier” refers to a synthetic substance, additive or excipient, with which the preparation or conjugate of an antibody drug, M or L, is administered. Pharmaceutical non-fibres may consist of liquids, such as water and oils, including petroleum,
<p dir="rtl">15 Livaanum, nibbhatam or fine saffron. Non-familiar materials can be used as adjectives, etc. In addition, a catalyst, stabilizer or other agents may be used. In one of the worst embodiments, when administered to a patient, the preparation or adjuvant and the non-pharmaceutically acceptable substances are considered sterile. The word is a representative word when the subject or adjunct is given to the vein. The use of glycerol, dextrose, and glycerol can also be used as a liquid compound, in addition to glycerol.</p>
<p dir="rtl">20 Stoppable. If desired, internal arrangements may consist of secondary formulations of wetting or chelating agents, or hydrogen stabilizing agents.</p>
The internal arrangements can include, including financial statements, documents, procedures, and future agreements gh, or any other seedling suitable for use. Other examples of non-pharmaceutical substances are described
“Remington's Pharmaceutical Sciences” by E. W. Martin
٤٠٦٩
-١٢٧-
In one of the embodiments, the formulation is made from a drug and/or an antibody-drug conjugate, according to routine procedures such as adjusting the drug arrangement for intravenous administration to intravenous administration, for delivery. Growth: Intravenous substances or carrier media for intravenous administration consist of isotonic aqueous hydrogen stabilized malate. Where necessary, the arrangements may also include:
<p dir="rtl">5 E-factors. Arrangements for intravenous administration may optionally include a local anesthetic such as lignocaine to settle the pain at the site of administration. In general, the ingredients are present either in an unaltered or mixed form as a composition of a dry composition, for example, in the form of a dry or mixed substance. A water-free gasket with a sealed seal, such as an ampoule or a sealant, to indicate the active agent's characteristics. When an injection of a vaccine and/or an antibody-drug conjugate is administered by infusion, it may be distributed,</p>
<p dir="rtl">10 For example, a drinking bottle containing water or ml of the sterile permanent type. When the mixture is administered with an injectable drug and/or an antibody-drug conjugate, an ampoule of sterile water for the injection or 1 ml of ml should be provided so that the ingredients can be mixed before administration.</p>
The composition may include various ingredients that are suitable for creating a solid or liquid dosage. For example, the composition may include substances that make up the packaging shell of the first ingredients
<p dir="rtl">15 Active. The ingredients that make up the packaging consist of a growth inert material, and can be transported to the packaging, for example, cider, shellac, and packaging agents. Another spell. Alternatively, the active ingredients can be used in a gelatin capsule.</p>
These are the types of small ones, or small ones, which may be included in the arrangement Lyrics General: Armatolog is used to treat cancer.
<p dir="rtl">20 Therapeutic uses of compounds and drug-antibody conjugates thereof</p>
Another aspect of the drug relates to the way in which the drugs and their antibody-drug conjugates are used to treat cancer.
The drugs from the cultures and/or drug-antibody conjugates are available, which are effective in inhibiting the attack of the tumor cell or cancer cell, causing apoptosis of the tumor cell or cancer cell, or for treating
٤٠٦٩
-١٢٨-
Cancer is a disease. The use of different formulations and/or antibody-drug conjugates thereof may be used in accordance with the established standards for the treatment of leukemia cancers. Modified conjugates can be used to deliver an ordered secretion to a tumor cell or cancer cell. Without limitation to the theory, in the most extreme embodiment, the antibody binds to or generates from the adduct of a tumor cell or cross-linked antigen
<p dir="rtl">5 For the cells of Al -Ruwa, and it is absorbed) - Or the gomings of the garden, or it is not available for the promotin, the result of the Gulf, the sacred for the cells or the cell. Al-Sartaf. In certain embodiments, once inside the cell, the parent or effect of the particular peptide arrangements is enzymatically cleaved or hydrolyzed by a protease of the parent or effect cross-linked to the tumor cell or successor.</p>
<p dir="rtl">10 The crab, causing a hidden compound to be closed, was removed from the location of the tracer. Next, the absolute compound is an envelope invented to penetrate inside the cell and exert cytotoxic or cytostatic activities. The conjugate can also be cleaved by a protease inside the cell, releasing a different Mn sequence. Alternatively, the array is cleaved from the conjugate outside the tumor cell or cancer cell, and where the array is transported into the cell.</p>
<p dir="rtl">15 In certain embodiments, the conjugates provide a cancer drug or tumor-specific drug that targets, e.g.</p>
Introduce the general nature of salaries from the most important sources.
In another embodiment, the antigen is generated by a tumor cell or cancer cell.
In another embodiment, the antibody is generated from a tumor cell or cancer cell antigen, which is found on the surface of the tumor cell or cancer cell.
<p dir="rtl">20 In another embodiment, the generation of the antibody is related to the antigen of a tumor cell or cancer cell.</p>
The term protein is a cellular tissue outside the cell that crosses the tumor cell or cancer cell.
The specificity of the antibody generated by the tumor cell or cancer cell can be important for the identification of tumors or cancers that are treated to a maximum extent.
٤٠٦٩
-١٢٩-
F.A. Al -Thaddi, for the paradise, the vitilo , ovaries, prostate, skin, stomach, and testicles; The word “cancers” includes the number of “cancers” in India FD, WA, and RAM 5. The lemon is sweet.
Treatment for multicellular carcinoma. Cancers, including uncontrolled tumors, secondary growths of a malignant tumor, pathology or other conditions characterized by uncontrolled growth, die It can be treated or suppressed by administering a drug and/or an antibody drug conjugate, for example.
In addition to other embodiments, methods for treating cancer include administering an effective supplement in a 10-pack of different sizes Ra and/or an adjuvant antibody drug adjuvant, for both the patient and the treatment agent appropriate to the urgent need. The most recent embodiment of the therapeutic agent is, of course, the treatment of the cancer with the treatment of the therapeutic agent. In another embodiment, the appropriate therapeutic agent is, for example, an agent that has been shown to treat cancer with resistance to therapy. An additional dose may be given, and/or an additional drug may be added to the patient, for a longer period of time as well 15 treatments for cancer.
In some embodiments, the patient also receives additional treatment, such as radiotherapy. In the case of a specific embodiment, a different compound arrangement and/or a specific antibody drug adduct is administered to the patient at the same time as a therapeutic agent. What is the treatment or treatment for diarrhea? If another characteristic is detected, the worker will be given conventional treatment or radiation therapy before or after administering an array of drugs and/or an antibody conjugate of 20 to...
An agent may be given appropriate treatment over a series of sessions. Any combination or combination of chemo-therapeutic agents may be given as standard of care agent(s).
In addition, cancer treatment methods include combination therapy and/or an antibody-drug conjugate, to replace combination therapy or radiotherapy. Then it can be proven that or proven
٤٠٦٩
-١٣٠-
10
15
Orthopedic treatment or treatment that is very toxic, for example, causes unacceptable or unpleasant side effects for the treatment tv . The intended treatment may, optionally, be treated with another cancer treatment such as radiotherapy, radiotherapy or combination treatment, depending on any of the treatments Determine whether it is acceptable or required.
Antibody-drug conjugates and/or antibody-drug conjugates may also be used for in-vitro or extra-vivo treatment, for example Certain cancers, including, in India, adenocarcinomas and lymphomas, include more advanced treatment گات Khalifa J, Ayyfah, Atifiyah Al-Munshid. Therefore, it may include a multi-step process in which cells are attached, a diverse blood group, the origin of which is specific to fibroblasts, and which cleanses these cancer cells, removing them after a total The remaining bone tissue cells of fibrous Mn were reduced during the administration of a high dose of Mn. / Or an antibody-drug conjugate, without a high dose of radiotherapy, and the stem cell patch is implanted again into the lymph node. Next, supportive care is recommended during recovery of skeletal function and recovery of the patient.
Types of absolute
Additional embodiments include different types of absolute chemistry, inside or outside of you The cancer cell or tumor cell is thought to be cleaved by its enzyme and/or hydrolyzate by a parent or effect of the proteases of the cancer cell or tumor cell The language of the word. If so, salaries include the types described here, and also include salaries such as those described below:
<img file="SA4069B1_D0162.tif" />
20
IV
or a medicinally acceptable salt or a substance derived from,
٤٠٦٩
-١٣١-
<img file="SA4069B1_D0163.tif" />
<img file="SA4069B1_D0164.tif" />
<img file="SA4069B1_D0165.tif" />
γ is C2-C20 alkylene or C2-C20 heteroalkylene; C3-C8
-Cl-ClOalkylene-arylene-,-C3-C8heterocyclo-,-arylene-,carbocyclo- 5
<p>-,-0-0001606-(03-C8carbocyclo)- -21600-0-0001606-,</p>
-0-0101608-(The•]-), -03)-00011606-0
-(08000000 or -03-08 heterocyclo)-CI-CIOalkylene)-;
<img file="SA4069B1_D0166.tif" />
٤٠٦٩
-١٣٢-
G is SH,-OH,halogen- or S-C1-C6 alkyl–;
R2 is C1-C8 alkyl,hydrogen or C1-C8 haloalkyl;
R3A and R3B are defined as any of the following:
R3A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl hydrogen.
<p dir="rtl">5 aralkyl, heteroaralkyl, aryl, C1-C10 heterocyclyl or halogen; And</p>
R3B is C1-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl.
halogen, heteroaralkyl, aryl, heterocyclyl or aralkyl; or
R3A and R3B together are C2-C8 alkylene or C1-C8 heteroalkylene;
R4A and R4B are defined as any of the following:
10 R4A is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen,
heteroaralkyl,aryl,C1-C10 heterocyclyl or aralkyl; And
R4B is C3-C8 carbocyclyl, C1-C8 haloalkyl, C1-C8 alkyl, hydrogen heteroaralkyl, aryl, C1-C10 heterocyclyl or aralkyl; or
R4A and R4B together are C2-C8 alkylene or C1-C8 heteroalkylene;
15
R5 hglo
R12
O
٤٠٦٩
-١٣٣-
<img file="SA4069B1_D0167.tif" />
C3-C8, C1-C10
<img file="SA4069B1_D0168.tif" />
Carbocycly and C6-C14 aryl optionally substituted with 1, 2, 3, 4 or 5 groups selected on the basis of a group of -C1-C8, -C1-C8 alkyl-N(R')2, -C1-C8 alkyl.
-C(O)R',-C1-C8 alkyl-C(O)OR' -O-(C1-C8 alkyl),alkyl-C(O)R' 5
,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,-C(O)OR',-OC(O) R'
-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3,halogen,-OH
S(=O)2R'- and 'SR-', so that the tail 'R' is transferred to the molecule of the hydrogen group,
C1-C8 alkyl and aryl are unsubstituted, or are capable of forming two hetyl compounds 'R', with nitrogen 10 attached to the C1-C10 heterocyclyl;
<img file="SA4069B1_D0169.tif" />
<img file="SA4069B1_D0170.tif" />
Or R5 HCFC GF GF GF GF
Optional replacement
1, 2, 3, 4 or 5 groups are selected according to a number of files.
The group formed from C1-C8 alkyl-,-C1-C8 alkyl-N(R')2,-C1-C8 alkyl-
,-OC(O)R',-C(O)R',-C1-C8 alkyl-C(O)OR' -O-(C1-C8 alkyl),C(O)R'
,halogen,-OH,-S(O)R',-S(O)2R',-NHC(O)R',-C(O)N(R')2,-C(O)OR' 15
-SR',-S(=O)2R',-NHCONH2,-NHC(=NH)NH2,-CN,-N(R')2,-N3
٤٠٦٩
-١٣٤-
10
15
and 'arylene-R', whereby the 'R' is selected from the group formed by the alkyl and aryl hydrogen, C1-C10alkylene-C3-C8heterocyclyl, C1-C8heterocyclyl, or two of the 'R's can be cleaved, together with the linked nitrogen. With, C1-C10 heterocyclyl;
R6 is C2-C8 alkynyl, -C2-C8 alkenyl, -C1-C8 alkyl, hydrogen- or C1-C8 haloalkyl-;
R12 is C1-C10 heterocyclyl, C1-C4 alkyl, hydrogen or C6-C14 aryl;
R13 is C1-C10 heterocyclyl; And
R7 is selected for the number of kilograms of the polycarbonate group NO2, Br, I, Cl, F, CN and CF3;
R10 HCFC -Cl-,aryl,-C3-C8carbocycle,-Cl-Cl0alkyl,hydrogen
arylene-Cl-,-Cl-Cl0alkylene-aryl,-C3-C8heterocyclo,C10heteroalkyl--(C3-C8 carbocyclo)-Cl-,-Cl-Cl0alkylene-(C3-C8carbocyclo),Cl0alkyl Cl-Cl0alkylene-(C3-C8heterocyclo) ), Cl0alkyl-, and -(-(C3-C8 heterocyclo
Cl-Cl0alkyl, an optionally substituted aryl on R10 containing an aryl m R7[h];
h is 1, 2, 3, 4 or 5; And
X is O or .S
In particular, salaries from Formula IV have a structure:
O OH
20
<img file="SA4069B1_D0171.tif" />
HN
<img file="SA4069B1_D0172.tif" />
R1O
،
And
٤٠٦٩
-١٣٥-
<img file="SA4069B1_D0173.tif" />
The method is further described with the following examples, examples that are contemporaneous with the scope of the method.
Representation Department
Experiments are generally carried out following an inert atmosphere (nitrogen or argon), including the use of moisture-reducing agents, oxygen, or intermediates. Generally, compounds are used Commercial operating expenses with additional refining costs, including assets, Fake for lack of suitability
Aldrich Chemical Company, Milwaukee, (General Sure-SealTM Products)
(Wisconsin). Products are generally dried in bulk before undergoing further reactions or undergoing biological testing. The 10-meter liquid thermometer (LCMS) kit records data for the test In this case, the world of pressure is suitable (APCI) or foldable cost scale (GCMS). The chemical changes of the NMR data are shown in terms of the interesting fiber (ppm, δ). To thousand, the remaining rows are thousand
Use deuterated liquids.
To classify reference procedures using other examples or methods, the interaction protocol may differ (length of interaction and temperature). In general, the interactions are followed by Use a thin layer thermometer (TLC) or spectrophotometer, and adjust for reaction. When appropriate, purification processes may vary between experiments: In general, the percentages and percentages used are chosen for the filter materials/gradients to provide appropriate Rfs or retention times.
Optical rotations are performed on a 343 Perkin-Elmer polarimeter (serial number 9506).
20 HRMS is performed on an Agilent 6220 TOF LC/MS.
٤٠٦٩
-١٣٦-
Salary names are available throughout the ACD Labs software.
HPLC and LC-MS conditions used for analysis
Protocol A: Column: (2) Phenomenex Luna C18, 3 x 150 mm, 5 mm; Telescopic radicals: formic acid: 0.1 gm water (kg/kg); telescopic radicals B: 0.1:
<p dir="rtl">5 formic acid in acetonitrile (lbs/lbs); Gradient level: 5:B over 1.5 minutes, 5:to 100:B over 8.5 minutes, then 100:B for 1 minute of delivery; saturation rate: 0.75 ml Per minute : 25 °C, degassing: 215 nM, 254 nM, MS range (+) 2000-150 dL;</p>
Protocol B: Column: (2) Phenomenex Luna C18, 3 x 150 mm, 5 mm;
<p dir="rtl">10 A: Formic acid: 0.1 gm water. Grading level: B: 50 gm For 1.5 minutes, 50: to 100 B within 6.5 Minute, then 100: B for 3 minutes; flow rate: 0.75 ml/minute. Temperature: 25°C; deflection: 215 DAD nm; range (+) 2000-150 MS</p>
Daltov; Lg: 10 ml; Tool: Agilent 1200 LCMS.
<p dir="rtl">15 Protocol C: Column: (2) Phenomenex Luna C18, 3 x 150 mm, 5 mm;</p>
Dispersed phase B: 0.02 m methanol (l/l); Dispersed phase B: 0.02 m methanol (l/l); Gradient level: B: 50 to B: 100 in 10 minutes; flow rate: 0.75 ml/min. Temperature: not adjusted; deflection: 215 nM DAD, 254 nM; capacitance: 10 mT;
1100 HPLC 20
Protocol D: Column: (2) Phenomenex Luna C18, 3 x 150 mm, 5 mm; Dispersed phase B: 0.02 m methanol (lbs/lbs); Dispersed phase B: 0.02 m methanol (lbs/lbs); Grading level: B:5 to B:100 within 8 minutes; dissolution rate ــــــــــــــــــــــــــــــــــــ 0.75 ml/minute. Temperature: not adjusted;
٤٠٦٩
-١٣٧-
Dehydration: 215 nM DAD, 254 nM; Liquid gelatin: 10 ml; Tool: Agilent
1100 HPLC
Protocol E: Column: 2-4.6 x 250 ml Phenomenex Lux Amylose, 5
Metrometer; Differential phases heptane: A; The mutant birds are denaturated (ethanol:B); 5 Gradient level: 5: to 100: B in 10 minutes; Flow rate: 1.5 ml/minute. Temperature: not set; Chasm: 215 nM DAD, 254 nM; Range (+) 150 MS-
1500 Daltov; Lg: 10 ml; Tool: Agilent 1100 LCMS.
Protocol F: Column: 50 x 2.1 Waters Acquity UPLC BEH, C18 mm, 1.7 mm; Distinctive phase A: 0.1 m of water (full/full); Distinctive phase B: 0.1: 10 ml of acetonitrile (full/full); Grading level: B: 5 through 0.1
minute, 5: to 95: B in 0.7 minutes, 95: B in 0.1 minute; Intake rate: 1.25 ml/minute. Temperature: 60°C; Chafing: 200-450 nM; Range (+) 100 MS-1200 Daltof; Lg: 5 ml; Instrument: Waters Acquity.
Protocol G: Column: (2) Phenomenex Luna C18, 3 x 150 mg, 5
<p dir="rtl">15 Metrometer; Dissolved solvent: trifluoroacetic acid: 0.02 m of water (volume/volume); The rate of inflation Temperature: 1.5 milliliters per minute. Dehydration: 210 nm</p>
1100 HPLC
<p dir="rtl">20 Protocol H: Column: 50 x 4.6 Phenomenex Gemini-NX, C18 mm, 3</p>
Metrometer, 110 Angstrom; Distinctive agent: formic acid: 0.1 m of water (full/full); Distinctive agent formic acid: B: 0.1 mg of acetonitrile (full/full); Grading level: B: to 100 in 4.1 minutes, line O my enemy, 100 : B within 0.4 minutes; flow rate:
٤٠٦٩
-١٣٨-
<p dir="rtl">1.5 ml/minute. Temperature: 60°C; Phylogeny: 450-200 nM DAD; MS range (+) 2000-100 daltov; Lg: 5 ml; Tool: Agilent.</p>
Protocol I: Column: Atlantis T3, 3 x 75 mm, 3 m; Alloy surfactants A: 0.05: trifluoroacetic acid per gram of water (lbs/lbs);
<p dir="rtl">5 Gradient level: 5: to 95: B in 5.75 minutes; Flow rate: 1.2 ml/minute. Temperature: 45°C; Phylogeny: DAD 215 nM, 230 nM, 254 nM; Range (+) MS: 1200-150 daltove; Lg: 5 ml; Tool: Agilent 1100 LCMS.</p>
Protocol J: Column: Phenomenex Luna Phenyl-Hexyl, 3 x 150 mm, 5 mm; Distinctive phase A: formic acid: 0.1 m of water (full/full); Distinctive phase B:
<p dir="rtl">10 0.1: formic acid ml acetonitrile (bridle); Grading level: 5: B over 1.5</p>
1 minute, 5: to 100: B within 8.5 minutes, then 100: B within 1 minute and 10 minutes; Absorption rate: 0.75 ml/minute. Temperature: 25°C; Chafing: 215 nM DAD, 254 nM; Range (+) 2000-150 MS Daltov; Bridle: 10 ml; Tool: 1200 Agilent
LCMS
<p dir="rtl">15 Protocol K: Column: Symmetry-C18, 2.1 x 50 mg, 3.5 mM; The tyrants</p>
Differential formic acid: 0.1 gm water (kg/kg); B: 0.1 gm methanol (kg/kg); Gradient level: B: 10 to 90 in 6 5 minutes; absorption rate: 0.7 milliliters / Flour rate: Flour rate: 215 DAD nm; Tool: 996 Waters
PDA 20
Protocol L: Column: XBridge C, 18-4.6 x 150 mm, 3.5 m; 5 A: A suitable molecule of grammium molecule, ammonium acetate; Metaphoresis B: acetonitrile; Gradient level: 10: B over 3 minutes then 10: to 80: B over 14 minutes; Absorption rate: 0.7 milliliters/minute. A drawer for the room: A drawer for the room. Chevrolet: 215 DAD
٤٠٦٩
-١٣٩-
nm; Range (+) 100-1500 MS Daltov; Lg: 3 ml; Tool: 996 Waters
PDA
Protocol M: Column: 3 x 150 mm, Phenomenex Luna, 5 m; Distinctive additives: formic acid: 0.1 gm water (volumes/globules); Distinctive additives formic acid: 0.1 gm methanol (globules/globules); Gradient level: B: 50 in 1.5 Minutes, 50: to 80: B during 8.5 minutes, then 80: B within 10 minutes; conversion rate: 0.75 ml/minute. Drying temperature: 45°C; 254 nM; range (+) 90 MS-
2000 Daltov; Lg: 10 ml; Tool: Agilent 1200 LCMS.
Protocol N: Column: (2) Phenomenex Luna C18, 3 x 150 mm, 5 mm; 10 Dissimilar phase A: 0.02 m water (l/l); Dissimilar phase B: 0.02 m acetonitrile (l/l); Gradient level: B: to 100 in 23.5 minutes; flow rate Temperature: 1.5 ml/min. Temperature: 210 DAD. Instrument: Agilent 1100 HPLC.
Protocol O: Column: Agilent Poroshell 300SB-C8, 2.1 x 75 mm, 2.6 15 mm; Dispersed phase A: 0.1 m/ml formic acid; Dispersed phase B: 0.1 m acetonitrile: B: 20 to B: 45 within 4 minutes; Normal. Thailand: 1 ml/min. Temperature: 60°C; degassing: 220 nm; range (+) 2000-400 ms - Lozenge: 10 microlitres; Tool: Agilent
1100 LC, Waters MicromassZQ MS. Rotation is removed using MaxEnt1.
20 Protocol P: Column: TSK-gel G3000SWxl, 7.8 x 300 mm, 10 m;
Dissimilar phase: 1 ml of hydrogen peroxide stabilizer ml of PBS, 1X (Phosphate), pH 7.4 ml 2: acetonitrile; Isocratic; Transfusion rate: 1 ml/minute. Degree of temperature: Degree of forelock; Lg: 5 ml; Instrument: Agilent 1100 HPLC.
٤٠٦٩
-١٤٠-
Q: Column: 50 x 2.1 Waters Acquity UPLC HSS T3, C18 mm, 1.7 mm; Discrete phase A: formic acid: 0.1 m water (lg/l); Discrete phase B: formic acid: 0.1 m acetonitrile (lg/l); Gradient level: B: 5 in 0.1 min, B: 5 to B: 95 in 2.5 min. 95 minutes: B within 0.35 minutes; loss rate: 1.25
<p dir="rtl">5 ml/minute. Temperature: 60°C; Chafing: 200-450 nM; Range (+) 100 MS-2000 Daltof; Lg: 5 ml; Instrument: Waters Acquity.</p>
Protocol Q1: Column: 50 x 2.1, Waters Acquity UPLC HSS T3, C18 mm, 1.7 m; Dispersive agent: formic acid: 0.1 gm of water; Dispersive agent: formic acid: 0.1 gm of acetonitrile; Gradient level: 5 B: 10 within 0.1 minutes, 5 : to 95: B through 1.5 minutes, 95: B within 0.35 minutes;
<p dir="rtl">1 25 ml/minute. Temperature: 60°C; Chafing: 200-450 nM; Range (+) MS 2000-100 dlt; Lg: 5 ml; Instrument: Waters Acquity.</p>
Q2 Protocol: Shaft: Xtimate C18, 30 x 2.1 mm, 3 mm; Dispersed phase: trifluoroacetic acid: 0.1 mg/ml; dissociated mushroom B: 0.1
<p dir="rtl">15 Trifluoroacetic acid with acetonitrile (l/l): Gradient level: 10 to 80:B in 0.9 minutes, 80:B in 0.6 minutes; 100:B for 0.5 minutes; GL: 1.2 milliliters/flour. Flour: 220 DAD Micrometer: 25°C; 1 meter.</p>
Q3 Protocol: Shaft: Xtimate C18, 30 x 2.1 mm, 3 mm; Metamorphic phase
<p dir="rtl">20 A: Trifluoroacetic acid: 0.1 mg/ml;</p>
Trifluoroacetic acid acetonitrile (lb/lb); Gradient level: B: to 60 for 0.9 minutes, 60: B for 0.6 minutes; 100: B for 0.5 minutes; normal GL: 1.2 milliliters/flour: 220 DAD nanometer: 25 °C;
٤٠٦٩
-١٤١-
Protocol R: Column: Phenomenex Luna, 3 x 150 mm, 5 m; Allocated foam A: 0.1 m/m formic acid; B: 0.1 m methanol; Gradient level: B: 5 in 1.5 minutes, B: 5 to B: 100 in 8.5 minutes Minute, then 100: B within a minute, flow rate: 0.75 ml/minute, temperature: 45°C, deflection: 215 nm, 254 nm, range (+) 150-2000 ms
Daltov; Lg: 10 ml; Instrument: 305 RP Agilent 1200 LCMS.
Protocol S: Column: 3 x 150 mm, Phenomenex Luna, 5 m; Dispersive solvent: trifluoroacetic acid: 0.1 m of water (full/full); 8.5 Minute, then 100: B during the day; flow rate: 1 ml/
The minute. Roll temperature: not set; Dehydration: 210 DAD nanometers; MDA (+) 150 MS-
2000 Daltov; Lg: 10 ml; Instrument: 305 RP Agilent 1100 HPLC.
ProtoTool T: Shaft: Atlantis dC18, 4.6 x 50 mm, 5 mm; Telescopic bacteria: Trifluoroacetic acid A: 0.05 (kg/kg); B: 0.05.
15 Trifluoroacetic acid (m acetonitrile) (ml/ml); Gradient level: 5 to: 95 B over 4 minutes; then remaining at: 95 B over 1 minute of birth; flow rate: 2 ml/minute. Temperature: 100 degrees Dehydration: 215 nM DDA range (+) 1000-160 mS DLT: 3 μL;
U-Protool: Shaft: (2) Phenomenex Luna C18, 3 x 150 mm, 5 mm;
<p dir="rtl">20 Dispersive surfactant A: formic acid: 0.1 gm water (kg/kg); dissociated surfactant B: formic acid: 0.1 gm acetonitrile (gmol/kg); Gradient level: B: 5 in 1.5 minutes, 5 to 10 0: B through 8.5 Minute, then 100: B during the birth minute; condensation rate: 0.75 ml/minute. Temperature: 45°C; deflection: 215 nm DAD, 254 nm (+) MS 2000-150 Daltov; Lj Al-Lakaf: 10 Meterometer: Agilent 1200 LCMS.</p>
٤٠٦٩
-١٤٢-
Protocol V: Column: HPLC-V Ultimate XB- C18, 3 x 50 mm, 3 m; Dissimilar phase A: 0.225 m of water (l/l); Dissimilar phase B: 0.225 m of acetonitrile (l/l); Grading level: B: 30 to B: 90 over 6 minutes; flow rate: 1.2 Milliliters/minute. Temperature: 40°C.
<p dir="rtl">5 220 DAD nm; Lg: 1 ml; Tool: SHIMADZU.</p>
Protocol W: Column: HPLC-V Ultimate XB- C18, 3 x 50 mm, 3 µm; Dispersed grade: trifluoroacetic acid A: 0.1 m of water (pack/pack); Minutes; conversion rate: 1.2 Milliliters/minute. Temperature: 40°C.
<p dir="rtl">10 220 DAD nm; Lg: 3 ml; Tool: SHIMADZU.</p>
Protocol X: Shaft: YMC-pack ODS-A, 4.6 x 150 mm, 5 m; Dispersed solution: trifluoroacetic acid: 0.1 m of water (volume/volume); 1.2 ml/min. Temperature: 220 DAD.
<p dir="rtl">15 40°C; Lg: 3 ml; Tool: SHIMADZU.</p>
Y Protool: Column: YMC-pack ODS-A, 4.6 x 150 mm, 5 m; A: Trifluoroacetic acid: 0.1 m of water (full/full); For 5 minutes; flow rate: 1.5 ml/minute. Labeling: DAD
20 220 nm; Tool: 1100 Agilent.
Protocol Z: Column: Xtimate C18, 30 x 2.1 meter, 3 meter; The birds
A: Trifluoroacetic acid: 0.1 m of water (l/m);
٤٠٦٩
-١٤٣-
Within two minutes; Infusion rate: 1.2 ml/minute. Roll temperature: 50°C; CF: 220 nm; Range (+) 100-100 ms Daltov; Lg: 1 ml; Tool: SHIMADZU.
AB Protocol: Column: (2) Phenomenex Luna C18, 2 x 150 mg, 5
Metrometer; Distinctive phase A: formic acid: 0.1 m of water (full/full); Distinctive phase B:
<p dir="rtl">5 0.1: formic acid ml acetonitrile (bridle); graded level: 5 to 100: B</p>
for 10 minutes, then 100: B for 2 minutes; Flow rate: 0.5 ml/minute. Temperature: 25°C; Chafing: 210 nM DAD, 254 nM; Range (+) 2000-150 MS Daltov; Lg: 5 ml; Tool: Agilent 1100 LCMS.
BB Protocol: Column: (2) Phenomenex Luna C18, 2 x 150 mg, 5
<p dir="rtl">10 Metrometer; Distinctive phase A: 0.1 m of formic acid in water (l/m); Disaggregated phase B: 0.1: formic acid in acetonitrile (l/m); Gradient level: B: 5 in 2 minutes, B: 5 to 100 in 12 minutes 100: B for two minutes, then 100: 5 B within 1.5 minutes; °C, recovery: 215 nanometers DAD, 254; MS Daltgovof;</p>
Agilent 15
CB Protocol: Column: Waters Dissimilar phase: ammonium hydroxide: 0.03 m of water (l/lb); dissimilar phase: ammonium hydroxide: 0.03 m of acetonitrile (l/l); Grading level: 5 to: 95 lm within 4 minutes, then 95 lm This Minute and hour; infusion rate: 2 milliliters/minute.
<p dir="rtl">20 Temperature: 25°C; Phylogeny: 215 nM DAD, range (+) 1000-160 ms DDA;</p>
Lg: 4 ml; Instrument: Waters ZQ/Alliance 2795 HPLC.
DB Protocol: Column: Waters Atlantis dC18, 50 x 4.6 mm, 5 mM; Dissimilar phase A: trifluoroacetic acid: 0.05 m of water (l/l); Dissimilar phase B: 0.05: trifluoroacetic acid (l/l); Grading level: 5 to
٤٠٦٩
-١٤٤-
<p dir="rtl">95:B for 4 minutes, then 95:B for 1 minute and the next. Transfusion rate: 2 ml/minute. Temperature: 25°C; Deoxygenation: 215 nM DAD, range (+) 1000-160 mS DDA; For your sake</p>
Loading: 4 ml; Instrument: Waters ZQ/Alliance 2795 HPLC.
EB Protocol: Column: XBridge RP18, 50 x 2.1 mm, 5 mM; The bird
<p dir="rtl">5 Degraded ammonium hydroxide: 0.02 m acetonitrile; Gradient level: 10 to 80 B over 6 minutes, then 80 for 2 minutes; Flow rate: 1.2 ml/minute. Transmission: 220 DAD nm. Temperature: 50°C.</p>
FB Protocol: Column: (2) Phenomenex Luna C18, 2 x 150 mg, 5
<p dir="rtl">10 Metrometer; Distinctive phase A: 0.1 m of formic acid (l/g); Dispersed phase B: 0.1: formic acid (l/g); Gradient level: B: 5 in 2 minutes, B: 5 to 100 in 10 minutes ghghgh , and 100: B for two minutes; decomposition rate: 0.5 milliliters/minute. Temperature: 25°C; decomposition rate: 215 DAD nm, 254 nm; range (+) MS 2000-150 dl; Tool: Agilent 1200 LCMS.</p>
<p dir="rtl">15 In some cases, some minor changes are made to the analysis conditions by LC-MS and HPLC, for example</p>
Do not exceed the change in the graded level or rate of flow indicated by the symbol *.
HPLC conditions used for purification
Method A: Column: 2-21.2 x 250 mg Phenomenex Lux Amylose, 5
metrometer; Heptane: A. Ethanol B: 20 Gradients: Gradient level: 5 to 100 B within 6 minutes. Determination rate: 27 ml/minute. Decomposition: 210-360 DAD Tr; ;
FractionLynx
Method B: Column: (2) Phenomenex Luna C18, 21.2 x 150 mg, 5 m; Acetic acid A: 0.02 km/h; Differential birds 0.02 :B:
٤٠٦٩
-١٤٥-
acetic acid m acetonitrile; Gradient level: 5: B over 1.5 minutes, 5: to 45: B over 8.5 minutes; The rate of consumption in Thailand: 27 milliliters/minute; Phylogeny: 215 nM DAD, 254 nM; Range (+) 2000-150 MS Daltov; Tool: Waters FractionLynx.
Method C: Column: Phenomenex Luna C18, 30 x 100 mm, 10 m;
<p dir="rtl">5 Telescopic bacteria A: Trifluoroacetic acid: 0.02 gm ml; B: Trifluoroacetic acid methanol; Gradient level: 10: to 90: B in 20 minutes; Flow rate: 20 ml/minute. Temperature: not set; Phylogeny: 210 nM DAD, 254 nM; Laj al-laqf: variable; Tool: Gilson.</p>
Method D: Column: 21.2 x 150 mm, Phenomenex Synergi Max-RP, 4
<p dir="rtl">10 metrometer; Formic acid A: 0.1 gm ml; B: formic acid m acetonitrile; Gradient level: 30: B for 1.5 minutes, 30 to 60: B over 8.5 minutes, 60 to 100: B over 0.5 minutes, then 100: B over 2 minutes; Flow rate: 27 ml/minute; CH: 360-210 DAD nM; Range (+) 2000-150 MS Daltov; Tool: Waters FractionLynx.</p>
15 Method E1: Column: (2) 21.2 x 150 Phenomenex Luna C18 mg, 5
metrometer; Formic acid A: 0.1 gm ml; B: formic acid m acetonitrile; Gradient level: 40: B for 1.5 minutes, 40 to 80: B over 8.5 minutes, 80 to 100: B over 0.5 minutes and 100: B over 2 minutes; Flow rate: 27 ml/minute; CH: 360-210 DAD nM; Range (+) 2000-150 MS
<p dir="rtl">20 Daltov; Tool: Waters FractionLynx LCMS.</p>
Method E2: Column: 21.2 x 150 mm, Phenomenex Luna Phenyl-hexyl. The protocol numbers are identical to those described for Method E1.
Method F: Column: 21.2 x 150 mm, Phenomenex Synergi Max-RP, 4
metrometer; Formic acid A: 0.1 gm ml; Telescopic birds 0.1 :B:
٤٠٦٩
-١٤٦-
formic acid methanol; Gradient level: 44: B for 1.5 minutes, 44: to 77: B over 8.5 minutes, then 77: B over 10 minutes; Fuel rate: 27 milliliters/minute; Dehydration: 360-210 DAD nanometers; Magvadi (+) 2000-150 MS Daltov; Tool: Waters
FractionLynx LCMS
<p dir="rtl">5 Method G: Column: 21.2 x 250 mg PrincetonSFC, 5 mg</p>
metrometer; Heptane: A. Deformation: Ethanol B: (denatured); Gradient level: 1:B for 1.5 minutes, 1:1 to 50:B within 8.5 minutes; Derivation rate: 27 ml/minute; Deformation GF: 360-210 DAD nanometers (+ ) 2000-150 MS Daltov;
Tool: Waters FractionLynx LCMS.
<p dir="rtl">10 Method H: Column: (2) Phenomenex Luna C18, 21.2 x 150 mg, 5</p>
metrometer; Acetic acid A: 0.02 km/h; Differential bacteria 0.02: B: acetic acid m acetonitrile; Gradient level: 20: B in 1.5 minutes, 20: to 60: B in 10.5 minutes; Flow rate: 27 ml/minute; Phylogeny: 360-210 nM DAD, range (+) 2000-150 MS Daltov; Tool: Waters FractionLynx LCMS
<p dir="rtl">15 Method I: Column: (2) Phenomenex Luna C18, 21.2 x 150 m, 5 m;</p>
Dissimilar phase A: formic acid: 0.1 M water; Dissimilar phase: formic acid: 0.1 m methanol; Gradient level: 40: B over 1.5 minutes, 40: to 70: B over 8.5 minutes and then 70: B over 10 minutes; Fuel rate: 27 milliliters/minute; Phylogeny: 360-210 nm DAD; Range (+) 2000-150 MS Daltov; Tool: Waters FractionLynx LCMS.
20 Method J: Column: Phenomenex Luna C18, 30 x 100 mm, 5 m;
Dissimilar phase A: 0.02 m water (l/l); Dispersed phase B: 0.02 m acetonitrile (l/l); Grading level: B: 10 to B: 90 over 20 minutes; dissolution rate FD: 20 Milliliters/minute. Rolling temperature: unadjusted. Function: 210 DAD nm, 254 nm. Tool: Gilson.
٤٠٦٩
-١٤٧-
Method K: Column: (2) Phenomenex Luna C18, 21.2 x 150 mg, 5 metres; Formic acid A: 0.1 gm ml; B: formic acid m acetonitrile; Gradient level: 20: B for 1.5 minutes, 20: to 50: B over 8.5 minutes, 50 to 100: B over 0.5 minutes, then 100: B over 2 minutes; Average
<p dir="rtl">5 Flow: 27 ml/minute; CH: 360-210 DAD nM; Range (+) 2000-150 MS Daltov; Tool: Waters FractionLynx LCMS.</p>
Method L: Column: (2) 21.2 x 150 Phenomenex Luna C18 mg, 5 meter; Formic acid A: 0.1 gm ml; B: formic acid m acetonitrile; Gradient level: 30: B for 1.5 minutes, 30 to 50: 10 B over 8.5 minutes, 50 to 100: B over 0.5 minutes, then 100: B over 2 minutes ff; Average
Flow: 27 ml/minute; CH: 360-210 DAD nM; Range (+) 2000-150 MS Daltov; Tool: Waters FractionLynx LCMS.
Method M: Column: Waters Sunfire, C18 mm, 100 x 19 mm, 5 m; Dissociated phase: trifluoroacetic acid: 0.05 m water (lg/l); Dissipated phase: B: 0.05
<p dir="rtl">15 Trifluoroacetic acid with acetonitrile (mg/kg); Gradient level: 100:B over 8.5 minutes. Addition rate: 25 ml/minute. Shift: 215 DAD nanometer; MD (+) 1000-160 MS Daltov; : Waters FractionLynx.</p>
Method N: Column: 100 x 19, Waters Sunfire, C18 mm, 5 m; The birds
Dissimilar formic acid: A: 0.05 M water (lg/l); dissimilar phase B: 0.05 formic
<p dir="rtl">20 acid m acetonitrile (lg/l); Gradient level: R to 100: B over 8.5 minutes. Transfusion rate: 25 ml/min. Decomposition: 215 nM DAD; Range (+) 160-1000 MS Dalton; Tool: Waters FractionLynx.</p>
Method O: Column: Phenomenex Luna C18, 150 x 21.2 mm, 5 m; Telescopic radicals: formic acid: 0.1 gm water (kg/kg); telescopic radicals B: 0.1:
٤٠٦٩
-١٤٨-
formic acid with acetonitrile (bridle/bridle); graduated level (bridle/bridle): Graduated from 20:B over 1.5 minutes, 20: to 40:B over 8.5 minutes, 40 to 100:B over After 0.5 minutes, then 100 minutes remain. Consumption rate: B for 1.5 minutes. Consumption rate: 27 ml/minute. Rating: 360-210 nanometers (+) 1000 -150 MS Daltov Instrument: Waters
FractionLynx 5
Method P: Column: 250 Phenomenex Gemini C18, 21.2 x 21.2 mm, 5 metres; Dispersed superfine additives ammonium hydroxide: 0.225 km/h The HD ػ ػ ػ Distinctive powder: ammonium hydroxide: 0.225 gm acetonitrile B: 0.225 gm (lg/gm); Gradient level: 45: to 85: B within 10 minutes. Scoring rate: 35 ml/g
minute. Phylogeny: 220 nM DAD, range (+) 1200-100 ms DAD; Tool: Shimadzu
MS Trigger
Method Q: Column: Phenomenex Synergi C18, 250 x 50, 10 mm; A: Trifluoroacetic acid: 0.1 gm water (bridle/bridle); B: 15 acetonitrile; Gradient level: 10 to 40: B, etc. 25 minutes. Language: 100.
ml/minute. Detection: 220 UV/Vis nm; Tool: Shimadzu LC-8A.
Method R: Column: (2) Phenomenex Luna C18, 21.2 x 250 mm, 5
metrometer; TFA: 0.1 gm water (kg/kg); TFA: 0.1 gm acetonitrile (kg/kg); graduated level B: 10 to 100 over 30 minutes; 20 with The country has become a variable in degree Heat: 25°C, drying: 215 nM, 254 nM;
Range (+) 2000-150 MS Daltov; Lig: 1.8 ml: Tool: Agilent 1100 Prep
HPLC
In some countries, some subtle changes are made to the purification conditions, such as to avoid without causing a change in the grade level or flow rate indicated by the symbol *.
٤٠٦٩
-١٤٩-
Public opinions
General Procedure A: Removal of Fmoc using diethylamine or piperidine. To boredom of tidy
(N,N-dimethylformamide or dichloromethane) Fmoc wraps on
Also add DMF, an equal amount of diethylamine or piperidine. Monitor the progress of the treatment.
<p dir="rtl">5 by LC-MS (or HPLC or TLC). Usually a substance containing dichloromethane and a small amount of methanol before spraying, remove on silica and purify by chromatography on silica gel, admixed with dichloromethane methanol (or any other suitable mixture of solvents) to provide the desired substance (or raw material to be used therefor).</p>
<p dir="rtl">10 General Procedure B: Removal of Boc or cleavage of t-Bu ester using trifluoroacetic acid. To a compound compound folded on a Boc or compound compound wrapped on a tert-butyl ester At 100 °C (or at room temperature) dichloromethane is added to trifluoroacetic acid, to create a ratio of 4:1 dichloromethane:trifluoroacetic acid. Monitor the progress of the process Work by LC-MS (or HPLC or TLC). The impurities are removed by washing. The residue is boiled at</p>
15 Fixed coating three-mart m heptane to supply the desired material.
General Procedure C: Boc removal or cleavage of tert-Bu ester (also referred to as t-Bu ester) using hydrochloric acid and dioxane. To whether mol of the solution is converted to BOC or the solution is converted to tert-butyl ester m-dioxane (or some combination without a molar, or another related molar), 4 mol of hydrochloric acid is added to dioxane.
<p dir="rtl">20 The reaction is presented by LC-MS (or HPLC or TLC). The reaction is separated by atomization and sometimes the filtrate is boiled at a constant boiling point once it turns into heptanes.</p>
General rent D: Akhtarf m
O-(7-azabenzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HATU).
٤٠٦٩
-١٥٠-
The Mallafa (A) ػ (2-2) diisopropylethylamine (also referred to as Hunig's base). 5. Monitor the progress of the reaction by LC-MS (or HPLC or TLC); the reaction is usually completed within 3 hours. The mixed substance is transported by means of a silica gelatin or reversed phase thermometer In some cases, boiling at a constant boiling temperature of three million heptanes, a small amount of ethyl acetate is added before removing onto silica or C18-bound silica. It is transported by means of silica gel or 10-milk formula.
Aaj Ara Al-A: Ahkht Arf M
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N5-carbamoyl-N-[4-({[(4-nitrophenoxy) carbonyl]oxy}methyl)phenyl]-L-ornithinamide (MalcValCitPABC-PNP).
15 To a mixture of payload amine and N-2,5-[6-(2,5-dioxo).
dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N5-carbamoyl-N-[4-({[(4-
nitrophenoxy)carbonyl]oxy}methyl)phenyl]-L-ornithinamide
1-2 pages (MalcValCitPABC-PNP, Eur. Pat. Appl. (1994), EP624377)
N,N-dimethylformamide or dimethylacetamide (also referred to as DMA), 20-added pyridine (4-methyl), diisopropylethylamine (4-methyl), 2,6-dimethylpyridine (4-methyl). Also referred to as HOBT or 1.1-0. 01(3H-[1,2,3]triazolo[4,5 -b]pyridin-3-ol isoform, also referred to as HOAT. After stirring at 40°C-50°C for 1-48 hours, the feed mixture is concentrated.
٤٠٦٩
-١٥١-
Balsht and boils at a constant boiling point three mart m heptane. The raw material is purified by chromatography of a modified phase according to the method used to produce the desired material.
Genetic Evacuation F: Tracing the commercial HERCEPTIN® antigen to the compound through the internal disulfides گا. HERCEPTIN® GFGFGH
<p dir="rtl">5 Commercial Genentech Inc ght as hfv</p>
x Addition of dialyzed reduces the antibody. (DPBS, Lonza) Dulbecco Phosphate.
Hundreds of TCEP (tris(2-carboxyethyl)phosphine hydrochloride, 5 mm g/distilled water) and reduced to a final concentration of 15 mg/ml of antibody using DPBS, 5 mm g/m distilled water. ,2'''-(ethane-1,2-diyldinitrilo)tetraacetic
<p dir="rtl">10 EDTA (acid), hydrogen peroxide stabilizer A 7-7.4. The mixture is added at 37°C for 1-2 hours and then cooled to room temperature . The adverb is to be filled out by adding y words. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK NG The Wahsa ػ DMA (10-5)</p>
<p dir="rtl">15 10 mg kg/ml, ml, ml, ml, ml, ml, ml, ml, ml, ml, ml. Add 1-2 thousand hours a day Thank you very much. The hydrogen formula of the feed mixture is then converted to DPBS (hydrogen pH 7.4) basalt 25 GE Healthcare Sephadex G Genomic Molecule Hydrogen Stabilizer Exchange Columns According to the maintenance instructions, the raw material is purified using a thermometer except for the size (SEC).</p>
<p dir="rtl">20 Using a GE AKTA Explorer system on a GE Superdex column and filter material PBS (pH 7.4).</p>
I would like to know the information about G: The connections are to be followed in the upper part of the filter device, which works
(part #UFC805096, Amicon Ultra 50k Ultracel centrifugal filters
(GE) 132 ml of stock is added to the carmine compound, L-cysteine, and PBS are twisted
<p dir="rtl">25 On 50 mM EDTA particles. Add these milliliters (50 microliters) to the body mixture</p>
٤٠٦٩
-١٥٢-
The specific antigen (5 mg) contains 950 μmol of PBS coated with 50 mg of EDTA. The concentration of cysteine in the mixture is 6.6 mg Restore after allowing the reaction to settle at a temperature (to temperature). 23°C) for 1.5 hours. The reaction tube was centrifuged to concentrate the substance to approximately 100 ml. The mixture was reduced to 1 ml of PBS.
<p dir="rtl">5 Feed contains 50 mg EDTA. This process takes 4 million minutes to remove cysteine reductase. The resulting use of 1 millimeter is a p A Jealmal Jarm (. After setting the temperature at 23°C (for 23°C) for an hour and a half, the supply tube is removed.</p>
<p dir="rtl">10 A solution to concentrate the substance to approximately 100 microliters. Pour the mixture into 1 ml M PBS. This process entails removing the excess maleimide. Multiple antibody conjugates are generally purified by size-except size (SEC) thermochromatography using a GE AKTA Explorer system on a GE Superdex20 column 0 and the filter material PBS (pH 7.4). The drug compound is synthesized at the intended location using a variety of methods including: Color spectrometer</p>
<p dir="rtl">15 (HPLC, MS), and thermochromatography analysis, among them hydrophobicity (HIC).</p>
Described in another section. The recorded value (Tables 19(a) and 19(b)) is generally produced by LC-MS following the reduction conditions.
General procedure H: Add 20 mM molecules of TCEP (generally 50 to 100 identical molecules) to the antiparticle (G, 5 Mg) in order to obtain the solution And the concentration of the antibody
<p dir="rtl">20 The mixture contains 50 mg/ml of PBS containing 50 mg/ml of EDTA. After allowing the antibody to incubate at 37°C for an hour and a half, the antibody's hydrogen stabilizer is replaced with PBS Add 50 milliliters of EDTA using a rotary concentrator to capture 50 ml of grammium molecule (wash 3 x 3 milliliters). (a concentration of 10 mT per cycle). Alternative methods such as TFF or dialysis are also available for longer periods. Recommend</p>
<p dir="rtl">25 Antibody Results: 1 ml of PBS mixed with 50 ml of Garamyl EDTA</p>
٤٠٦٩
-١٥٣-
50 mg of freshly prepared microflora is treated with 1:1 PBS/EtOH (DHA dehydroascorbate) (1 mM). The molecule has a molecule called the molecule, which dissociates to stabilize at 4°C overnight. The special hydrogen stabilizer changes Mix the antibody/DHA mixture into PBS and aliquot 50 mM EDTA particles using a rotary centrifuge.
<p dir="rtl">5 50 tylodalitone/molecular weight (3 x 3 ml wash, 10 mM concentration for three cycles).</p>
Suspension of the antibody. The results: 1 ml of confluent PBS mixed with 50 ml of garmin ED TA is treated with maleimide formula, which contains DMA (5-10 grams). After testing for an hour and a half, the hydrogen stabilizer of the substance changes ( (as above) to 1 ml PBS (3 × 3 ml wash, 10 mM concentration for each cycle). Purification was performed by SEC 10 (as previously described) to remove any adhering material.
General Procedure I: The drug name of the linking drug is determined using the method previously described (name F). The specific hydrogen stabilizer of the drug is exchanged for the drug The antibody is made up of 50 milligrams of the body containing borate hydrogen (hydrogen pH 9.2). Using a superior filtration device (grain atomization of 50% tylodalthelon). The mixture reduces the results to 15 37°C for 24 hours (maleimide-Peg extension gel) or 45°C for 48 hours
(maleimide-caproyl cross-linking gel). The resulting solution is cooled, replaced with pH stabilizer, and purified by SEC (as previously described) to remove any bound substance. LCMS analysis of the substance indicates... The word “succinimide” is complete in meditation (90: or it is affected ( ػ
General Procedure J: Conjugate pentafluorophenyl esters to the indicated antibody following the previously described procedure WO2012007896 A1.
The most important information about K: It can be traced back to the descriptions of amino-alkyl compounds, which are linked to the amino-alkyl enzyme. Description: WO2012059882 A2.
٤٠٦٩
-١٥٤-
General drug L: N-conjugate-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-2-carboxy-1-methoxypropyl]
pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-
Valinamide (which is harmful to the body, number 136) is amino acid, which is part of
<p dir="rtl">5 amine using HATU (1-2 ml) in the presence of Hunig's base (1-5 ml) mols of dichloromethane, DMF, or some other ml of them (or mls of the parent or effect). Observe the reaction By LC-MS (or TLC or HPLC). The reaction is electrophoresed and usually purified by silica chromatography or by photolithography HPLC. It is then separated, according to Fmoc, as described below in year A after chromatography and purification by chromatography. rm silica</p>
<p dir="rtl">10 Or by optical HPLC.</p>
General Procedure M: 151 M is coupled to the amine, in connection with the use of (1-2) HATU, or any other suitable coupling agent) in the presence of Hunig's rule (1-5) mL of DMF, dichloromethane, or In some cases, the reaction is based on the results of their successor (or the results of the parent or influence). The reaction is monitored by LC-MS (or TLC or HPLC). The reaction is determined by the condition. It is then done,
<p dir="rtl">15 Removal of Boc buffer as described in General Procedure B, concentration is carried out by elution and purification by dialysis.</p>
Traumatography of silica or by photochemical HPLC.
N: traces -2,7,10,13,16,19,22-1-(9H-fluoren-9-yl)- 3-oxo
Fmoc-AmPegXC2-COOH (or heptaoxa-4-azapentacosan-25-oic acid)
Other compounds (such as pentapeptide, a cell compound) or a cell compound pentapeptide
<p dir="rtl">20 The fodder assembly is wrapped on a separate part of the foil (N) using HATU (2-1). ml of dichloromethane, DMF, or some other form of the syllable that follows it (or a syllable that is filled with a syllable, and it is the same as the syllable). LC-MS (or TLC or HPLC) method. The reaction is based on electrolysis. It is then completed by removing the Boc liquid according to A. Some of them</p>
<p dir="rtl">25 The last hundred seconds is removed by removing the protective group on the part on the pentapeptide.</p>
٤٠٦٩
-١٥٥-
Cytotoxicity using the general procedure B (or another procedure known in the literature based on the chemical group). The agent is centrifuged and purified by silica chromatography or by photochemical HPLC.
What are the scientific opinions about O: Fmoc-AmPegXC2-COOH is associated with the amyloid pentapeptide
<p dir="rtl">5 For cells, the class (or pentapeptide) is a compound for cells that wraps around a group of thousands of parts other than the frame (N) The Fmoc buffer is removed according to the general procedure N. The reaction is mixed with the solution and then purified by silica thermolysis or by fluorescence HPLC. Alternatively, the following substance may be used. Next, an appropriate PABC (eg mcValCitPABC, or a similar compound) is arranged according to E. Thank you very much. GF</p>
<p dir="rtl">10 The pentapeptide that releases the cells from the molecule is then removed, using the usual procedure A or A. GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFAA Alaafaafaafaafaafaafaafaafaafaafaafa GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK B) (or any other relevant procedure, which is known (depending on the safety group). The agent is concentrated with water and purified by silica chromatography or by photochemical HPLC.</p>
Ajra McVALCITPABC-PNP,
<p dir="rtl">15 MalPeg3C2ValCitPABC-PNP (harmful in a similar way to mcValCitPABC-PNP).</p>
Answer: Fmoc-AmPegXC2-COOH is a synthetic pentapeptide (or synthetic pentapeptide). The Fmoc limit is removed as described by the general procedure N. The agent is concentrated in the solution and transferred by silica thermochromatography or by fluorescence HPLC (or
<p dir="rtl">20 The raw material can be used in their entirety. To the inverted milliliter of the raw material, the DMF at °C (or a slightly higher temperature) is added 1-2) bromoacetic acid is compatible) then base 5- 1 (Hunig is incompatible) and 2-1 (HATU is incompatible). Your data was monitored by LC-MS (or TLC or HPLC). It is dissolved in water and purified by preparative HPLC analysis.</p>
٤٠٦٩
-١٥٦-
Replacing mcValCitPABC-PNP.
fluoren-9-ylmethoxy)carbonyl]amino}hexanoyl) -L-valyl-N~5~-
carbamoyl-N-[4-({[(4-nitrophenoxy)carbonyl]oxy}methyl)phenyl]-L-
ornithinamide (which is harmful to the mcValCitPABC-PNP gel polish). Next, remove
<p dir="rtl">5 For Fmoc (general procedure B) then purification by analytical HPLC.</p>
Addition of the chemical formula S: One thousand milliliters of methanol, which is toxic to the cells, is added at the link (1). Compatible) then formic acid. The reaction is stirred at room temperature for 1-40 minutes and then added (1)6-3) sodium (cyano-kappaC)(trihydrido)borate is compatiable, indicated...
<p dir="rtl">10 Also, monitor the reaction by LC-MS (or TLC or HPLC). Alternatively, some additional additives are added to the mixture -6-) 2,5-dioxo-2,5-dihydro-1H 3-1(pyrrol -1-yl(hexanal) compounds. The compound is synthesized by the chemical formula and can then be transported using a synthetic HPLC assay.</p>
General procedure T: 4-[3-oxo-3-(2-oxoazetidin-1-yl)propyl]anilinium 15 is described in the literature.
(Bioorganic and Medicinal Chemistry Letters. 2012, vol. 22, #13, 4249 –
4253)
1,2-bis(pentafluorophenyl) 3,3'-[eth ane diylbis(oxy)]dipropanoate using HATU as dichloromethane is traced to the
<p dir="rtl">20 Desired pentapeptide for cells. The substance is then purified by photochemical HPLC.</p>
Fmoc-ValCitPABC-PNP traces the glycosylated pentapeptide of the desired cells by following procedure E. Next, continue to follow procedure E A. The evaporating substance is bound to 2-oxo-2-({4-[ 2-oxoazetidin
٤٠٦٩
-١٥٧-
yl)propyl]anilinium m 1,4-dioxane-2,6-dione following the procedure of General D). The material is then purified by photochemical HPLC.
V-1,2-Bis(pentafluorophenyl) 3,3'-[ethane]
bis(pentafluorophenyl) 4,7,10,13,16- or diylbis(oxy)]dipropanoate
Desired cytotoxic agent (or pentapeptide, pentaoxanonadecane-1,19-dioate 5
Some of the desired cytotoxic pentapeptides are coupled to a protective group on a part other than the N-terminus (following the general rule D). If the protective group is found, then remove the protective group (using... The procedures and procedures of the connection described above Debiyat. The material is then purified by photochemical HPLC.
10 General procedure W: 1-4-({[(4-nitrophenoxy)carbonyl]oxy}methyl)phenyl conjugate
<p>9) H-fluoren-9-yl)-3-oxo-2,7,10-trioxa-4-azatridecan-13-oate</p>
The desired cytotoxic pentapeptide follows the general procedure E. Fmoc is removed following the general procedure A. Bis(pentafluorophenyl) 3,3'-[ethane-1,2-diylbis(oxy)]dipropanoate is coupled to the residue following the general procedure D. The material is further purified by fluorescence HPLC.
15 General Procedure
alanyl-N~1~-[4-({[(4-nitrophenoxy)carbonyl]oxy}methyl)phenyl]-N~4~-
Trityl-L-aspartamide is the desired cytolytic pentapeptide following the general procedure E.
Remove the Fmoc by following the year rule A and remove the trityl group by following the year rule B.
M Substance Bis(pentafluorophenyl) 3,3'-[ethane-1,2-diylbis(oxy)]dipropanoate
<p dir="rtl">20 E, following a general procedure D. The substance is purified by photochemical HPLC.</p>
2-{N-{3-[2-(3-ethoxy-3-oxopropoxy)ethoxy]propanoyl
L-valyl-N~5~-carbamoyl-N-[4-({[(4-nitrophenoxy) carbonyl]oxy}methyl)
phenyl]-L-ornithinamide is a desired cytotoxic pentapeptide following general procedure E. The ethyl ester is removed using lithium hydroxide, THF, or water. It is formed later, NHS
٤٠٦٩
-١٥٨-
The ester is extracted from the residue, 1-hydroxypyrrolidine-2,5-dione, using -'N,N dicyclohexylcarbodiimide - THF. The substance is purified by photochemical HPLC.
X3: Tracking -N-[(9H-fluoren-9-ylmethoxy)carbonyl]-D-valyl
N~5~-carbamoyl-N-[4-({[(2-carboxypropan-2-yl)carbamoyl] oxy}methyl)
<p dir="rtl">5 phenyl]-L-ornithinamide DMSO and acetonitrile. You are welcome to remove Fmoc I love you so much qtf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf mf</p>
Using bis(pentafluorophenyl) 3,3'-[ethane-1,2-diylbis(oxy)]dipropanoate
Hunig base m acetonitrile. The substance is purified by photochemical HPLC.
X4: Conjugates -N-[1-(9H-fluoren-9-yl)-3,5,12-trioxo-2,7,10-trioxa 10 4-azadodecan-12-yl]-2-methylalanine Number 250, followed by foreigners D, number 250.
acetonitrile. Fmoc must still follow the General Procedure A that has been established in the previous year (bis(pentafluorophenyl 3,3'-[ethane-1,2-diylbis(oxy)]dipropanoate)). The substance was purified by fluorescent HPLC.
Ajeda A
N~2~-acetyl-N~6~-(tert-(hydroxymethyl)phenyl]-L-ornithinamide 15
butoxycarbonyl)-L-lysine following the general procedure D. The resulting residue, L-bis(4-nitrophenyl)carbonate, is associated with the Hunig base. Then, the desired cytotoxic pentapeptide is followed by the general procedure E. Remove BOC water by following general procedure B with acetonitrile. The waste material is purified by photochemical HPLC.
<p dir="rtl">20 In some cases, some significant changes are made to the terms of the transaction, for example, to complete it without giving birth.</p>
The order of adding the tracer and the reactant or hydrating the tracer or reactant is indicated by the symbol *. Moreover, such proceedings are only representative proceedings and are not confidential.
٤٠٦٩
-١٥٩-
In addition to the general procedures mentioned above, the pain relievers dolastatin and auristatin
It includes the following:
Petit et al. J.Am. Chem. Soc. 1989, 111, 5463; Petit et al. Anti-Cancer
Drug Design 1998, 13, 243 and references cited therein; Petit et al. J.
Nat. Prod. 2011, 74, 962; WO 96/33212; WO 95/09864; EP 0695758; 5
WO 07/8848; WO 01/18032; WO 09/48967; WO 09/48967; WO 09/117531; WO 08/8603; US 7,750,116; US 5,985,837; andUS
2005/9751;
The winds, their twists and turns, merge here, wafting through contemplation.
<p dir="rtl">10 MS analysis and sample staining</p>
Damage samples for LC-MS analysis by adding 20 μL of sample (1 mg/mL ADC/PBS) 20 μL/mL 20 μM garmic dithiothreit ol DTT)). After allowing the mixture to stabilize at room temperature for 5 minutes, samples were analyzed according to Protocol O.
<p dir="rtl">15 The following calculations are carried out for the aggregate report (DAR) from the proposed:</p>
Loading = 2*[LC1/(LC1+LC0)]+2*[HC1/(HC0+HC1+HC2+HC3)]+
4*[HC2/(HC0+HC1+HC2+HC3)]+6*[HC3/(HC0+HC1+HC2+HC3)]
So the variables shown are a combination of: LC0 = unbored chain, LC1 = counter-bored chain, HC0 = non-bored heavy chain, HC1 = counter-bored heavy chain, 20 HC2 = double-bored heavy chain, And HC3 = heavy chain triplet.
The LC-MS conditions used are protocol F for a retention time of less than 1 minute and protocol H for the remaining experiments unless otherwise indicated.
٤٠٦٩
-١٦٠-
Tldhir
N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-valyl-N-
[(2R,3S,4S)-1-carboxy-2-methoxy-4-methylhexan-3-yl]-N-methyl-L-
valinamide (#8)
<img file="SA4069B1_D0174.tif" />
Step 1: Synthesis of -2-benzyl [(2S,3S)-1-hydroxy-3-methylpentan (#1) yl]methylcarbamate. to mol of N-[(benzyloxy)carbonyl]-N-methyl 52.37( L-isoleucine, 187.5 mol, 1 liter) tetrahydrofuran (524 mol, 0.35 mol). (m) Added slowly during the 1980s and the establishment of a new complex -borane 10 1) tetrahydrofuran molecule, 375 milliliters, 375 milliliters of tetrahydrofuran.
Garm, 2 °C) and leave the reaction to stir for 18 hours at room temperature. The reaction is cooled to 0 °C and one teaspoon (30 ml) of vinegar is added. For 30 minutes, stir in the mixture.
tert-butyl methyl ether, 1 ml (100 ml) and sodium carbonate
(250 ml). The aqueous layer is extracted again (100 tert-butyl methyl ether).
<p dir="rtl">15 The combined organic layers are washed with 1 ml of sodium carbonate (100 ml), washed with 1 ml of sodium carbonate (200 ml), dried with magnesium sulfate, filtered.</p>
٤٠٦٩
-١٦١-
It is filtered with oil to provide 1# (48.44 c, 97: yield) lubrication of dull-skinned oil, which is used in the next step without further purification.
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers: δ 7.26-7.41 (m, 5H), [5.06 (AB quartet, JAB=12.9 Hz, Δ
5.06 (AB quartet, JAB=9.0 Hz, Δ5
Hz) and 4.59 (t, J=5.4 Hz), total 1H], 3.67-3.80 (m, 1H), 3.51-3.60 (m, 1H), 3.41-3.51 (m, 1H), 2.75 and 2.71 (2 s , total 3H), 1.49-1.64 (br m, 1H), 1.24-1.37 (br m, 1H), 0.90-1.02 (br m, 1H), 0.74-0.87 (br m, 6H).
presumed to be a mixture of rotamers = m
10 Step 2: Synthesis of -2-benzyl methyl[(2S,3S)-3-methyl-1-oxopentan (#2) yl]carbamate. To mol of 1# (8.27 g, 31.2 mM, 1 ml) (41.35 m) dimethyl sulfoxide, 0.75 mol), add triethylamine (8.70 ml, 64 mmol g, 2. 05%) and the mixture is cooled until 10.18 (sulfur trioxide pyridine) g, 63.96 mg mol.
<p dir="rtl">15 (c) (2.05 degrees Celsius), during which the internal temperature is below 8 degrees Celsius.</p>
Bring it to a boiling point and stir for 18 hours. The solution is poured over water (100 ml) and 100 tert-butyl methyl ether (50 ml). The aqueous layer is extracted with 50 tert-butyl methyl ether (50 ml) and the resulting organic layers are washed 100 mg (100 ml), 100 mg sulfate, filtrate, concentrated by aspiration and transferred by dialysis
<p dir="rtl">20 Traumatology of silica gel (gradation: 10 to 60: ethyl acetate m heptane) to supply #2</p>
(7.14 C, 87): Tazit Adi Al-Louf.
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 9.61 (s, 1H), 7.26-7.42 (m, 5H), 5.01-5.13 (m,
٤٠٦٩
-١٦٢-
2H), 4.04-4.12 (m, 1H), 2.86 and 2.82 (2 s, total 3H), 1.94-2.11 (br m,
1H), 1.26-1.42 (br m, 1H).
characteristic signals = characteristic signals.
Step 3: Synthesis
tert-butyl (3R,4S,5S)-4-{[(benzyloxy)carbonyl](methyl)amino}-3-hydroxy- 5 5-methyl heptanoate (#3).
2.5 mol (n-butyllithium) by adding lithium diisopropylamine harms
tetrahydrofuran, 35.9 milliliters, 89.8 milliliters, 1.4 milliliters of diisopropylamine, 96.3 milliliters 1.5 meters (°C)
10 50 milliliters of tetrahydrofuran (1.3 mol C) at -78°C. One hour and a half later,
Add dropwise 15.7 ml (15.7 ml tert-butyl acetate, 116 mM, 1.8 ml) and stir the reaction mixture for an additional hour and a half while leaving it slowly to reach -20°C. The reaction mixture is cooled to -78°C Add 16.9 milliliters of aldehyde #2, 64.2 milliliters of aldehyde, and 1 liter of tetrahydrofuran (10 milliliters). The reaction mixture is stirred for an hour.
15 Half and then quenched by adding water (100 ml). After extracting 100 x 2 (diethyl ether ml), the organic layers were dried in sodium sulfate, filtered, atomized and purified by silica gel chromatography (gradation: SR). : to 20: acetone m heptane) to provide 3# (8.4 C, 34:) non-loof lubrication.
LC-MS: m/z 402.4 [M+Na+],
20 ZMV retention = 3.91 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers: δ 7.27-7.39 (m, 5H), 5.01-5.12 (m, 2H), [4.93 (d, J=7.2 Hz) and 4.98 (br d, J=7.2 Hz), total 1H], 4.03-4.15 (br m, 1H), 3.68-3.85 (br m, 1H),
٤٠٦٩
-١٦٣-
2.65 and 2.72 (2 br s, total 3H), 2.28-2.37 (m, 1H), 2.09-2.17 (m, 1H), 1.74-1.90 (br m, 1H), 1.41-1.51 (m, 1H), 1.39 (s, 9H), 0.92-1.01 (m, 1H), 0.77-0.92 (m, 6H).
Step 4: Synthesis
tert-butyl (3R,4S,5S)-4-{[(benzyloxy)carbonyl](methyl)amino}-3- 5
methoxy-5-methyl heptanoate (#@2).
Li T -0.88 molecule c (1,8-bis(dimethylamino)naphthalene C,
10 59.2 mM mol, 2.7 dihydrate, 9.10 dimethyloxonium tetrafluoroborate
(g, 61.6 mm mol, 2.8 ml). After stirring overnight, the mixture is filtered through a Celite filter. The filtrated material is concentrated by vacuum and the residue is purified by thermolysis silica (gradation: grade: to 40) : 1:1 ethyl acetate:acetone (heptane) giving 2@# (8.7 g, 68:) lubricant.
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers: δ 15 7.28-7.40 (m, 5H), 5.01-5.13 (m, 2H), 3.89-4.08 (br m, 1H), 3.703 .82 (m, 1H), 3.18 and 3.26 (2 s, total 3H), 2.66 and 2.71 (2 br s, total 3H), 2.44-2.53 (m, 1H, assumed; partially obscured by solvent peak), 2.17- 2.24 (m, 1H), 1.71-1.86 (br m, 1H), 1.39 and 1.39 (2 s, total 9H),
<p>1.31-1.40 (m, 1H), 0.94-1.08 (m, 1H), 0.76-0.91 (m, 6H). 20</p>
Partially obscured by solvent peak = Partially obscured by solvent peak.
Step 5: Synthesis
٤٠٦٩
-١٦٤-
tert-butyl (3R,4S,5S)-3-methoxy-5-methyl-4-(methylamino)heptanoate, hydrochloride salt (#4).
2@# 13.37 mg, 33.98 mg, 1 mt 134 methanol (134 ml, 0.1 mol) and concentrated hydrochloric acid (3.1 ml,
<p dir="rtl">5 37.4 mm molecule of germanium, 1.1 liters (10: palladium added to carbon) moistened by</p>
<p dir="rtl">50:( )0.1 wzf:; 1.34 g, 3.40 mm mol. The mixture is hydrogenated at a pressure of 45 pounds per square inch for 3 hours, then purified with nitrogen, filtered through celite and filtered Lot #4 (9.20 EGP, 92): Solid material with white puff .</p>
1H NMR (400 MHz, CDCl3) δ 9.65 (br s, 1H), 8.97 (br s, 1H), 3.98
<p>4.04 (m, 1H), 3.40 (s, 3H), 3.06-3.13 (br m, 1H), 2.82 (br dd, J=6, 5 10</p>
Hz, 3H), 2.74-2.80 (m, 1H), 2.68 (dd, half of ABX pattern, J=16.3, 4.2 Hz, 1H), 2.00-2.10 (br m, 1H), 1.73-1.84 (m, 1H) ), 1.46 (s, 9H), 1.38
1.45 (m, 1H), 1.13 (d, J=7.0 Hz, 3H), 0.99 (t, J=7.4 Hz, 3H).
Step 6: Synthesis
tert-butyl (3R,4S,5S)-4-[{N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L- 15 valyl}(methyl)amino]-3-methoxy-5-methylheptanoate (# 5).
<p>18.53(N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-valine to the mixture</p>
GF, 54.60 mM, 54.60 mM, 1.3 ml (1,3,5-2-chloro-4,6-dimethoxy 9.58) triazine (CDMT). kg, 54.6 ml, 54.6 ml, 1.3 ml (ml -2)
20 118) methyltetrahydrofuran, 0.34 mol (Adds -N)
<p dir="rtl">6.52 milliliters of methylmorpholine, 59.1 milliliters of methylmorpholine, 1.5 milliliters of thickness 4# (11.80 g, 39.9 mM, 1 mL). After 3 hours, quench the solution with water (50 ml) and stir the mixture Tomorrow 15 minutes The aquatic layer is described and extracted as a whole. 2-50 ml (methyltetrahydrofuran). The organic layers are washed with 1 ml of sodium.</p>
٤٠٦٩
-١٦٥-
Diluted bicarbonate (50 ml), dried with magnesium sulfate, filtered, and filtered to give a non-sticky oil, which is purified by silica gel thermolysis (gradation: 5 to 40 m heptane) Giving 5 # (26.2 g, 91:) Colorless foam.
LC-MS (Protocol I) m/z 581.3 [M+H+] 604.3 [M+Na+], 5
ZMV retention = 4.993 min;
1H NMR (400 MHz, DMSO-d6), possibly a mixture of rotamers, characteristic major signals: δ 7.88 (d, J=7.4 Hz, 2H), 7.71 (d, J=7.4 Hz, 2H), 7.62 (d, J=8.6 Hz, 1H), 7.41 (dd, J=7.4, 7.4 Hz, 2H), 7.27-7.34 (m, 2H), 4.13-4.32 (m, 4H), 3.70-3.82 (br m, 1H), 3.24 (s, 3H), 2.92 10
(br s, 3H), 2.54 (dd, J=15.7, 2.4 Hz, 1H), 2.17 (dd, J=15.4, 9.4 Hz, 1H), 1.95-2.07 (m, 1H), 1.70-1.83 (br m , 1H), 1.40 (s, 9H), 0.83-0.94 (m,
9H), 0.69 (t, J=7.2 Hz, 3H).
possibly a mixture of rotamers
<p dir="rtl">15 major signals = major signals.</p>
Step 7A: Synthesis
tert-butyl (3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(L-)
valyl)amino]heptanoate (#6).
The 5) (Tetraydurran) (Tetraydurran), 0.16 A
<p dir="rtl">22 milliliters of diethylamine. The mixture was stirred for 6 hours, then the suspension was filtered through Celite and washed with tetrahydrofuran (25 milliliters). The filtered material was agitated by filtering to form a pale yellow color of oil, which was then repeated at 50 milliliters. -methyltetrahydrofuran milliliters (Wertz times</p>
٤٠٦٩
-١٦٦-
Others to complete the removal of diethylamine. Crude oil from #6 (< 15.25 g) goes to the next step without further purification.
Step 7B: Synthesis
(3R,4S,5S)-4-[{N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-valyl}(methyl)amino]-3-methoxy-5-methylheptanoic acid (#@5) . 5
Apply to drying agent B, 5# (1.62 mg, 2.79 mg ml, 1 ml) (10) dichloromethane ml, 0.3 mol) and 3 (trifluoroacetic acid ml) creates 5@# (1.42 mol), 97: (A solid solid substance used for further purification.
LC-MS m/z 525.3 [M+H+] 547.3 [M+Na+]
<p dir="rtl">10 ZMV retention = 0.95 min;</p>
1H NMR (400 MHz, DMSO-d6), characteristic signals: δ 7.89 (d, J=7.6 Hz, 2H), 7.71 (d, J=7.4 Hz, 2H), 7.59 (d, J=8.8 Hz, 1H) , 7.41 (dd, J=7.6, 7.4 Hz, 2H), 7.28-7.34 (m, 2H), 4.14-4.32 (m, 4H), 3.24 (s, 3H), 2.92 (br s, 3H), 2.51- 2.57 (m, 1H, assumed; partially obscured by solvent peak), 2.20 (dd, J=15.9, 9.5 Hz, 1H), 1.95-2.06 (m, 1H), 1.70- 15
<p>1.83 (br m, 1H), 1.22-1.36 (br m, 1H), 0.84-0.93 (br m, 9H), 0.70 (t, J=7.3 Hz, 3H).</p>
Step 8: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-valyl-N-[(3R,4S,5S)-1-tert-butoxy-3-methoxy-5-methyl-1- oxoheptan-4-yl]-N- 20 methyl-L-valinamide (#7).
٤٠٦٩
-١٦٧-
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-alpha
<p dir="rtl">19.54 gm valine, 55.29 mmol gm, 1.3 ml and 6# (15.25 gm, 42.54 mmol gm, 1 ml) 2-methyltetrahydrofuran 2-methyltetrahydrofuran ml, 0.28 mol (Add (9.71) 2-chloro) -4,6-dimethoxy-1,3,5-triazine (CDMT)</p>
<p dir="rtl">5 55.3 Millions of Jerusalem, 3.3, 1.3 Sid</p>
<p dir="rtl">(6.6 milliliters of methylmorpholine, 60 milligrams, 1.4 mol), while the internal temperature is less than 25 °C. The reaction is stirred for 4 hours and then quenched by adding water E (50 milliliters). Flour, which is filtered through an aqueous layer and is extracted with 2-50 ml (2-50 methyltetrahydrofuran). The organic layers are mixed with mol% of sodium</p>
10 Bicarbonate is a suitable) 100 millimeters (, ػ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ؽ ” Giving #7 (32 J, 97:).
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.89 (d, J=7.4 Hz, 2H), 7.62 (d, J=7.4 Hz, 2H),
<p>7.41 (br dd, J=7.4, 7.4 Hz, 2H), 7.29-7.34 (br m, 2H), 4.52-4.69 (br m, 15 1H), 3.70-3.82 (br m, 1H), 3.22 and 3.25 (2 br s, total 3H), 2.94 and 2.96 (2 br s, total 3H), 2.78 and 2.81 (2 br s, total 3H), 2.11-2.23 (m, 1H), 1.90-2.10 (m, 2H), 1.68 -1.83 (br m, 1H), 1.40 (s, 9H), 1.21-1.33</p>
(br m, 1H).
<p dir="rtl">20 Step 9: Synthesis</p>
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-valyl-N-[(2R,3S,4S)-1-carboxy-2-methoxy-4-methylhexan-3-yl] -N-methyl-L-valinamide (#8).
٤٠٦٩
-١٦٨-
To #7 (32 g, 46 mol, 1 ml (160 ml) dichloromethane, 0.29 mol) added dropwise over 10 minutes (17.4 mol) trifluoroacetic acid ml, 231 ml gm gfgfg part grmfgm, 5 mtf. After 6 hours, the reaction continues for 18 hours Mix the product with toluene
5 (320 milliliters) and is concentrated in the form of a lipstick 8# (35.8 ml, 97:) counterfeiting of laminated paper, galvanized,
The next step is used for additional purification.
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.90 (d, J=7.0 Hz, 2H), 7.62 (d, J=7.4 Hz, 2H), 7.41 (br dd, J=7.4, 7.0 Hz, 2H), 7.29-7.35 (m, 2H), 4.54-4.68 (br m, 1H), [4.09 (d, J=11 Hz) and 4.22 (d, J=10.9 Hz ), total 1H], 3.74-3.84 (br 10 m, 1H), 3.22 and 3.24 (2 br s, total 3H), 2.94 and 2.96 (2 br s, total 3H), 2.78 and 2.80 (2 br s, total 3H), 2.13-2.24 (br m, 1H), 1.89-2.10 (br m, 2H), 1.70-1.81 (br m, 1H).
Tldhir
(2R,3R)-3-[(2S)-1-(tert-Butoxycarbonyl)pyrrolidin-2-yl]-3-methoxy-2- 15 methylpropanoic acid (#11; “Boc-Dap-acid”)
Step 1: Synthesis
tert-butyl(2S)-2-[(1R,2S)-1-hydroxy-2-methylbut-3-en-1-
yl]pyrrolidine-1-carboxylate (#9). 20
10) tert-butyl (2S)-2-formylpyrrolidine-1-carboxylate to mol
C, 50 mol C, 1 ml (120 m) dichloromethane, 0.42 mol
٤٠٦٩
-١٦٩-
(Add 9.76) potassium (2Z)-2-buten-1-yltrifluoroborate g, 60.2 mm g, 1.2 ml, then 3.24 tetra-n-butylammonium bromide g, 5.02 mm g mm, 0.1 meter) and water (60 ml). After 13 hours, add 150 ml (150 ml) of dichloromethane and 150 ml of water. All the aquatic dishes are used and eaten.
<p dir="rtl">5 Extract them with 100 ml dichloromethane. Wash the mixed muscle layers with an appropriate solution of sodium chloride (5 ml, 200 ml). 100ml water (200ml), and stirred with water to obtain #9 (~13g) orange blossom oil. No, it is used for additional purification.</p>
1H NMR (400 MHz, CDCl3) δ 5.61-5.86 (br m, 1H), 4.97-5.09 (br m, 2H), 3.80-3.98 (br m, 2H), 3.45-3.67 (br m, 1H), 3.21- 3.29 (m, 1H), 2.14
2.26 (m, 1H), 1.80-2.04 (m, 3H), 1.65-1.76 (m, 1H), 1.47 (s, 9H), 1.12 10
(d, J=6.6 Hz, 3H).
Step 2. Synthesis:
tert-butyl(2S)-2-[(1R,2S)-1-methoxy-2-methylbut-3-en-1-
yl]pyrrolidine-1-carboxylate (#10).
15 60) Sodium hydride sulfide: 60 mg of mineral oil, 3.38 mg, 84.4 mg mol
Garm, 1.1 liters (40 milliliters of hexane), and stir the mixture for 5 minutes. The solids are stirred to settle and the hexane is removed Add 59 (N,N-). dimethylformamide ml, 1.3 mol (1.3 mol) and cool the mixture to 0°C; then add dropwise 5 methyl iodide (5 ml; 81 mol).
20 1.05 ml), then add dropwise 19.6 ml (19.6 g), 76.8 mg mol, 1
One hundred percent (59 milliliters of N,N-dimethylformamide) within 5 minutes, while maintaining a temperature between 0°C and 5°C. The reaction is stirred at 100°C for two hours. The reaction is quenched with a ml of ammonium chloride mixture (150 milliliters), a mixture of 5 milliliters of sodium chloride (5%, 300 millilitres) was poured, and the mixture was extracted with ethyl acetate (50×3).
٤٠٦٩
-١٧٠-
The combined organic layers are washed with 10 m: 300 x 2 ml of sodium chloride, washed with water (200 ml), and shaken with a dishwasher. The oil moistened with water obtained from ethyl acetate (150 milliliters) is re-concentrated and purified by thermoglobulin silica gel (gradient level: 2): I love you I love you so much GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFGAFF 10:
<p dir="rtl">5 Ethyl acetate (m heptane) Lithium ion 10# (15g, 73): Non-loof lubrication.</p>
1H NMR (400 MHz, CDCl3), presumed to be a mixture of rotamers: δ 5.60-5.83 (m, 1H), 4.91-5.06 (m, 2H), 3.81-3.95 (br m, 1H), 3.43 (s, 3H), 3.36-3.61 (m, 2H), 3.19-3.31 (m, 1H), 2.09-2.21 (br m, 1H), 1.862.02 (br m, 2H), 1.62-1.85 (br m, 2H), 1.47 and 1.49 (2 s, total 9H),
1.09 (d, J=6.6 Hz, 3H). 10
Step 3. Synthesis:
(2R,3R)-3-[(2S)-1-(tert-butoxycarbonyl)pyrrolidin-2-yl]-3-methoxy-2-methylpropanoic acid (#11).
to 10# (25 gm, 92.8 mmol g, 1 ml) 100 gm) tert-butanol
<p dir="rtl">15 ml, 0.93 mol) Add water (30 ml) directly, then N-methylmorpholine (25.97 mol), 192.1 mol (25.97 mol), 2.07 mol) and osmium tetroxide (235.93 mol, 928.04 mM). grammium molecule, 0.01 m) After 12 hours, the mixture is concentrated by agitation using water (20 ml) to remove the tert-butanol residue. The residue is divided into 500 ml. ethyl acetate (millilitres) and water (500 milliliters) more than milliliters</p>
20 (150 millilitres). The aqueous layer is extracted with 250 milliliters of ethyl acetate (250 milliliters). Wash.
The organic layers were mixed with an appropriate solution of sodium chloride (10:200 by weight, 200 ml), washed with water (150 ml), and triturated with a solution of pale Penan oil moistened with water. 100 milliliters of ethyl acetate. Any remaining salt is used as an empty diol (34.76 g) without further purification.
٤٠٦٩
-١٧١-
To the raw diol (34.76 g, >92.8 mmol, 1 ml) acetonitrile (347 ml, 0.1 mol) and water (174 ml) add sodium permanganate (2.03 g, 5.73 mmol). 0.05 m, 0.05 °C The mixture is cooled to 0°C and added (51.46 mM sodium periodate, 240.6 mM, 2.1 M) dropwise over 5 30 minutes, while being rolled up At the internal temperature, when it falls below 5°C, the material overturns Stubbornly
°C for 4 hours, then poured with 2 ml of sodium thiosulfate pentahydrate (65.40 g, 263.5 mmol, 2.3 ml) of water (100 ml). The mixture was filtered through a Celite filter and the mixture was mixed The text marked in the middle divides the intervening material Between ethyl acetate (200 milliliters) and water (200 milliliters). The aqueous layer is re-extracted with ethyl acetate (250 milliliters).
<p dir="rtl">10 The aqueous layers are washed with 10 milliliters of citric acid. Once the desired product has been obtained, it is very water-soluble, and the aqueous layers are gelled, treated with 100 milliliters of Celite (100 milliliters), and vitrified to produce a white, white paste. Add ethyl acetate (150 milliliters) and the mixture is reconstituted to remove any remaining residues, which are then hydrolyzed in the process Alternatively, the container is treated with 150 milliliters of ethyl acetate, stirred at 50°C for 10 minutes and filtered. It continues</p>
<p dir="rtl">15 Twice). These filtered materials are separated from the previous organic layer (with citric acid wash), concentrated, mixed with (200 milliliters) of ethyl acetate, and filtered through a Celite filter to remove the solids. Finally, they are filtered through a Celite filter to remove the solids. This is the main topic of production. 11# (22.9 kg, 69: on two lines) Targhafwa Belaf Egypt/Panam.</p>
LCMS (Protocol I): m/z 310.1 [M+Na+], 232.1 [(M - 2-methylprop-1-ene)+H+], 188.1 [(M - Boc)+H+], 20
Retention time = 3.268 minutes;
1H NMR (400 MHz, DMSO-d6), characteristic signals: δ 3.61-3.85 (br m, 2H), 3.20-3.45 (br m, 4H), 3.03-3.17 (br m, 1H), 1.59-1.93 (br m,
4H), 1.40 (br s, 9H), 1.02-1.18 (br m, 3H).
٤٠٦٩
-١٧٢-
Illustration:
(2R,3R)-3-Methoxy-2-methyl-N-[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]-3-[(2S)-pyrrolidin- 2-yl]propanamide, trifluoroacetic acid salt (#19), (2R,3R)-3-methoxy-2-methyl-N-[(1S)-2-phenyl-1-(1,3-thiazol-2- yl)ethyl]-3-[(2S)-pyrrolidin-2-yl]propanethioamide, trifluoroacetic acid salt (#18)
<img file="SA4069B1_D0175.tif" />
10
15
Step 1. Synthesis of (12#)Nα-(tert-butoxycarbonyl)-L-phenylalaninamide.
To be a millions of 30.1 المرارية 10 ° C. 6.6 (N -Methylmorpholine Meltal, 124 millimeters (11.8 milliliters of ethyl chloroformate, 124 milliliters of ethyl chloroformate, 1.09 milliliters). After 20 minutes, add 30 ml of appropriate ammonium hydroxide (45 ml, 350 mM, 3.1 mol). The mixture was stirred at room temperature for 18 hours before mixing I. The residual material is ethyl acetate and washed alternately with 1 ml of appropriate potassium bisulfate, water and 1 ml and then dried, the organic layer in sodium sulfate.
Filter and shake with salt. The soft white solid (requires heating and stirring) is ethyl acetate (400 ml); the mixture is then separated to cool to room temperature before adding hexane (For 1000 milliliters). After a few minutes, White matter begins to be deposited
٤٠٦٩
-١٧٣-
Wrapped with fodder mixture. The solid material is collected by filtration, washed with 2 heptane × 150 ml, and dried for 18 hours to give 12# (24.50 g), 8 2: (solid material with white plov.
LC-MS: m/z 263.2 [M-H+], 309.2 [M+HCO2-],
<p dir="rtl">5 ZMV retention = 1.85 min;</p>
<p>1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, major rotamer: δ 7.35 (br s, 1H), 7.22-7.30 (m, 5H), 7.00 (br s, 1H), 6.78 ( d, J=8.6 Hz, 1H), 4.09 (ddd, J=10, 9, 4.5 Hz, 1H), 2.95 (dd,</p>
J=13.8, 4.4 Hz, 1H), 2.72 (dd, J=13.7, 10.1 Hz, 1H), 1.30 (s, 9H).
10 Step 2. Synthesis of -2-tert-butyl [(2S)-1-amino-3-phenyl-1-thioxopropan
yl]carbamate (#13)
1000 mg (14.060 mg)
180) tetrahydrofuran, 0.296 mol 2.4-bis-4(2,4-bis)
Working agent: (methoxyphenyl)-1,3,2,4-dithiadiphosphetane-2,4-dithione
15 (12.70 gm) (Lawesson gm, 31.40 mg gm, 0.59 ml) and is re-thickened with vinegar
I worked for 90 minutes. The reaction is cooled to room temperature and quenched by adding 1 ml of sodium bicarbonate. The mixture was extracted with twice as much ethyl acetate, and the organic layers mixed with sodium sulfate were dried, filtered, and filtered. The waste material, ethyl acetate, is synthesized with silica gelatin and purified by silica gelatin treatment (level
<p dir="rtl">20 Graded: R R: to 100: ethyl acetate (m heptane), litho R 13# (11.50 EGP, 77:) solid material with white puff.</p>
LC-MS: m/z 279.4 [M-H+], 225.2 [(M - 2-methylprop-1-ene)+H+], 181.2 [(M - Boc)+H+]; 1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, major rotamer: δ 9.60 (br s, 1H), 9.19 (br s, 1H),
٤٠٦٩
-١٧٤-
<p>7.23-7.32 (m, 5H), 6.82 (d, J=8.8 Hz, 1H), 4.44 (ddd, J=9.4, 9.1, 4.4 Hz, 1H), 3.00 (dd, J=13.7, 4.5 Hz, 1H) , 2.79 (dd, J=13.6, 9.9 Hz, 1H),</p>
<p>1.29 (s, 9H).</p>
3. Synthesis of 2-tert-butyl [(1S)-2-phenyl-1-(1,3-thiazol)
yl)ethyl]carbamate (#14) 5
To the mixture of #13 mixture (5.65 g, 20.2 mm g, 1 ml) acetone (101 ml, 0.2 g) add 8.76 ml bromoacetaldehyde acetal diethyl, 5 8.2 mm gm molecule, 2.89 m) and a diameter of 4 hydrochloric acid 1 molecule of dioxane. Remove three milliliters of nitrogen from the mixture before it is reduced to re-consumption.
<p dir="rtl">10 Vapor thickening. After two hours, the mixture is cooled to room temperature and concentrated by vacuum. After the mixture is mixed with ethyl acetate, it is washed with 1 ml of sodium bicarbonate and washed with 1 ml of water. The organic layer is dried with sodium sulfate, filtered, and concentrated by elution. The raw orange oil obtained from ethyl acetate is softened before it is filtered with silica and purified with silica gelatin (gradient level: grade: to 35: ethyl acetate). (Method A) 15 heptane) (Atifaa #14 (625 mag, 10:));</p>
HPLC (Protocol E): m/z 304.5 [M+H+], 248.9 [(M - 2-methylprop-1-ene)+H+],
Retention time = 7.416 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 20 major rotamer: δ 7.75 (d, J=3.3 Hz, 1H), 7.75 (br d, J=8.6 Hz, 1H), 7.61
(br d, J=3.1 Hz, 1H), 7.25-7.30 (m, 5H), 4.99 (ddd, J=10.5, 8.9, 4.5 Hz, 1H), 3.29-3.36 (m, 1H, assumed; partially obscured by water signal), 2.98 (dd, J=13.8, 10.6 Hz, 1H), 1.31 (s, 9H).
٤٠٦٩
-١٧٥-
4. Synthesis of 1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethanamine.
Hydrochloride salt (#15)
Apply to dry cleaning, 3.318 mg 1 ml dioxane, 0.33 ml ml (20 ml) dioxane, 80 ml (5 hydrochloric acid) (775 mg, 97%).
1H NMR (400 MHz, DMSO-d6) δ 8.95-9.07 (br m, 3H), 7.86 (d, J=3.2 Hz, 1H), 7.73 (d, J=3.2 Hz, 1H), 7.18-7.28 (m , 3H), 7.10-7.15 (m, 2H), 4.98-5.07 (m, 1H), 3.49 (dd, J=13.3, 4.9 Hz, 1H), 3.18 (dd, J=13.4,
10.2 Hz, 1H). 10
Step 5. Synthesis:
tert-butyl (2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2) -yl)ethyl]amino}propyl]pyrrolidine-1-carboxylate (#16).
<p dir="rtl">15 to milliliters of 11# (280 mg, 0.974 mm mol, 1 mol) and 15# 460</p>
mg, 1.44 mol (m3), 1.48 mol (m3) N,N-dimethylformamide ml, 0.32 mol (mol) at °C Add (diethylphosphoryl cyanide (DEPC) 93: 212 mmol, 1.30 mg mol (367 lmol, 2.63 mmol) (1.34 mol, 2.7 mol). After two hours at °C, this amounts to 20 The mixture is brought to room temperature for 18 hours Next, the reaction mixture contains ethyl
30 Toluene: acetate (1:2 milliliters), and washed sequentially with 1 mol of sodium bisulfate (35 milliliters) and 50 milliliters of sodium bicarbonate (4 x 25 milliliters). The organic layer, sodium sulfate, is filtered. It is separated by suction and purified
٤٠٦٩
-١٧٦-
(12) Silica gel to 100% ethyl acetate (heptane) giving #16 Tahramanum oil (374 mg, 81:).
LC-MS: m/z 474.4 [M+H+], 374.4 [(M - 2-methylprop-1-ene)+H+],
Retention time = 3.63 minutes;
1H NMR (400 MHz, DMSO-d6), characteristic signals: δ 8.66 (d, J=8.5 5
Hz, 1H), 7.78 (d, J=3.3 Hz, 1H), 7.64 (d, J=3.3 Hz, 1H), 7.21-7.31 (m, 4H), 7.14-7.20 (m, 1H), 5.40 (ddd , J=11.4, 8.5, 4.0 Hz, 1H), 3.23 (br s,
3H), 2.18 (dq, J=9.7, 6.7 Hz, 1H), 1.06 (dq, J=6.6 Hz, 3H).
Step 6A: Synthesis:
tert-butyl (2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2-phenyl-1- 10
(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidine-1-carboxylate (#17).
This amounts to 100°C for coating mixture #16 (350 mg/ml, 0.739 mg/ml). M, 1
2,4-bis(4-methoxyphenyl)-1,3,2,4-dithiadiphosphetane-2,4-MTF) and
<p dir="rtl">15 dithione (6 milliliters of toluene, 0.1 mol.) After 10 minutes, the mixture is cooled to a very cold temperature. The non-stickable material is still Then, by filtration, the filtered material is concentrated by filtration. The filtered material is purified by dialysis of silica gel (gradient level: 12: ethyl acetate to 80: ethyl acetate m heptane), then by dialysis of the reverse phase chromatography (no). E2 method (giving #17) 120 mg ,</p>
20 33:(؛
HPLC (Protocol J): m/z 490.2 [M+H+],
Retention time = 10,069 minutes;
٤٠٦٩
-١٧٧-
[α]20D – 110 (c 0.24, MeOH); 1H NMR (400MHz, CD3OD),
Characteristic signals: δ 7.78 (d, J=3.3 Hz, 1H), 7.51 (d, J=3.3 Hz, 1H), 7.32-7.37 (m, 2H), 7.24-7.30 (m, 2H), 7.17-7.23 ( m, 1H), 6.52-6.61 (br m, 1H), 3.62 (br dd, J=15, 4 Hz, 1H), 3.37 (s, 3H), 2.98-3.09 (br m, 1H), 2.53-2.64 (br m, 1H), 1.60-1.78 (m, 2H), 1.49 (s, 9H), 1.27 (d, 5
J=6.5 Hz, 3H).
Step 6B. Synthesis:
(2R,3R)-3-methoxy-2-methyl-N-[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]-3-[(2S)-pyrrolidin- 2-yl]propanethioamide, trifluoroacetic acid salt (#18). 10
According to formula B, 17# (198 mg, 0.404 mg ml, 1 ml), 6 (dichloromethane ml, 0.07 mol) and 2 (trifluoroacetic acid ml). Synthesis of #18 (185 mg, 91: (No, it is used for additional purification.
LC-MS: m/z 390.1 [M+H+],
15 ZMV retention = 0.57 min;
1H NMR (400 MHz, DMSO-d6) δ 10.91 (d, J=8.2 Hz, 1H), 9.07-9.20 (br m, 1H), 7.86-8.00 (br m, 1H), 7.83 (d, J=3.2 Hz, 1H), 7.69 (d, J=3.3 Hz, 1H), 7.27-7.36 (m, 4H), 7.21-7.26 (m, 1H), 6.33 (ddd, J=11.3, 8.3, 4.4 Hz, 1H) , 3.76-3.82 (m, 1H), 3.56 (dd, J=14.6, 4.3 Hz, 1H), 3.45 (s,
3H), 3.28 (dd, J=14.6, 11.3 Hz, 1H), 3.02-3.12 (br m, 1H), 2.89-3.00 20
(br m, 1H), 2.72-2.89 (m, 2H), 1.69-1.83 (br m, 1H), 1.43-1.58 (m, 2H), 1.20-1.33 (m, 1H), 1.22 (d, J= 6.6 Hz, 3H).
Step 7. Synthesis:
٤٠٦٩
-١٧٨-
(2R,3R)-3-methoxy-2-methyl-N-[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]-3-[(2S)-pyrrolidin- 2-yl]propanamide, trifluoroacetic acid salt (#19).
According to Evacuation Standard B, 16# (607 mg/ml, 1.28 mg/mol, 1 ml), 5/10 mL Suitable for 2 milliliters (trifluoroacetic acid)
#19 (640 mg, respectively) is synthesized and used in the next step without further purification.
1H NMR (400 MHz, DMSO-d6) δ 8.96-9.07 (br m, 1H), 8.89 (d, J=8.8 Hz, 1H), 7.87-8.00 (br m, 1H), 7.80 (d, J=3.2 Hz, 1H), 7.66 (d, J=3.3
Hz, 1H), 7.28-7.34 (m, 4H), 7.20-7.27 (m, 1H), 5.43 (ddd, J=11.3, 8.6,
<p>4.2 Hz, 1H), 3.42-3.50 (m, 2H), 3.36 (s, 3H), 3.04-3.14 (br m, 1H),10</p>
<p>2.99 (dd, J=14.2, 11.5 Hz, 1H), 2.92-3.02 (m, 1H), 2.78-2.88 (br m,</p>
1H), 2.34-2.42 (m, 1H), 1.73-1.84 (br m, 1H), 1.55-1.68 (m,1H),
<p>1.38- 1.53 (m, 2H), 1.15 (d, J=6.9 Hz, 3H).</p>
Illustration:
(2R,3R)-3-Methoxy-2-methyl-N-(2-phenylethyl)-3-[(2S)-pyrrolidin-2-15
yl] propanethioamide, hydrochloride salt (#23), (2R,3R)-3-methoxy-2-
methyl-N-(2-phenylethyl)-3-[(2S)-pyrrolidin-2-yl]propanamide, hydrochloride salt (#24)
<img file="SA4069B1_D0176.tif" />
٤٠٦٩
-١٧٩-
Step 1A. Synthesis:
tert-butyl(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-
phenylethyl)amino]propyl}pyrrolidine-1-carboxylate (#20).
to #11 (22 C, 77 mm C, 1 H) M 383) dichloromethane
<p dir="rtl">5 Whattar, 0.2 OPYLETHYALAMINE Meltel E Mellett, 91.9 millimeters, Jarm, 1.2, 1.2 And HATU (39 mg, 99.5 mg, 1.3 mol). The cost is reduced to 18 kg It is linked to the Shaf i. المنية الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم Sodium SULFATE, Sodium, Specger and Pleasures The filtrate is purified using silica gel (gradient level: zero to 100: ethyl acetate heptane) to give 20# (24gm, 8gm). 0:(Solid material, white plov, Egypt.</p>
LC-MS: m/z 392.2 [M+2H+], 291.1 [(M - Boc)+H+], 15
ZMV retention = 0.88 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers: δ 7.80-7.89 (br m, 1H), 7.23-7.29 (m, 2H), 7.15-7.23 (m, 3H), 3.723. 82 and 3.55-3.62 (2 br m, total 1H), 3.45-3.55 (br m, 1H), 3.31-3.44 (br m, 2H), 3.29 (s, 3H), 3.12-3.25 (br m, 1H) , 2.98-3.12 (br m, 1H), 20
2.71 (t, J=7.1 Hz, 2H), 2.09-2.19 (m, 1H), 1.71-1.83 (br m, 2H), 1.601.70 (br m, 1H), 1.49-1.60 (br m, 1H) , 1.41 (s, 9H), 1.03 (d, J=6.8 Hz,
3H).
Step 1B. Synthesis of (21#) dipyridinium-1-ylpentathiodiphosphonate.
٤٠٦٩
-١٨٠-
Add 4.45 grams of phosphorous pentasulfide, 2.19 milliliters, 20 milliliters of pyridine, 1 mol (56 milliliters of pyridine, 0.36 milliliters of molasses) at 80°C and the mixture is reduced When the steam is re-condensed (115 °C) for an hour and a half. The mixture is cooled to a temperature of 100 degrees Celsius and the product is filtered to give a solid substance of #21 yellow color (4.57 g, 60: 1 drop).
<p dir="rtl">5 Melting: 165-167°C (T°C);</p>
1H NMR (400 MHz, DMSO-d6) δ 8.78-8.84 (m, 4H), 8.22-8.30 (m,
2H), 7.76-7.83 (m, 4H).
Step 2A. Synthesis:
tert-butyl (2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-[(2-
phenylethyl)amino]-3-thioxopropyl}pyrrolidine-1-carboxylate (#22). 10
Add mixture of #20 (1.200 g, 3.073 mmg, 1 ml) and #21 (1.40 g, 3.69 mmg). acetonitrile (15 milliliters, 0.20 mol) to microwave radiation at At 100 °C for 30 minutes, the mixture is then cooled to room temperature, with 150 milliliters of ethyl acetate, and washed successively.
15 Hydrochloric acid is suitable for 0.5 mol (100 ml) and 50 ml (2 x 50 ml). The organic layer is dried over magnesium sulfate, filtered, and triturated using a filter. The residue is purified by silica gelation (sulfate) Gradual fatwa: 20: To 80: ethyl acetate, heptane (give 22 #) 670 mg, 54: (a hardener is used to form a solid glass of glass). Melting point: 107-109°C;
LC-MS: m/z 407.4 [M+H+], 351.3 [(M - 2-methylprop-1-ene)+H+], 20 307.3 [(M - Boc)+H+],
ZMV retention = 0.99 min;
٤٠٦٩
-١٨١-
1H NMR (400 MHz, CD3CN), presumed to be a mixture of rotamers: δ
<p>8 28 (br s, 1H), 7.19-7.33 (m, 5H), 3.81-4.05 (br m, 2H), 3.60-3.81 (br</p>
m, 2H), 3.38-3.51 (br m, 1H), 3.36 (s, 3H), 3.02-3.17 (br m, 1H), 2.89
<p>3 02 (m, 2H), 2.50-2.62 (br m, 1H), 1.71-1.85 (br m, 2H), 1.53-1.66 (br m, 2H), 1.45 (br s, 9H), 1.23 (d, J=6.7 Hz, 3H). 5</p>
Step 3. Synthesis:
(2R,3R)-3-methoxy-2-methyl-N-(2-phenylethyl)-3-[(2S)-pyrrolidin-2-yl] propanethioamide, hydrochloride salt (#23).
Apply to drying agent C, 22# 325 mg, 0.799 mg ml, 1 ml (10 ml dioxane, 0.2 mol) and 4 ml hydrochloric acid
<p dir="rtl">4 (dioxane ml, 16 mm mol, 20 ml) 23# (274 mg, ml) white foam is created;</p>
LC-MS: 308.2 [M+H+],
ZMV retention = 0.55 min.
<p dir="rtl">15 Step 2B. Synthesis:</p>
(2R,3R)-3-methoxy-2-methyl-N-(2-phenylethyl)-3-[(2S)-pyrrolidin-2-yl] propanamide, hydrochloride salt (#24).
To 20#) 7 ° C, 17.9 millimeters, the dignity ػ
20 Hydrochloric acid (20 milliliters dioxane, 80 milliliters, 4.4 milliliters). After stirring for 18 hours, the mixture was agitated with 24 liters (5.86 milliliters) (5.86 milliliters), and used without further purification;
٤٠٦٩
-١٨٢-
LC-MS: 292.2 [M+H+],
ZMV retention = 0.47 min.
Illustration:
N-Methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{ [(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}- 5 3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl ]-N-methyl-
L-valinamide (#26)
<img file="SA4069B1_D0177.tif" />
Step 1. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-valyl-N- 10[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[( 1R,2R)-1-methoxy-2-methyl-3-
{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-
thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide(#25)
15 According to the standard formula D, 8# (480 mg, 0.753 mg ml, 1 ml),
<p dir="rtl">HATU</p>
<p dir="rtl">(372 mg ml, 0.979 mg ml, 1.3 mol) and 367) triethylamine metrol, 2.64 mg ml Words, 3.5 words, the required word is created. Otherwise, words can be moved in succession.</p>
٤٠٦٩
-١٨٣-
Traumatology of silica gel (graded level: to 30% heptane acetone) Lithium oxide #25 (711 mg, 75:) Solid material.
LC-MS: m/z 1009.7 [M+H+],
ZMV retention = 1.15 min;
HPLC (Protocol B): m/z 505.3 [M+2H+]/2, 5
Retention time = 10.138 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.81 (br d, J=8 Hz), total 1H], 7.89 (br d, J=7 Hz, 2H), [7.80 (d, J=3.3 Hz) and 7.83 (d, J=3.2 Hz), total 1H], [7.64 (d, J=3.2 Hz) and 7.69 (d, J=3.2 Hz), total 1H], 7.62 10
(br d, J=7 Hz, 2H), 7.37-7.44 (m, 2H), 7.28-7.35 (m, 4H), 7.20-7.27 (m, 2H), 7.12-7.18 (m, 1H), 6.27- 6.35 and 6.40-6.48 (2 m, total 1H),
[1.14 (d, J=6.4 Hz) and 1.17 (d, J=6.3 Hz), total 3H].
Step 2. Synthesis:
N-methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1- 15
methoxy-2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl -1-oxoheptan-4-yl]-N-methyl-
L-valinamide (#26).
A. 10 (Dichloromethane milliliter, 0.07 molecules c cm (and 10 (Diethylamine millimeters (evacuating the required material, which is clearly made up. (Gradient level: Grade R: L to 10: methanol, kg dichloromethane) Giving a solid material to glass windows.
٤٠٦٩
-١٨٤-
Diethyl ether and heptane are added and the mixture is centrifuged by aspiration, yielding 26# (501 mg, 92:9) a white solid.
HPLC (Protocol A): m/z 787.4 [M+H+],
retention time = 7.229 min, (purity < 97:)
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.81 (br d, J=8. Hz), total 1H], [7.99 (br d, J=9 Hz) and 8.00 (br d, J=9 Hz), total 1H], [7.80 (d, J=3.3 Hz) and 7.83 (d, J =3.3 Hz), total 1H], [7.65 (d, J=3.2 Hz) and 7.69 (d, J=3.3 Hz), total 1H], 7.29-7.34 (m, 2H), 7.19-7.28 (m, 2H ), 7.13-7.19 (m, 1H), [6.31 (ddd, J=11, 8, 4.5 Hz) and 6.45 (ddd, J=11.5, 8, 4.5 Hz), total 1H], [4.57 (dd, J =8.9, 8.7 Hz) and 4.63 (dd, J=8.7, 8.7 Hz), total 1H], 3.16, 3.21, 3.24 and 3.25 (4 s, total 6H), 2.96 and 3.03 (2 br s, total 3H), [1.14 (d, J=6.6 Hz) and 1.17 (d, J=6.4 Hz), total 3H].
Illustration:
N2-[(1-Aminocyclopentyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4 -yl]-N-methyl-L-valinamide (#30)
10
15
<img file="SA4069B1_D0178.tif" />
٤٠٦٩
-١٨٥-
Step 1. Synthesis:
tert-butyl (3R,4S,5S)-4-[{N-[(1-{[(9H-fluoren-9-ylmethoxy)carbonyl] amino}cyclopentyl)carbonyl]-L-valyl}(methyl)amino] -3-methoxy-5-methylheptanoate (#27).
5 to #6 (287 mg, 0.801 mM dichloromethane, 1 mL)
4) 4 ػ Xylic Acid, 0.879 millimeters C. (376 mg) HATU, 0.960 mg 1.2 mg.
<p dir="rtl">10 The mixture was stirred for 18 hours and added 15 ml ethyl acetate. The reaction mixture was washed with 1 ml hydrochloric acid (2 x 5 ml). The organic layer is dried with sodium sulfate, filtered. The raw material is purified by melting silica gel (grade level: ethyl acetate to 60: ethyl acetate m heptane) #27 litho (502 mg, 91:) white foam.</p>
LC-MS: m/z 692.3 [M+H+], 714.3 [M+Na+], 636.3 [(M - 2-methylprop- 15 1-ene)+H+],
ZMV retention = 1.13 min;
1H NMR (400 MHz, DMSO-d6), characteristic signals: δ 7.89 (br d, J=7.4 Hz, 2H), 7.67-7.75 (m, 2H), 7.60 (br s, 1H), 7.38-7.44 (m , 2H), 7.30-7.36 (m, 2H), 7.21 (br d, J=8.8 Hz, 1H), 4.44-4.59 (m, 2H), 4.17- 20
<p>4. 27 (m, 3H), 3.68-3.78 (br m, 1H), 3.21 (s, 3H), 2.88 (br s, 3H), 2.09</p>
2.20 (m, 2H), 1.39 (s, 9H).
Step 2. Synthesis:
٤٠٦٩
-١٨٦-
(3R,4S,5S)-4-[{N-[(1-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}
cyclopentyl)carbonyl]-L-valyl}(methyl)amino]-3-methoxy-5-
methylheptanoic acid (#28).
27# 500 ml GFGFFF, 0.723 milliliters, 0.723 ml, 0.723 ml, 0.723 ml GF (GF)
<p dir="rtl">5 7) dichloromethane milliliters, 0.1 mol (add 3) trifluoroacetic acid</p>
ml). The mixture initially becomes orange-coloured, then becomes dark within hours. After stirring for 18 hours, remove the solution with a solution of 28# (460 mg). (Glass of Baluf Benm Datf, which is used without purification) Lighting.
LC-MS: m/z 636.3 [M+H+].
10 Step 3. Synthesis:
N2-[(1-{[(9H -fluoren-9-ylmethoxy)carbonyl]amino}cyclopentyl)carbonyl] -N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2- [(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-
thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-
Valinamide (#29). 15
In accordance with Evacuation Procedure D, 50 mg (50 mg, 0.079 mg/ml, 1 ml) of dichloromethane, 0.03 mol (0.5 ml), 18#44 amine (ml). (0.087 mM, 1.1 mol), triethylamine (33 mM, 0.237 mmol, 3 mol) and 36 mg) HATU, 0.95 mmol
<p dir="rtl">20 Ḍarmāmām, 1.2 is filled in) The desired material is created otherwise.</p>
Silica (graded level: p.r.: to 30: acetone m heptane) gives #29 (59 mg, 67:) a solid.
LC-MS: m/z 1007.5 [M+H+],
٤٠٦٩
-١٨٧-
ZMV retention = 1.11 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.80 (br d, J=8 Hz), total 1H], 7.89 (br d, J=7 Hz, 2H), [7.80 (d, J=3.3 Hz) and 7.82 (d, J=3.1 Hz), total 1H], 7.68-7.75 (m, 2H), [7.64 ( d, J=3.2 Hz) and 7.68 (d, J=3.2 5
Hz), total 1H], 7.38-7.44 (m, 2H), 7.27-7.36 (m, 4H), 7.12-7.25 (m, 4H), [6.30 (ddd, J=11, 8, 4.5 Hz) and 6.39 -6.48 (m), total 1H], [4.50 (br dd, J=8, 8 Hz) and 4.54-4.59 (m), total 1H], 4.17-4.29 (m, 3H), 2.89 and 2.96 (2 br s, total 3H), [1.13 (d, J=6.5 Hz) and 1.16 (d, J=6.4 Hz),
total 3H]. 10
Step 4. Synthesis:
N2-[(1-aminocyclopentyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide (#30). 15
A. Litter, 0.9 ml, molecules (and 4 millimeters (Diethylaamine (Diethylaamine)) Multi-level formula: SR: to 10: methanol (dichloromethane) (give the example #30 (26 mg, 61): 20 solids.
HPLC (Protocol A): Retention time = 7.233 minutes,
m/z 785.4 [M+H+],
(Purity < 72:(.
٤٠٦٩
-١٨٨-
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.82 (br d, J=8 Hz), total 1H], 8.19-8.27 (m, 1H), [7.80 (d, J=3.2 Hz) and 7.83 (d, J=3.2 Hz), total 1H], [7.65 (d, J=3.3 Hz) and 7.69 (d, J =3.3 Hz), total 1H], 7.287.33 (m, 2H), 7.20-7.27 (m, 2H), 7.14-7.19 (m, 1H), [6.31 (ddd, J=11, 5
<p>8, 4.5 Hz) and 6.44 (ddd, J=11, 8, 4 Hz), total 1H], [4.53 (dd, J=9, 8 Hz) and 4.60 (dd, J=9, 7.5 Hz), total 1H], 3.24 and 3.25 (2 s, total 3H), 3.17 and 3.21 (2 s, total 3H), 2.93 and 3.00 (2 br s, total 3H), [1.14 (d, J=6.5</p>
Hz) and 1.17 (d, J=6.5 Hz), total 3H].
10 Illustration:
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S) -2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl -
L-valinamide (#34)
<img file="SA4069B1_D0179.tif" />
Step 1: Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-1-tert-butoxy-3-methoxy-5-methyl-1-oxoheptan-4- yl]-N-methyl-L-valinamide (#31).
٤٠٦٩
-١٨٩-
to mol mol 6# (70: purity, 3.13 mol, 6.1 mmol, 1 ml) ml 40 dichloromethane, 0.15 mol C (add -9-N-[(9H-fluoren 1.99(ylmethoxy) carbonyl) ]-2-methylalanine (g, 6.12 mM mol, 1 mL), 2.67 (diisopropylethylamine mL, 15.3 mM mol, 2.5 mL)
<p dir="rtl">5 HATU (2.79 gm, 7.35 mg ml, 1.2 mol). Stir the mixture for 18 minutes.</p>
One hour, other than ethyl acetate, washed with 1 ml of appropriate hydrochloric acid. The organic layer is dried with sodium sulfate, filtered, and separated with silica. Afterwards, the material is purified by chromatography with silica gel (gradient level: 0:45 to ethyl acetate/heptane) Lithium oxide #31 (3.65 g, 90:) a solid substance.
LC-MS: m/z 665.5 [M+H+], 688.5 [M+Na+], 610.5 [(M - 2-methylprop- 10 1-ene)+H+];
HPLC (Protocol C): retention time = 9.455 minutes (purity < 94:);
1H NMR (400 MHz, DMSO-d6), characteristic signals: δ 7.89 (d, J=7.4 Hz, 2H), 7.67-7.74 (m, 2H), 7.39-7.48 (m, 3H), 7.31-7.36 (m , 2H),
<p>7.29 (br d, J=8.8 Hz, 1H), 4.47-4.60 (br m, 1H), 4.47 (dd, J=8.6, 8.0 15</p>
Hz, 1H), 4.18-4.28 (m, 3H), 3.69-3.79 (br m, 1H), 3.21 (s, 3H), 2.88 (br s, 3H), 2.15 (dd, J=15.5, 9.3 Hz, 1H), 1.91-2.01 (m, 1H), 1.67-1.81 (br m, 1H), 1.39 (s, 9H), 1.36 (br s, 3H), 1.30 (s, 3H), 0.75 (d, J= 6.6
Hz, 3H), 0.66-0.73 (br m, 3H).
<p dir="rtl">20 Step 2. Synthesis:</p>
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(2R,3S,4S)-1-carboxy-2-methoxy-4-methylhexan-3-yl]-N-methyl -L-valinamide (#32).
٤٠٦٩
-١٩٠-
Apply to drying agent B, 100mg #31 (500mg, 0.751mg). (7) dichloromethane ml, 0.1 ml (3 ml) and 32 trifluoroacetic acid (458 mg, water) are synthesized. The next step is used without further purification.
LC-MS: m/z 611.4 [M+2H+], 632.2 [M+Na+],
<p dir="rtl">5 ZMV retention = 0.94 min.</p>
Step 3. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)- 1-methoxy-2-methyl-3-{[(1S)-2-
phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-
5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#33). 10
According to the general rule D, 32# (53 mg, ≤ 0.083 mmol, 1 mol), 4) dichloromethane ml, 0.02 mol, 1) N,N-di methylformamide (ml, 18# 43.8) amine, 0.0870 mM, 1 mL,
<p dir="rtl">(36 mM triethylamine, 0.26 mM g, 3 mM) and 39.5 mM HATU,</p>
15 0.104 milligrams of germanium molecule, 1.2 ml (the required material is synthesized, the raw material is purified by
Traumatology of silica gel (gradient level: SR: to 30: acetone m heptane) giving #33 (60 mg, 69: in two steps).
LC-MS: m/z 981.4 [M+H+],
ZMV retention = 1.090 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 20 characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.80 (br d, J=8 Hz), total 1H] , 7.86-7.91 (m, 2H), [7.80 (d, J=3.3 Hz) and 7.82 (d, J=3.3 Hz), total 1H], 7.68-7.74 (m, 2H), [7.64 (d, J) =3.2 Hz) and 7.68 (d, J=3.3 Hz),
٤٠٦٩
-١٩١-
total 1H], 7.38-7.44 (m, 2H), 7.20-7.36 (m, 6H), 7.12-7.17 (m, 1H), 6.27-6.34 and 6.40-6.47 (2 m, total 1H), 3.22 and 3.24 ( 2 s, total 3H), 3.14 and 3.18 (2 s, total 3H), 2.90 and 2.97 (2 br s, total 3H), 1.37 (br s, 3H), 1.31 (2 br s, total 3H), [1.13 (d, J=6.6 Hz) and 1.16 (d, J=6.5
Hz), total 3H]. 5
Step 4. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S) -2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl -
L-valinamide (#34). 10
According to General Regulation A, 33# (55 mg, 0.055 mol ml, 1 mol) dichloromethane ml, 0.009 mol ml) and 4) diethylamine ml (R) You can compose the desired word. Otherwise, the words will be navigated using the “Trumpet” text. M silica gel (gradient level: m: to 5: methanol m dichloromethane) giving #34 (25 mg, 60:) as 15 solid.
HPLC (Protocol A): m/z 759.4 [M+H+],
Retention time = 7.088 minutes, (purity <75:).
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.81 (br d, J=8 Hz), total 1H], 8.01-8.08 (m, 1H), [7.80 (d, J=3.1 Hz) and 7.83 (d, J=3.3 Hz), 20 total 1H], [7.65 (d, J=3.2 Hz) and 7.69 (d, J=3.2 Hz), total 1H], 7.297.33 (m, 2H), 7.20-7.27 (m, 2H), 7.13-7.19 (m, 1H), 6.27-6.35 and 6.40-6.48 (2 m, total 1H ), [4.49 (dd, J=9, 8 Hz) and 4.56 (dd, J=9, 8 Hz), total 1H], 3.24 and 3.25 (2 s, total 3H), 3.17 and 3.21 (2 s, total
٤٠٦٩
-١٩٢-
3H), 2.92 and 2.99 (2 br s, total 3H), 1.20 and 1.21 (2 s, total 3H), 1.12 and 1.13 (2 s, total 3H), 0.75-0.81 (m, 3H).
Illustration:
N-methyl-L-valyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-[ (2-phenylethyl)amino]-3-thioxopropyl}pyrrolidin-1- 5 yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide (#36)
<img file="SA4069B1_D0180.tif" />
Step 1. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-valyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R) ,2R)-1-methoxy-2-methyl-3- 10
[(2-phenylethyl)amino]-3-thioxopropyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide (#35).
23# 337 mg, 0.983 mm (8) dichloromethane milliliters, 0.1 mol) and 1 N ,N-dimethylformamide
<p dir="rtl">15 ( (DiISOPROPYLETHYALAMINE), 2.95 mm molecular cm, 3 (and 472 (HATU) ػ ػ Malaki ػ M, 1.2 A</p>
<p dir="rtl">20 Magnesium sulfate, filtrate, and concentrate by elution. The residue was purified by a reverse-phase thermolysis (method G) giving 35# (600 mg, 66:);</p>
٤٠٦٩
-١٩٣-
LC-MS: m/z 926.6 [M+H+],
ZMV retention = 1.16 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [9.94 (br t, J=5 Hz) and 10.16-10.23 (br m), total 1H], 7.90 (d). , J=7.2 Hz, 2H), [7.71 (br d, J=7 Hz) and 8.06 (br d, 5 J=8 Hz), total 1H], 7.60-7.65 (m, 2H), 7.41 (br dd , J=7, 7 Hz, 2H), 7.15-7.36 (m, 7H), 3.29 (s, 3H), 1.16-1.22 (m, 3H).
Step 2. Synthesis:
N-methyl-L-valyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-[ (2-phenylethyl)amino]-3-thioxopropyl}pyrrolidin-1- 10 yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide (#36).
According to General Procedure A, from #35 (465 mg, 0.502 mM, 1 (5) dichloromethane mL, 0.1 mol) and 5 (diethylamine mL) the desired raw material is synthesized, which is purified by thermochromatography. M silica gel (gradient level: 0 to 15:10 methanol/dichloromethane) giving #36 (310 mg, 88:) a solid.
LC-MS: m/z 704.6 [M+H+],
time = 0.74 minutes; m/z: Slovak HRMS C38H66N5O5S: 704.4779; Found: 704.477 [+M+H];
1H NMR (400 MHz, CD3OD), presumed to be a mixture of rotamers, characteristic signals: δ 7.23-7.30 (m, 4H), 7.15-7.22 (m, 1H), [4.68 (d, 20
J=8.6 Hz) and 4.74 (d, J=8.0 Hz), total 1H], 3.39 and 3.40 (2 s, total 3H), 3.12 and 3.22 (2 br s, total 3H), [2.82 (d, J= 6.0 Hz) and 2.84 (d, J=6.0 Hz), total 1H], 2.29 and 2.30 (2 s, total 3H), [1.27 (d, J=6.8 Hz)
٤٠٦٩
-١٩٤-
and 1.29 (d, J=6.6 Hz), total 3H], [0.84 (t, J=7.4 Hz) and 0.87 (t, J=7.4
Hz), total 3H].
Illustration:
N-methyl-L-valyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3- 5 thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#41), N-Methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy- 3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-
thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L- 10 valinamide (#42)
<img file="SA4069B1_D0181.tif" />
Step 1. Synthesis:
methyl N-{(2R,3R)-3-[(2S)-1-(tert-butoxycarbonyl)pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate (#37). 15
٤٠٦٩
-١٩٥-
The 11) Dichloromethane, 0.3 Jeal, Jarm (and 3 (N-N-DIMTHYLFORMAMIDE Jarmam, 2 I have been completed ػ ػ ػ A
<p dir="rtl">5 2.03(L-phenylalanine methyl ester hydrochloride, 9.40 mm mol,</p>
<p dir="rtl">1 2 ml and 4.79 HATU, 12.2 mm mol, 1.3 ml. The reaction was stirred for 18 hours and then concentrated with the mixture. The residue was 100 ml (100 ethyl acetate). Successive questions M1 Hydrochloric acid: 2 x 50 ml (2 x 50 ml) and 1 mm. The muscle layer is dried with sodium sulfate, filtered and evaporated. ــــــــــــــــــــــــم</p>
<p dir="rtl">10 dichloromethane and filtered. The filtered material is purified by thermolysis of silica gel (gradient level: to 100: ethyl acetate m heptane) to give #37 (2.76 g, 65:) a white solid in Egypt.</p>
LC-MS: m/z 449.3 [M+H+], 349.2 [(M - Boc)+H+],
ZMV retention = 0.88 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 15 characteristic signals: δ 8.28 (d, J=8.2 Hz, 1H), 7.14-7.29 (m, 5H), 4.50 (ddd, J =10.9, 8.1, 4.4 Hz, 1H), 3.64 (s, 3H), 3.23 (s, 3H), 2.15-2.24 (m,
1H), 1.56-1.76 (m, 2H), 1.31-1.55 (m, 11H), 1.02 (d, J=6.6 Hz, 3H).
Step 2. Synthesis:
methyl N-{(2R,3R)-3-[(2S)-1-(tert-butoxycarbonyl)pyrrolidin-2-yl]-3- 20 methoxy-2-methylpropanethioyl}-L-phenylalaninate (#38).
Add thickening mixture #37 (1.52 mg, 3.39 mg, 1 ml). 21# (1.68 ml, 4.41 mg mol, 1.3 mol) acetonitrile (12 milliliters, 0.28 mol) to metro irradiation FD 100°C for one hour. Divide the mixture into two bowls
٤٠٦٩
-١٩٦-
and ethyl acetate. The aqueous layer is re-extracted with ethyl acetate. The combined organic layers are washed with 10 mM: 10 mM citric acid, dried with sodium sulfate, filtered, and centrifuged. The compound is made up of a small amount of ethyl acetate and is concentrated in silica. Purification by chromatography of silica gel (gradient level: to 30% ethyl 5 acetate heptane) U#38 (680 mg, 43:);
LC-MS: m/z 465.2 [M+H+], 487.3 [M+Na+], 365.2 [(M - Boc)+H+],
ZMV retention = 0.97 min;
HPLC (Protocol B): 465.2 [M+H+], 487.2 [M+Na+], 365.2 [(M -
Boc)+H+],
10 Retention time = 7,444 minutes (purity < 98:);
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 10.23 (br d, J=7.5 Hz, 1H), 7.17-7.28 (m, 5H), 5.24 (ddd, J =11, 7.5, 4.5 Hz, 1H), 3.66 (s, 3H), 3.28 (s, 3H), 3.21 (dd, J=14.3, 4.4 Hz, 1H), 3.07 (dd, J=14.2, 11.2 Hz, 1H), 2.65-2.74 (m, 1H),
<p>1.54- 1.71 (m, 2H), 1.37 (s, 9H), 1.17 (d, J=6.4 Hz, 3H). 15</p>
Step 3. Synthesis:
methyl N-{(2R,3R)-3-methoxy-2-methyl-3-[(2S)-pyrrolidin-2-
yl]propanethioyl}-L-phenylalaninate, hydrochloride salt (#39).
According to the chemical formula C, use 660 MgCl, 1.42 ml C Like
20 (1 ml) dioxane (10 ml, 0.14 ml) and 4 ml hydrochloric acid (20 ml) dioxane (80 ml). #39 (590 mg) is synthesized as a substance. Solid white plum from Egypt, which was used in the next step without further purification.
٤٠٦٩
-١٩٧-
LC-MS: m/z 365.2 [M+H+],
ZMV retention = 0.58 min;
1H NMR (400 MHz, DMSO-d6) δ 10.67 (d, J=7.7 Hz, 1H), 9.42-9.54 (br m, 1H), 8.21-8.33 (br m, 1H), 7.20-7.35 (br m, 5H ), 5.25 (ddd, J=11.1, 7.6, 4.4 Hz, 1H), 3.76 (dd, J=8.9, 3.0 Hz, 1H), 3.68 (s, 3H), 3.39 (s, 5
3H), 3.24 (dd, J=14.2, 4.5 Hz, 1H), 3.13 (dd, J=14.3, 11.0 Hz, 1H), 2.93-3.09 (m, 3H), 2.85-2.93 (m, 1H), 1.72 -1.84 (m, 1H), 1.36-1.60
(m, 3H), 1.22 (d, J=6.6 Hz, 3H).
Step 4. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-valyl-N- 10[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[( 1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-
thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#40).
15 According to the standard formula D, 8# (247 mg/ml, 0.387 mg/ml, 1 ml),
<p dir="rtl">#39 (186 mol C, ≤0.450 mol C, 1.2 mol), 10) dichloromethane ml, 0.04 mol 176 mg HATU, 0.464 mg mol, 2 (N,N-dimethylformamide milliliters), 1.2 ml and 189 ml of triethylamine, 1.35 ml of mol, 3.5 ml. The required substance is synthesized. Finally, the traces are transferred using a thermometer. 20 silica gel (graded level: SR: to 25: acetone m heptane) giving 40 #)410 mg, 90: On two steps (hard material with white plov, Egypt.</p>
LC-MS: m/z 984.7 [M+H+], 1006.7 [M+Na+],
٤٠٦٩
-١٩٨-
Loss retention time = 1.15 minutes; HPLC (Protocol C): Retention time = 9.683 minutes (purity <99):
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.19 (br d, J=7 Hz) and 10.49 (br d, J=8 Hz), total 1H], 7.90 (d, J=7.5 Hz, 2H), 7.60-7.65 (m, 2H), 7.38-7.45 (m, 2H), 5
<p>7.29 -7.35 (m, 2H), 7.14-7.28 (m, 5H), [5.20 (ddd, J=11, 7, 4 Hz) and 5.35-5.43 (m), total 1H], 3.65 and 3.69 (2 s) , total 3H), [1.15 (d, J=6.5</p>
Hz) and 1.18 (d, J=6.4 Hz), total 3H].
Step 5A. Synthesis:
N-methyl-L-valyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1- 10
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#41).
The millions of Malaga 0.03
<p dir="rtl">24.4 mg hydroxide, 1.02 mm mol, 2.5 ml water (5 ml). After 4 hours, the agent is completely concentrated and then boiled at a solid temperature of 3 ml Article 7 (dimethyl sulfoxide) (ml) and purified using reversed-phase chromatography (Method C, 7, stop x 1 ml). The appropriate fraction was separated (Genevac) before it was sealed.</p>
<p dir="rtl">20 A small amount of methanol or dichloromethane. The mixture is then atomized into a glassy solid. Next, diethyl ether is added, then heptane, and the mixture is shaken with Lithium oxide #41 (180 mg, 59:5): a white solid.</p>
LC-MS: m/z 748.6 [M+H+],
ZMV retention = 0.68 min;
٤٠٦٩
-١٩٩-
HPLC (Protocol A): 748.4 [M+H+],
Retention time = 6.922 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 12.9 and 13.1 (2 v br s, total 1H), [10.12 (br d, J=8 Hz) and 10.45 ( br d, J=8 Hz), total 1H], 8.75-8.90 (m, 2H), 8.62- 5
<p>8. 73 (br m, 1H), 7.13-7.29 (m, 5H), [5.20 (ddd, J=11, 7.5, 4 Hz) and 5.40 (ddd, J=11.5, 8, 4 Hz), total 1H], 4.55-4.73 (m, 2H), 3.23 and 3.25 (2 s, total 3H), 3.16 and 3.18 (2 s, total 3H), 2.97 and 3.01 (2 br s, total</p>
3H), 1.13-1.20 (m, 3H), 0.73-0.81 (m, 3H).
<p dir="rtl">10 Step 5B. Synthesis:</p>
N-methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S) -1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide (#42).
<p dir="rtl">15 According to the formula for A, 40# (561 mg, 0.570 mg mol, 1 mol),</p>
(10) dichloromethane ml, 0.057 mol) and 10 (diethylamine ml) 42# (348 mg, 80:) a white solid is synthesized after thermolysis of silica gel (gradient level: methanol to 10:00). dichloromethane(.
LC-MS: m/z 762.7 [M+H+],
20 ZMV retention = 0.74 min;
HPLC (Protocol A): 762.4 [M+H+],
Retention time = 7.315 minutes (purity <95):
٤٠٦٩
-٢٠٠-
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.20 (br d, J=7.5 Hz) and 10.50 (br d, J=8 Hz), total 1H], 7.95-8.03 (m, 1H), 7.15-7.29 (m, 5H), [5.20 (ddd) , J=11, 7.5, 5 Hz) and 5.39 (ddd, J=11, 7.5, 4 Hz, total 1H], [4.57 (dd, J=8.8, 8.7 Hz) and 4.61 (dd, J=8.7, 8.6 Hz), total 1H], 3.65 and 3.69 (2 s, total 5 3H), 3.24 and 3.25 (2 s, total 3H), 3.16 and 3.17 (2 s, total 3H), 2.96 and 2.99 (2 br s, total 3H), 2.69-2.79 (m, 1H), 2.62-2.68 (m, 1H), 2.14 and 2.15 (2 br s, total 3H), [1.15 (d, J=6.6 Hz) and 1.18 (d, J= 6.5 Hz), total 3H], [0.75 (t, J=7.4 Hz) and 0.76 (t, J=7.3 Hz), total 3H].
10 Illustration:
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}- 1-methoxy-2-methyl-3-
thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, hydrochloride salt (#44), 2-methylalanyl-N-[(3R) ,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1- 15
methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L -valinamide, hydrochloride salt (#45)
٤٠٦٩
-٢٠١-
<img file="SA4069B1_D0182.tif" />
<img file="SA4069B1_D0183.tif" />
Step 1. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-
3-methoxy-l-{(2S)-2-[(lR,2R)-l-methoxy-3-{[(2S)-l-methoxy-l-0X0-3-phenylpr0pan-2-yl]amin0} -2-methyl-3-thi0X0pr0pyl]pyrr0lidin-l- 5 11-5-018-1-001801401-4-1--06111--20100 06 (*43).
١٥
To a solution of 32# (321 mg, 0.881 mmol, 1 equiv) in dichloromethane (5 ml, 1.0 mol) and N,N-dimethylformamide (1 ml) add 39# (484 mg, <769. mmol, 0.9 equivalent), HATU (353 mg, 0.881 mmol/equivalent) and
2.64 mmol, 3 equiv). After stirring for 18 hours, the mixture was diluted with dichloromethane, washed with water and brine, dried over magnesium sulfate, filtered, and concentrated in silica by vacuum. The residue was purified by silica gel chromatography (gradient level: 0 to 30% acetone in heptane) to give 43# (574 mg, 68 in two steps) as a white solid.
LC-MS: m/z 956.6 [Μ + Η+],
٤٠٦٩
-٢٠٢-
Retention time = 4.49 minutes;
1H NMR (400 MHz, CD3OD), presumed to be a mixture of rotamers, characteristic signals: δ 7.80 (d, J=7.5 Hz, 2H), 7.64-7.72 (m, 2H), 7.16-7.35 (m, 7H) , [5.43 (dd, J=11, 4.5 Hz) and 5.58 (dd, J=11.5, 4 Hz), total 1H], 3.72 and 3.75 (2 s, total 3H), 3.34 and 3.35 (2 s, total 5 3H), 3.26 and 3.29 (2 s, total 3H), 3.05 and 3.11 (2 br s, total 3H), 1.39 and 1.40 (2 s, total 3H), [1.24 (d, J=6.7 Hz) and 1.29 ( d, J=6.4 Hz), total
3H].
Step 2A. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1- 10
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, hydrochloride salt(#44).
100 mg (100 mg, 0.105 mg) 15 ml (5 ml tetrahydrofuran, 0.02 mol) lithium hydroxide added.
(10 M. ػ After methanol, a molecule of dioxane is treated with a molecule of hydrochloric acid 4, and it is completely synthesized to give 44# (56 MG, 71: 20) as a white solid.
LC-MS: m/z 720.6 [M+H+],
ZMV retention = 0.67 min; HPLC (Protocol D): Retention time = 8.851 minutes;
٤٠٦٩
-٢٠٣-
1H NMR (400 MHz, CD3OD), presumed to be a mixture of rotamers, characteristic signals: δ 7.17-7.31 (m, 5H), 3.34 and 3.35 (2 s, total 3H), 3.10 and 3.16 (2 br s, total 3H), 1.62 and 1.64 (2 s, total 3H), 1.53 and 1.55 (2 s, total 3H), [1.26 (d, J=6.5 Hz) and 1.30 (d, J=6.5 Hz), total
3H], 0.84-0.91 (m, 3H). 5
Step 2B. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy -1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide, hydrochloride salt(#45). 10
In accordance with Regulation A, a mixture of #43 (176 mg, 0.184 mg mol, 1 mol), 4) dichloromethane mL, 0.05 mol) and 4 (diethylamine mL) are evacuated. The desired message is the other way around. Talk to you on your phone number. The resulting trifluoroacetic acid salt (method C) is treated with methanol, treated with 4 ml of 15 ml of hydrochloric acid and dioxane How to give #45 (100 mg, 70:) white plum solid.
LC-MS: m/z 734.6 [M+H+],
ZMV retention = 0.72 min;
1H NMR (400 MHz, CD3OD), presumed to be a mixture of rotamers, characteristic signals: δ 7.18-7.31 (m, 5H), 5.41-5.47 and 5.55-5.62 (2 20
m, total 1H), 3.73 and 3.76 (2 s, total 3H), 3.35 and 3.36 (2 s, total 3H), 3.10 and 3.15 (2 br s, total 3H), 1.62 and 1.64 (2 s, total 3H) , 1.53 and 1.55 (2 s, total 3H), [1.25 (d, J=6.6 Hz) and 1.29 (d, J=6.5 Hz), total
3H], 0.84-0.91 (m, 3H).
٤٠٦٩
-٢٠٤-
Illustration:
N2-[(1-Aminocyclopentyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan- 4-yl]-N-methyl-L-valinamide (#47)
Step 1. Synthesis:
10
15
N2-[(1-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}cyclopentyl)-carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2 -[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl [pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#46).
The Malaga, in the 19th), 0.944 mm Jazzam C Restaurant (28#) 600 mg, 0.944 mm diisopropylethylamine metrol, 2.83 mM kg, 3 mL and 444 HATU, 1.13 mL Ej Aramifum, 1.2 mtv). After stirring for two days, the mixture was concentrated and the residue was mixed with ethyl acetate (60 ml) and washed ml Compatible hydrochloric acid: 1 molecule, 1 ml, 1 ml
٤٠٦٩
-٢٠٥-
Sulfated, mixed with sodium sulfate, filtered, and concentrated by decoction. Dilute the residual material with dichloromethane and filter. The filtered material is separated after pressing a mixture of silica and is purified by chromatography with silica gel (gradient level: 40 to 100: ethyl acetate (heptane) to give 46# (644 mg, 69:6) a white colored solid.
LC-MS: m/z 991.8 [M+H+], 5
ZMV retention = 1.07 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.89 (br d, J=7.4 Hz, 2H), [7.77 (d, J=3.3 Hz) and 7.79 (d , J=3.3 Hz), total 1H], 7.66-7.76 (m, 2H), [7.62 (d, J=3.3 Hz) and 7.65 (d, J=3.3 Hz), total 1H], 7.37-7.44 (m , 2H), 7.11-7.36 (m, 10
7H), [5.38 (ddd, J=11, 8, 4 Hz) and 5.48-5.57 (m), total 1H], 3.13, 3.17, 3.18 and 3.24 (4 s, total 6H), 2.90 and 3.00 (2 br s, total 3H), [1.05 (d, J=6.6 Hz) and 1.09 (d, J=6.8 Hz), total 3H].
Step 2. Synthesis:
N2-[(1-aminocyclopentyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)- 15
2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-
thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#47).
500 mg, 0.504 mg Add 20 tetrahydrofuran (8) ml, 0.06 ml (diethylamine 4 ml).
Stirring for 18 hours, the reaction mixture was concentrated by vacuum and the residue was purified by diluting silica gel (gradient level: methanol to 10 m dichloromethane), giving #47 (374 mg, 96:) a white solid .
٤٠٦٩
-٢٠٦-
LC-MS: m/z 769.6 [M+H+],
ZMV retention = 0.70 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.64 (br d, J=8.4 Hz) and 8.87 (br d, J=8.6 Hz), total 1H], [8.22 (br d, J=9.4 Hz) and 8.26 (br d, J=9.4 Hz), total 1H], 5
[7.77 (d, J=3.3 Hz) and 7.80 (d, J=3.3 Hz), total 1H], [7.63 (d, J=3.1 Hz) and 7.66 (d, J=3.3 Hz), total 1H], 7.13-7.31(m, 5H), [5.39(ddd,
J=11.1, 8.5, 4.2 Hz) and 5.54 (ddd, J=11.7, 8.8, 4.1 Hz), total 1H], [4.53 (dd, J=9.2, 7.6 Hz) and 4.64 (dd, J=9.2, 6.6 Hz), total 1H], 3.16, 3.20, 3.21 and 3.25 (4 s, total 6H), 2.93 and 3.03 (2 br s, total 3H), 10
[1.05 (d, J=6.8 Hz) and 1.10 (d, J=6.6 Hz), total 3H], 0.73-0.80 (m,
3H).
Illustration:
N2-[(1-Aminocyclopropyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-oxo-3-{[(1S)-2-phenyl-1-(1,3- 15
thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#51), 1-amino-N- [(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -{[(1S)-
2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3- methyl-1-oxobutan-2- 20 yl]cyclohexanecarboxamide (#52)
٤٠٦٩
-٢.٧-
<img file="SA4069B1_D0184.tif" />
Step 1: Synthesis:
(2R,3R)-3-methoxy-2-methyl-N-[(lS)-2-phenyl-l-(l,3-thiazol-2-y!)ethyl]-3-[(2S)-pyrrolidin -2-yl]propanamide, trifluoroacetic acid salt and
(3R,4S,5S)-4-[{N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L- 5
valyl}(methyl)amino]-3-methoxy-5-methylheptanoic acid (*48).
To a solution of 16# (1 g, 2.11 mg, 1 equiv) and 5** (1.22 g,
2.11 mmol, 1 eq) in dichloromethane (2.0 mmol, 1.0 mol) at 0°C add trifluoroacetic acid (6 ml). After 3 hours, he concentrates
» 1 Vacuum the mixture to give the mixture 48# (8.1 g), which is used in the next step without further purification;
IC-MS (Protocol K): m/z 374.2 [ΜΗ],
Retention time = 20093 minutes, [+525.2 [Μ+Η, retention time = 40875 minutes.
٤٠٦٩
-٢٠٨-
Step 2. Synthesis:
N2-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy- 2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl- 1-
oxoheptan-4-yl]-N-methyl-L-valinamide (#49). 5
to 48# mol (1.8 mol, ≤2.1 mol mol, 1 mol) and diethyl
1,2-dimethoxyethane (0.51) cyano phosphonate (DEPC), 3.2 mm mol, 1.5 ml (30 ml) 1,2-dimethoxyethane Add 1.47 milliliters of triethylamine, 10.6 milliliters of triethylamine molecule. (5 ml). After stirring at 10°C for two hours, the mixture is agitated by vacuum and the residue is purified by diluting the gel (10 ml of silica: to 50 ml of ethyl acetate (petroleum ether). #49) 0.8 g , 45:(.
methanol: 0.6 Rf m dichloromethane(;
LC-MS (Protocol K): m/z 881.3 [M+H+], 903.3 [M+Na+],
15 Retention time = 4.837 minutes.
Step 3. Synthesis:
N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S) -2-phenyl-1-(1,3-thiazol-2-
yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#50). 20
According to Evacuation Standard A, 49# (0.70 mg/ml, 0.79 mg/ml, 1 ml) 1 molecule (10 milliliters of diethylamine) and 10 milliliters of diethylamine
٤٠٦٩
-٢٠٩-
Synthesis of 50# (160 mg, 30:) after purification by thermochromatography with silica gel (gradient level: methanol to 5 m dichloromethane).
methanol: 0.4 Rf m dichloromethane (10)
LC-MS (Protocol K): m/z 658.3 [M+H+], 680.3 [M+Na+],
5 ZMV retention = 2.760 minutes.
Step 4A. Synthesis:
N2-[(1-aminocyclopropyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-oxo-3-{[(1S)-2-phenyl-1-(1,3-
thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#51). 10
100 ml, 0.15 ml kgfgm qfgfgfg part rmfgfgm, 1 mfgf,
70 ,Brop(bromotris(dimethylamino)phosphonium hexafluorophosphate
ml, 0.18 mg mol, 1.2 ml and 0.08 mg diisopropylethylamine, 0.45 mg ml, 3 mol. Dichloromethane (15 milliliters, 0.01 mol)
15 (c) At 0°C add 18(1-aminocyclopropanecarboxylic acid) mg,
0.18 mg mol, 1.2 ml). After two hours, the mixture was lysed with water and extracted with two parts of ethyl acetate. The organic layers mixed with sodium sulfate were dried, filtered, and agitated. The waste material was then purified chromatography rm silica gel) Gradual level: 0: to 5: methanol m dichloromethane) giving 51# (45 mg, 34:).
20 methanol:10(0.5 Rf m.)dichloromethane
LC-MS (Protocol L): m/z 741.44 [M+H+];
٤٠٦٩
-٢١٠-
1H NMR (300 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.64 (br d, J=8 Hz) and 8.88 (br d, J=8 Hz), total 1H], [8.16 (br d, J=9 Hz) and 8.22 (br d, J=10 Hz), total 1H], [7.77 (br d, J=3.5 Hz) and 7.79 (d, J=3.5 Hz), total 1H ], [7.63 (d, J=3.5 Hz) and 7.65 (d, J=3 Hz), total 1H], 7.10-7.32 (m, 5H), 5.33-5.60 (m, 1H), 3.16, 5
3.20, 3.21 and 3.26 (4 s, total 6H), 2.93 and 3.02 (2 br s, total 3H), [1.05 (d, J=6.3 Hz) and 1.10 (d, J=6.3 Hz), total 3H].
Step 4B. Synthesis:
1-amino-N-[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2- 10 yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1- oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]cyclohexanecarboxamide(#52).
to 50 #molmol (120 mg, 0.18 mmol, 1 mol), 84) Prop 15 mg, 0.21 mmol ml, 1.2 ml and 0.1 ml diisopropylethylamine, 0.54 mol mol, 3 Dichloromethane (15 milliliters, 0.009 milliliters) at °C add 31 (1-aminocyclohexanecarboxylic acid) milliliters, 0.21 millimeters of mol After two hours, the mixture was quenched with water and extracted with two times more ethyl acetate. The organic layers mixed with sodium sulfate are dried, filtered, and triturated 20 times a day. The residual material is purified by chromatography with silica gel (gradient level: 0: to 5: methanol to dichloromethane) to give 52# (50 mg, 35:).
methanol:10(0.6 Rf m.)dichloromethane
LC-MS (Protocol K): m/z 783.79 [M+H+];
٤٠٦٩
-٢١١-
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.64 (br d, J=8 Hz) and 8.87 (br d, J=9 Hz), total 1H], 8.18-8.28 (m, 1H), [7.77 (d, J=3.5 Hz) and 7.80 (d, J=3.3 Hz), total 1H], [7.63 (d, J=3.3 Hz) and 7.66 (d, J =3.3 Hz), total 1H], 7.127.31 (m, 5H), 5.35-5.43 and 5.49-5.57 (2 m, total 1H), [4.51 (dd, J=9, 5
8 Hz), and 4.61 (dd, J=9, 7 Hz), total 1H], 3.16, 3.19, 3.21 and 3.25 (4 s, total 6H), 2.93 and 3.02 (2 br s, total 3H), [1.05 ( d, J=6.8 Hz) and
<p>1.10 (d, J=6.8 Hz), total 3H].</p>
Illustration:
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1- 10
methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-
yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#54)
<img file="SA4069B1_D0185.tif" />
<p dir="rtl">15 Step 1. Synthesis:</p>
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-
3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-
2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#53).
٤٠٦٩
-٢١٢-
According to the general procedure D, from 32# (2.05 g, 2.83 mg mol, 1 mol) m
<p dir="rtl">(20 ml dichloromethane, 0.1 mol) and 3 (N,N-dimethylformamide ml), 19# 2.5 (ml amine, 3.4 mol, 1.2 ml) HATU, 1.29 mol, 3.38 mol. 100 (1.57) triethylamine ml, 11.3 mol</p>
<p dir="rtl">5 (Garm, 4%) The required raw material is synthesized and purified by chromatography of silica gel.</p>
(Graduated level: R: to 55: acetone m heptane), production of 53# (2.42 C, 74:) solid material.
LC-MS: m/z 965.7 [M+H+], 987.6 [M+Na+],
ZMV retention = 1.04 min;
HPLC (Protocol A): m/z 965.4 [M+H+], 10
Retention time = 11,344 minutes (purity <97):
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.86-7.91 (m, 2H), [7.77 (d, J=3.3 Hz) and 7.79 (d, J=3.2) Hz), total 1H], 7.67-7.74 (m, 2H), [7.63 (d, J=3.2 Hz) and 7.65 (d, J=3.2 Hz), total 1H], 7.38-7.44 (m, 2H), 7.30-7.36 (m, 2H), 7.11- 15
<p>7 30 (m, 5H), [5.39 (ddd, J=11.4, 8.4, 4.1 Hz) and 5.52 (ddd, J=11.7, 8.8, 4.2 Hz), total 1H], [4.49 (dd, J=8.6, 7.6 Hz) and 4.59 (dd, J=8.6, 6.8 Hz), total 1H], 3.13, 3.17, 3.18 and 3.24 (4 s, total 6H), 2.90 and</p>
<p>3 00 (2 br s, total 3H), 1.31 and 1.36 (2 br s, total 6H), [1.05 (d, J=6.7)</p>
Hz) and 1.09 (d, J=6.7 Hz), total 3H]. 20
Step 2. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{ [(1S)-2-phenyl-1-(1,3-thiazol-2-
٤٠٦٩
-٢١٣-
yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#54).
A. Come on the rest of the desired material, 5, it will be transmitted to the desired, the level of Term t: to 10: methanol kg dichloromethane). The evaporating substance contains diethyl ether and heptane and is concentrated by lysing with Lithium oxide #54 (406 mg, 75:) a white colored solid.
LC-MS: m/z 743.6 [M+H+],
ZMV retention = 0.70 min;
HPLC (Protocol A): m/z 743.4 [M+H+], 10
Retention time = 6.903 minutes, (purity <97:);
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.64 (br d, J=8.5 Hz) and 8.86 (br d, J=8.7 Hz), total 1H], [8.04 (br d, J=9.3 Hz) and 8.08 (br d, J=9.3 Hz) , total 1H], [7.77 (d, J=3.3 Hz) and 7.80 (d, J=3.2 Hz), total 1H], [7.63 (d, J=3.3 Hz) 15 and 7.66 (d, J=3.2 Hz ), total 1H], 7.13-7.31 (m, 5H), [5.39 (ddd, J=11, 8.5, 4 Hz) and 5.53 (ddd, J=12, 9, 4 Hz), total 1H], [4.49 (dd, J=9, 8 Hz) and 4.60 (dd, J=9, 7 Hz), total 1H], 3.16, 3.20, 3.21 and 3.25 (4 s, total 6H), 2.93 and 3.02 (2 br s, total 3H), 1.21 (s, 3H), 1.13 and 1.13 (2 s, total 3H), [1.05 (d, J=6.7 Hz) and 1.10 (d, J=6.7 Hz), total 3H], 0.73- 20
0.80 (m, 3H).
Illustration:
٤٠٦٩
-٢١٤-
2-Methylalanyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[ (2-phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide, acetic acid salt (#56)
<img file="SA4069B1_D0186.tif" />
<img file="SA4069B1_D0187.tif" />
<img file="SA4069B1_D0188.tif" />
<img file="SA4069B1_D0189.tif" />
<img file="SA4069B1_D0190.tif" />
Step 1. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-{(3R,4S,5S)-
3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-phenylethyl)amino]propyl}pyrrolidin-1-yl] -5-methyl-1-oxoheptan-4-yl}-
N-methyl-L-valinamide (#55). 10
The millions of Malah Jealmam Jar (32#) 156 m, 0.256 mm molecule, c, a, 0.9, (, 135) (, 135) diisopropylethylamine mM, 0.768 mM, 3 mL (120 mg HATU, 0.307 mM, 1.2 mL).
15 Stirring for 18 hours, the mixture was concentrated by vacuum and the residue was removed with 10 ml (10 ml) of ethyl acetate, washed with an appropriate solution of 1 ml of hydrochloric acid (2 x 5 ml) and 1 ml of hydrochloric acid. Dry sodium sulfate, filter, The filtered material is separated from dichloromethane and filtered after pressing with silica and purified by filtration
٤٠٦٩
-٢١٥-
Traumatology of silica gel (gradient level: SR: to 100: ethyl acetate m heptane) giving #55 (44 mg, 19:) solid substance with white puff.
LC-MS: m/z 884.5 [M+2H+],
ZMV retention = 1.04 minutes.
<p dir="rtl">5 Step 2. Synthesis:</p>
2-methylalanyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[ (2-phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide, acetic acid salt (#56).
<p dir="rtl">10 MGLV MGGF 55# (44 MGGF, 0.050 mg MGGF kgfg</p>
1 (Tetraydrofuran milliliter, 0.05 molecules c The one who is the one who is the one who is the one who is the one who is the one). 49:(A solid substance.
LC-MS: m/z 660.8 [M+H+],
15 ZMV retention = 2.23 min;
HPLC (Protocol A): m/z 660.5 [M+H+], 682.4 [M+Na+],
Retention time = 6.865 minutes.
Illustration:
2-Methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{ [(1- 20 phenylcyclopropyl)methyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#60)
٤٠٦٩
-٢١٦-
<img file="SA4069B1_D0191.tif" />
Step 1. Synthesis of 1@#1-(1-phenylcyclopropyl)methanamine.
1-phenylcyclopropanecarbonitrile (1-phenylcyclopropanecarbonitrile) 50 mg, 0.34 mol, 1 ml (500 ml tetrahydrofuran, 0.7 mol) at °C
<p dir="rtl">5 Add 23 grams of lithium aluminum hydride, 0.35 mol, 1.03 mol. The reaction mixture is stirred at 0°C for 1 hour and then the steam is re-condensed for 1 hour. Cooled after E, the reaction mixture is quenched with water (23 15 ml) and 15 ml of sodium hydroxide (69 ml). The mixture was filtered and rinsed with Littor 1@# (36 g, 72:).</p>
LC-MS: m/z 148.1 [M+H+],
10 ZMV retention = 0.86 min;
1H NMR (400 MHz, CDCl3) δ 7.2-7.4 (m, 5H), 2.78 (s, 2H), 1.19 (br s,
2H), 0.72-0.84 (m, 4H).
Step 2. Synthesis:
tert-butyl(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1-
phenylcyclopropyl)methyl]amino}propyl]pyrrolidine-1-carboxylate (#57). 15
According to Standard D, 2.15 mg (2.15 g, 7.48 mmol, 1.1 ml) dichloromethane (20 ml, 0.3 mol) and 4) N,N-dimethylformamide.
٤٠٦٩
-٢١٧-
ml(1@# 1.001) 1-(1-phenylcyclopropyl)methanamine, 6.799 mM
HATU molecule, 1 mA, 3.10 HATU, 8.16 mg (gm, 1.2 m)
And 2.84 milliliters of triethylamine, 20.4 milliliters of molasses, 3 ml (3 ml) of the required raw material is synthesized. Purification by chromatography of silica gel (gradient level: p.r.: to 100:
<p dir="rtl">5 ethyl acetate (m heptane), production of 57# (1.93 g, 68:) solid.</p>
HPLC (Protocol A at 45°C): [+m/z 417.3[M+H, retention time = 10.575 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers: δ 7.75-7.81 (m, 1H), 7.20-7.27 (m, 4H), 7.12-7.19 (m, 1H), 3.33-3.62 and 3.71-3.80 (br multiplets, total 4H), 3.28 (s, 3H), 2.97-3.17 (br m, 10 2H), 2.14-2.24 (br m, 1H), 1.67-1.80 (br m, 2H), 1.45 -1.65 (m, 2H), 1.41
(s, 9H), 1.00 (d, J=6.6 Hz, 3H), 0.67-0.93 (m, 4H).
Step 3. Synthesis:
(2R,3R)-3-methoxy-2-methyl-N-[(1-phenylcyclopropyl)methyl]-3-[(2S)-pyrrolidin-2-yl]propanamide, hydrochloride salt (#58). 15
According to general procedure C, Mn 57# (566 mg, 1.36 mM, 1 mol) m
<p dir="rtl">4 #58 is synthesized (#58 is synthesized) 466 MG, 97:(;</p>
LC-MS: m/z 318.2 [M+H+], 339.2 [M+Na+], 20
ZMV retention = 0.56 min;
1H NMR (400 MHz, DMSO-d6) δ 9.53 (br s, 1H), 8.48 (br s, 1H), 8.11 (br dd, J=5.7, 5.6 Hz, 1H), 7.23-7.30 (m, 4H) , 7.14-7.21 (m, 1H), 3.58
٤٠٦٩
-٢١٨-
(dd, J=7.5, 3.9 Hz, 1H), 3.50 (dd, J=13.7, 6.3 Hz, 1H), 3.34 (s, 3H), 3.21-3.29 (br m, 1H), 3.18 (dd, J= 13.8, 5.0 Hz, 1H), 3.04-3.13 (br m, 2H), 2.42-2.50 (m, 1H), 1.56-1.89 (m, 4H), 1.04 (d, J=6.9 Hz, 3H), 0.71- 0.91 (m, 4H).
<p dir="rtl">5 Step 4. Synthesis:</p>
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)- 1-methoxy-2-methyl-3-oxo-3-{[(1-
phenylcyclopropyl)methyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#59).
10 According to the general rule D, mn 32# (550 mg, 0.902 mg mol, 1 mol),
<p dir="rtl">#58 (350 mg, 0.992 mol/ml, 1.1 ml (10 dichloromethane, 0.08 ml) and 2) N,N-dimethylformamide ml), 446 mg (HATU), 1.17 mmol/ml kg, 1.3 m (and 0.503 milliliters of triethylamine, 3.61 milliliters of molasses, 4 liters of water) and the required raw material is synthesized, purified by silica gel chromatography.</p>
15 (Graduated level: SR: to 30: acetone m heptane), production #59 (618 mg, 69:) white puff pastry solid, Egypt.
LC-MS: m/z 908.7 [M+H+], 930.7 [M+Na+],
Loss retention time = 1.07 minutes; HPLC (Protocol B at 45°C): 908.5 m/z
[+M+H], retention time = 8.721 minutes (purity <97:);
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 20 characteristic signals: δ 7.89 (d, J=7.5 Hz, 2H), 7.38-7.44 (m, 2H), 7.30-7.36 (m , 2H), [4.49 (dd, J=8.5, 7.8 Hz) and 4.59 (dd, J=8.7, 6.9 Hz), total 1H], 4.18-4.26 (m, 3H), 3.93-4.01 (br m, 1H). ), 3.23 and 3.26
<p>(2 s, total 3H), 3.16 and 3.16 (2 s, total 3H), 2.91 and 3.05 (2 br s, total</p>
٤٠٦٩
-٢١٩-
3H), 1.36 and 1.37 (2 br s, total 3H), 1.30 and 1.32 (2 br s, total 3H), [1.00 (d, J=6.7 Hz) and 1.02 (d, J=6.6 Hz), total 3H ], 0.67-0.78 (m, 7H).
Step 5. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1- 5
methoxy-2-methyl-3-oxo-3-{[(1-phenylcyclopropyl)methyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L -valinamide (#60).
According to the formula A, 59# (605 ml, 0.666 ml mol, 1 mol) 10 ml dichloromethane, 0.067 ml (and 10 (diethylamine milliliters)).
Synthesis 60# (379 mg, 83:):
HPLC (protocol a at 45°C): [+m/z 685.5 [M+H, storage time = 7.072 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.03 (br d, J=9.6 Hz) and 8.07 (br d, J=9.4 Hz), 15 total 1H] , [7.74 (br dd, J=7, 4 Hz) and 7.99 (br dd, J=5.9, 5.7 Hz), total 1H], 7.20-7.27 (m, 4H), 7.11-7.17 (m, 1H), [4.49 (dd, J=9, 7 Hz) and 4.58 (dd, J=9, 7.5 Hz), total 1H], 3.96-4.04 (br m, 1H), 3.24 and 3.27 (2 s, total 3H), 3.18 and 3.19 (2 s, total 3H), 2.93 and 3.07 (2 br s, total
3H), 1.20 and 1.21 (2 s, total 3H), 1.12 and 1.14 (2 s, total 3H), [1.00 20
(d, J=6.7 Hz) and 1.03 (d, J=6.7 Hz), total 3H].
Illustration:
٤٠٦٩
-٢٢٠-
2-Methylalanyl-N-[(3R04S,5S)-l-{(2S)-2-[(lR,2R)-3-{[2-(cyclohepta-
2,4,6-060-1-)810110001-1-08110-2-0181-3-
0X0pr0pyl]pyrr0lidin-J-yl}-3-meth0xy-5-methyl-]-0X0heptan-4-yl]-N-methyl-L-valinamide (#66)
<img file="SA4069B1_D0192.tif" />
Step 1. Synthesis of (61*)cyclohepta-2,4,6-trien-l-ylacetonitrile.
To a solution of anhydrous acetonitrile (3.12 mL, 56.2 mmol, 1 equiv) in tetrahydrofuran (281 mL, 0.2 mol) add lithium diisopropylamine (8.1 mol).
0 1 0010000/110802806/180008 3102 milliliters, 56.2 mmol, 1 equiv) at -078°C. After 20 minutes at -78°C, tropylium tetrafluoroborate (10 g, 56 mmol, 1 eq) is added. After 10 minutes, the reaction is concentrated by vacuum and the residue is diluted with ethyl acetate and washed with water. The organic layer is dried over sodium sulfate, filtered, and concentrated by vacuum to produce a brown oil, which is purified by analysis.
5 1 Silica gel chromatography (gradient level: 0 to 0 1 ethyl acetate in heptane) to provide 61# (1.88 g, 25^) aseptate in a smaller color.
1Η NMR (400 MHz, CDCI3) δ 6.69-6.71 (m, 2Η), 6.27-6.32 (m, 2Η), 5.28-5.33 (m, 2Η), 2.61 (d, J=702 Hz, 2Η), 2.26- 2.34 (m, 1Η).
٤٠٦٩
-٢٢١-
Step 2. Synthesis of (62#)2-(cyclohepta-2,4,6-trien-1-yl)ethanamine.
To a suspension of 911 mg (lithium aluminum hydride, 24 mm mol, 1.4 ml) diethyl ether (75 ml, 0.23 mol) at 0°C, add it Slowly, dripping over 15 minutes, ml #61 (2.25 gmol, 17.2 mg/mol, 1 liter (15 mL) of diethyl ether). The reaction is brought to a boiling point. After 5
After a few hours, the reaction is cooled to 0°C and quenched with water (1 ml), then filtered for a short time on a Celite filter and washed with methanol. The mixture is dried. Sodium sulfate, filtered, and triturated using Lithium ion (#62) 1.683 C, 73: (Tzeit Plov, Hebm.
LC-MS: m/z 136.1 [M+H+],
10 ZMV retention = 0.23 min;
1H NMR (400 MHz, CDCl3) δ 6.64-6.67 (m, 2H), 6.16-6.21 (m, 2H), 5.16-5.21 (m, 2H), 2.84-2.89 (m, 2H), 1.86-1.92 (m , 2H), 1.62-1.70
(m, 1H).
Step 3. Synthesis:
tert-butyl (2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1- 15
yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidine-1-carboxylate (#63).
11# (3.57 mm, 12.4 mm). (100 ml dichloromethane, 0.1 mol) and 4) N,N-dimethylformamide
20 (Add 5.36 mM HATU, 13.7 mM, 1.1 mol). After 20 minutes, add 5.20 mL (triethylamine, 37.3 mM, 3 mol). Then 62 # )1.68 C, 12.4 mm mol The mixture was stirred for 18 hours. The agent was equilibrated by elution and the residue was separated from ethyl acetate and washed with water (50 ml). The layer was extracted again.
٤٠٦٩
-٢٢٢-
ethyl acetate (3 m) of aqueous water. The combined organic layers are dried, filtered, and triturated with litholyte. Littor 63 # (2.95 liters, productivity 59:) Viscous lubrication.
LC-MS: m/z 405.4 [M+H+], 427.4 [M+Na+],
<p dir="rtl">5 ZMV retention = 0.75 min;</p>
1H NMR (400 MHz, CDCl3), presumed to be a mixture of rotamers: δ 6.63-6.68 (m, 2H), 6.16-6.23 (m, 2H), 5.19 (br dd, J=9.0, 5.8 Hz, 2H) , 3.51-3.63 and 3.71-3.90 (2 br multiples, total 3H), 3.42 (s, 3H), 3.183.29 and 3.34-3.47 (2 br multiples, total 3H), 2.27-2.45 (br m, 1H), 1.6-2.00 (m, 7H), 1.47 and 1.50 (2 br s, total 9H), 1.16-1.29 (br m, 10 3H).
Step 4. Synthesis:
Step 4. Synthesis of (2R,3R)-N-[2-(cyclohepta-2,4,6-trien-1-yl)ethyl]-3-methoxy-2-methyl-3-[(2S)-pyrrolidin -2-yl]propanamide, hydrochloride
salt (#64) 15
Treats the medium compound #63 (400 mg, 0.989 mg mol, 1 ml) 4 mol of hydrochloric acid (10 mol) dioxane ml, 40 ml (Gm, 40 ml). An hour and a half later, the The compound mixture is made up of 1 ml of sodium hydroxide, 1 ml of dichloromethane . It takes 20 minutes to extract the aqueous layer with dichloromethane and dry the various organic layers with sodium sulfate, filter, and agitate with #64 liquid. (301 mg, tm) lubrication in Panama, which slowly begins to harden at a certain temperature.
LC-MS: m/z 305.3 [M+H+],
٤٠٦٩
-٢٢٣-
ZMV retention = 0.54 min; HPLC (Protocol G): Retention time = 4.848 minutes;
1H NMR (400 MHz, CDCl3), characteristic signals: δ 6.64-6.67 (m, 2H), 6.16-6.22 (m, 2H), 6.08-6.14 (br m, 1H), 5.16-5.22 (m, 2H), 3.44 (s, 3H), 3.31 (dd, J=6.3, 4.5 Hz, 1H), 2.98-3.04 (m, 1H), 2.94 (ddd,
J=10.5, 7.2, 5.6 Hz, 1H), 2.81 (ddd, J=10.5, 7.7, 6.7 Hz, 1H), 2.57 (qd, 5 J=7.1, 4.5 Hz, 1H), 1.90-1.97 (m, 2H) ), 1.49-1.55 (m, 1H), 1.18 (d,
J=7.1 Hz, 3H).
Step 5. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[ 2-(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1- 10
methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-
oxoheptan-4-yl]-N-methyl-L-valinamide (#65).
According to General Procedure D, 32# (678 mg, 0.937 mM, 1 mL)
<p dir="rtl">Dichloromethane (9.37 milliliters, 0.1 mol), 64 #300 (mg amine, 0.985</p>
15 Millions of J.Atza Arama Make a molecule, 3, 3, (to give up the required material, the time Irm silica gel (gradient level: sr: to 50: acetone m heptane), production of #65 (546 mg, 65:) solid.
LC-MS: m/z 896.7 [M+H+], 918.7 [M+Na+],
20 ZMV retention = 1.06 minutes.
Step 6. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1- yl)ethyl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٢٢٤-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#66).
The 65# 540 (540) Jealmam Jarm (TRITYAYALAMINE milliliter (5) and decreases, and the one is the case. It is necessary to stretch the scandal And it:
HPLC (protocol A at 45°C): [+m/z 674.5 [M+H, retention time = 7.015 minutes.
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 10 characteristic signals: δ [8.03 (br d, J=9 Hz) and 8.05 (br d, J=9 Hz), total 1H] , [7.77 (br dd, J=5.5, 5.5 Hz) and 7.98 (br dd, J=5.5, 5.5 Hz), total 1H], 6.54-6.65 (m, 2H), 6.10-6.19 (m, 2H), 5.11-5.19 (m, 2H), [4.48 (dd, J=9, 8 Hz) and 4.54 (dd, J=9, 7.5 Hz), total 1H], 3.94-4.04
(br m, 1H), 3.26 and 3.29 (2 s, total 3H), 3.17 and 3.19 (2 s, total 3H), 15
<p>2.93 and 3.06 (2 br s, total 3H), 1.20 and 1.21 (2 s, total 3H), 1.12 and</p>
<p>1.13 (2 s, total 3H), [1.04 (d, J=6.8 Hz) and 1.07 (d, J=6.7 Hz), total</p>
3H].
Illustration:
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1- 20
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#69), 2-methylalanyl-N-[(3R,4S, 5S)-3-methoxy-
1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-
٤٠٦٩
-٢٢٥-
phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#70)
<img file="SA4069B1_D0193.tif" />
<img file="SA4069B1_D0194.tif" />
Step 1. Synthesis:
methyl N-{(2R,3R)-3-methoxy-2-methyl-3-[(2S)-pyrrolidin-2- 5
yl]propanoyl}-L-phenylalaninate, hydrochloride salt (#67).
According to the formula C, 37# (2.39 mol, 5.33 ml, 1 mol), 10 ml dioxane, 0.53 mol 40 ml hydrochloric acid (4 mol) dioxane 10 ml, 40 ml c rms, 7.5%) #67 (2.21 c) is synthesized
<p dir="rtl">10 White fluff solid matter, which is used in the next step for further purification.</p>
LC-MS: m/z 349.2 [M+H+],
ZMV retention = 0.53 min;
1H NMR (400 MHz, DMSO-d6) δ 9.45-9.58 (br m, 1H), 8.63 (d, J=8.1 Hz, 1H), 8.51-8.62 (br m, 1H), 7.25-7.33 (m, 4H ), 7.18-7.25 (m, 1H),
٤٠٦٩
-٢٢٦-
<p>4.50 (ddd, J=10.8, 8.1, 4.5 Hz, 1H), 3.65 (s, 3H), 3.54 (dd, J=6.8, 4.5 Hz, 1H), 3.20 (s, 3H), 3.11 (dd, J= 13.8, 4.5 Hz, 1H), 2.99-3.14 (br m, 3H), 2.89 (dd, J=13.8, 10.9 Hz, 1H), 2.44-2.50 (m, 1H, assumed;</p>
partially obscured by solvent peak), 1.77-1.89 (m, 1H), 1.60-1.73 (m, 2H), 1.46-1.57 (m, 1H), 1.05 (d, J=6.8 Hz, 3H). 5
Step 2. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)- 1-methoxy-3-{[(2S)-1-methoxy-1-
oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (# 68). 10
According to General Procedure D, from #32 (353 mg, 0.488 mM, 1 liter (10) mM dichloromethane, 0.04 mM), #67 (271 mM). ـ،
≤0.588 mM, 1.3 mol, 223 HATU, 0.586 mmol, 1.2 mol and 238 diisopropylethylamine mol, 1.71 mmol M, 3.5
<p dir="rtl">15 The desired substance is synthesized, which is then purified using thermochromatography and silica gel (grading level: grade: to 40: acetone). (404 mg heptane) Lithium ion 68# (404 mg, 88: two-step feeding) solid substance.</p>
LC-MS: m/z 940.7 [M+H+], 962.7 [M+Na+],
ZMV retention = 1.04 min; HPLC (Protocol C): Retention time = 9.022 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 20 characteristic signals: δ [8.25 (br d, J=8 Hz) and 8.48 (br d, J=8 Hz), total 1H] , 7.89 (d, J=7.4 Hz, 2H), 7.67-7.75 (m, 2H), 7.38-7.44 (m, 2H), 7.31-7.36 (m, 2H), 7.14-7.24 (m, 5H), 4.43 -4.69 (m, 3H), 4.17-4.26 (m, 3H), 3.91-3.99 (br m, 1H), 3.63 and 3.65 (2 s, total 3H), 3.19 and
٤٠٦٩
-٢٢٧-
<p>3.24 (2 s, total 3H), 3.14 and 3.15 (2 s, total 3H), 2.90 and 2.99 (2 br s, total 3H), 1.36 and 1.37 (2 br s, total 3H), 1.30 and 1.32 (2 s , total 3H),</p>
[1.02 (d, J=6.8 Hz) and 1.06 (d, J=6.6 Hz), total 3H].
Step 3A. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1- 5
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#69).
143 ml, 0.152 ml. 10 mg (10 ml) tetrahydrofuran (5 ml, 0.02 mol) added 5 ml of lithium hydroxide
(9.10 mg, 0.378 mg mol, 2.5 mol) H2O (3 ml). After 5 hours, the reaction is agitated, boiling at a boiling temperature of three meters heptane, y, ab m 2.2 (dimethyl sulfoxide ml) and purified by reverse-phase chromatography (Method C) to give 69# (56 mg, 52:).
<p dir="rtl">15 HPLC (protocol A at 45°C): [+m/z 704.4 [M+H, retention time = 6.623 minutes;</p>
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 8.08-8.22 and 8.37-8.49 (2 m, total 5H), 7.127.28 (m, 5H), 3.18, 3.20 20
[1.02 (d, J=6.8 Hz) and 1.05 (d, J=6.6 Hz), total 3H], 0.74-0.81 (m,
3H).
Step 3B. Synthesis:
٤٠٦٩
-٢٢٨-
2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy -1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide (#70).
<p dir="rtl">5 According to the formula for A, 68# (240 mg, 0.255 mg mol, 1 mol),</p>
10 (Dichloromethane milliliter, 0.026 molecules C Restaurant (and 10 (Diethylamine milliliter (giving up 70) 120) And Abu Tahdat with a Silica) Silica) 10 10 :methanol GFGF
)dichloromethane
10 HPLC (Protocol A at 45°C): m/z 762.7 [M+H] [+740.4 [M+Na+], retention time = 6.903 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.26 (d, J=8.1 Hz) and 8.49 (d, J=8.3 Hz), total 1H], [8.03 (d, J=9.5 Hz) and 8.07 (d, J=9.5 Hz), total 1H], 7.14-7.27 (m,
5H), 3.63 and 3.67 (2 s, total 3H), 3.16, 3.18, 3.20 and 3.25 (4 s, total 15 6H), 2.92 and 3.01 (2 br s, total 3H), 1.20 and 1.22 (2 s, total 3H), 1.12 and 1.13 (2 s, total 3H), [1.02 (d, J=6.8 Hz) and 1.06 (d, J=6.7 Hz), total
3H], 0.74-0.80 (m, 3H).
Illustration:
N2-[(3-Aminoxetan-3-yl)carbonyl]-N-{(3R,4S,5S)-3-methoxy-1- 20
[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1 -oxoheptan-4-yl}-N-methyl-L-valinamide, acetic acid salt (#75)
٤٠٦٩
-٢٢٩-
<img file="SA4069B1_D0195.tif" />
<img file="SA4069B1_D0196.tif" />
<img file="SA4069B1_D0197.tif" />
<img file="SA4069B1_D0198.tif" />
Step 1. Synthesis of 3-[(tert-butoxycarbonyl)amino]oxetane-3-carboxylic acid (#71).
To 1(1-aminooxetane-3-carboxylic acid, 8.54 mM, 1
<p dir="rtl">5 Add 15 milliliters of dioxane, 0.5 milliliters of dioxane, 38.7 milliliters of sodium hydroxide, 38.7 milliliters of Irmm, 4.5 liters of water (15 ml) of di-2.09) tert-butyl dicarbonate, 9.29 mol.</p>
10 The organic layer was dried with sodium sulfate, filtered, and triturated to give #71 (633 mg, 38:) a white solid.
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers: δ 12.93 (br s, 1H), 7.59 and 7.93 (2 br s, total 1H), 4.71-4.78 (m, 2H),
4.47 (d, J=6.4 Hz, 2H), 1.30 and 1.38 (2 s, total 9H).
15 Step 2. Synthesis:
٤٠٦٩
-٢٣٠-
N2-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy- 2-methyl-3-oxo-3-[(2-phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-
N-methyl-L-valinamide (#72).
5 To 5@# (9.47 ml, 18 mm ml, 1 ml) and 24# (5.90 ml, 18 ml).
(add 9.52) diisopropylethylamine milliliter, 54.2 mmol gm, 3 mM, 8.49) HATU gm, 21.7 mM gm, 1.2 The mixture was stirred for 18 hours and then concentrated by solution. The residue was left with 300 milliliters of ethyl acetate and washed with the entire mixture.
10 Hydrochloric acid is mixed with 1 ml (2 x 100 ml) and 1 mol How would you like to see the following text?
250 (Dichloromethane Mellit (and Roma). R: ػ Don't let it go.
LC-MS: m/z 797.6 [M+H+], 819.6 [M+Na+], 15
ZMV retention = 1.06 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 3.26 and 3.28 (2 s, total 3H), 3.18 and 3.20 (2 s, total 3H), 2.95 and 3.10 (2 br s, total 3H), 1.01-1.09 (m, 3H), 0.67
0.78 (m, 3H). 20
Step 3. Synthesis:
N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-phenylethyl) )amino]propyl}pyrrolidin-1-yl]-5-methyl-1-
oxoheptan-4-yl}-N-methyl-L-valinamide (#73).
٤٠٦٩
-٢٣١-
To 72# (5.16 gmol, 6.47 mg mol, 1 ml) tetrahydrofuran (10 ml, 0.65 ml) diethylamine (10 ml). After 1 hour In this case, the reaction is concentrated with salt and the residue is purified by chromatography. m silica gel (gradient level: 0: to 10: methanol m dichloromethane) giving #73 (2414 mg, 65:).
LC-MS: m/z 576.5 [M+H+], 5
ZMV retention = 0.64 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.80-7.88 and 7.99-8.10 (2 m, total 1H), 7.147.31 (m, 5H), 3.17 and 3.18 (2 s, total 3H), 2.87 and 3.03 (2 br s, total
3H), 1.02-1.08 (m, 3H). 10
Step 4. Synthesis:
N2-({3-[(tert-butoxycarbonyl)amino]oxetan-3-yl}carbonyl)-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R) ,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-
oxoheptan-4-yl}-N-methyl-L-valinamide (#74). 15
Add 73# (100 mg, 0.174 mg, 1 liter) of dichloromethane (4 ml, 0.04) and 0.5 (0.5) N,N-dimethylformamide (45.2 mg, 0.208 mm). GF, 1.2 HATU, 3 methylene diisopropylethylamine, 0.521 mg mol, 3 methylene diisopropylethylamine (THC). 0.260 mg ml,
20 1.5 %. After 16 hours, the reaction is shaken off and the residue is ethyl acetate (6).
ml) and washed with appropriate 1 ml hydrochloric acid (2 x 2 ml) and 1 ml. The organelle layer is dried with sodium sulfate, filtered, and centrifuged. The raw material is purified by dilution of the phase chromatography (Method C). #74 (140 mg), which is used in the next step without further purification.
٤٠٦٩
-٢٣٢-
LC-MS: m/z 774.7 [M+H+], 796.6 [M+Na+],
XMV retention 0.91 minutes.
Step 5. Synthesis:
N2-[(3-aminooxetan-3-yl)carbonyl]-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy- 2-methyl-3-oxo-3-[(2- 5
phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-
N-methyl-L-valinamide, acetic acid salt (#75).
The 74# 140# (140) (Dichloromethane Mellett, 0.06 Jealm Jarm (1 (TRIFLUOROACECICICIC) 10 milliliters). The mixture was mixed with ethyl acetate (6 milliliters) and washed with 2 milliliters of sodium bicarbonate (2 milliliters). The organic layer was dried with sodium sulfate, filtered, and filtered. Half of the raw material was purified using a thermoelectric method (method B) giving No. 75 (16). Majjafyfym, 26:, Alaqafyf in two steps).
LC-MS: m/z 674.6 [M+H+], 15
Loss retention time = 0.68 minutes; HPLC (protocol A at 45°C): 674.5 m/z
[+M+H], retention time = 7.128 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.80-7.87 and 8.02-8.07 (2 m, total 2H), 7.23
<p>7.30 (m, 2H), 7.14-7.22 (m, 3H), 4.28-4.33 (m, 2H), 3.96-4.04 (br m, 20 1H), 3.17 and 3.19 (2 s, total 3H), 2.96 and 3.10 (2 br s, total 3H), [1.04</p>
(d, J=7.0 Hz) and 1.07 (d, J=6.6 Hz), total 3H].
Illustration:
٤٠٦٩
-٢٣٣-
N,2-Dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1 -methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl- L-valinamide (#79), N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-
2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2- 5 methyl-3-thioxopropyl]pyrrolidin-1-yl}-3- methoxy-5-methyl-1-
oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#80)
<img file="SA4069B1_D0199.tif" />
Step 1. Synthesis:
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[{N-[(9H-fluoren-9- 10)
ylmethoxy)carbonyl]-L-valyl}(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanethioyl}-L-
phenylalaninate (#76).
According to general procedure D, 5@# m (260 mg, 0.648 mmol, 1 mol), 15#39 (340 mg, ≤0.629 mmol). GFGFfgfgfgrmfgfgm, 1 mF, 10) dichloromethane
Milliliters, 0.065 milliliters, 0.065 milliliters, 0.778 milliliters, 0.778 milliliters ml, 1.2 h) and 339 mmol diisopropylethylamine, 1.94 mmol, 3 h.
٤٠٦٩
-٢٣٤-
Composing the desired content, etc., the words are navigated by following the following steps: (gradient level: p. To 40: acetone ml heptane) to give #76 (466 mg, 83: in two steps) a solid.
LC-MS: m/z 871.5 [M+H+], 893.5 [M+Na+],
<p dir="rtl">5 Loss retention time = 1.10 minutes; HPLC (Protocol C): Retention time = 9.249 minutes (purity <99):</p>
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.19 (br d, J=7.4 Hz) and 10.49 (br d, J=7.8 Hz), total 1H], 7.89 (br d, J=7.4 Hz, 2H), 7.68-7.75 (m, 2H), 7.54-7.60
(m, 1H), 7.41 (br dd, J=7.4, 7.4 Hz, 2H), 7.28-7.36 (m, 2H), 7.15-7.28 10
<p>(m, 5H), [5.20 (ddd, J=10.9, 7.3, 4.4 Hz) and 5.34-5.43 (m), total 1H], 3.65 and 3.69 (2 s, total 3H), 3.24 and 3.25 (2 s, total 3H), 3.17 (br s, 3H), 2.93 and 2.98 (2 br s, total 3H), [1.15 (d, J=6.6 Hz) and 1.18 (d,</p>
J=6.6 Hz), total 3H].
<p dir="rtl">15 Step 2. Synthesis:</p>
methyl N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(L-valyl)amino [heptanoyl}pyrrolidin-2-yl]-2-methylpropanethioyl}-L-phenylalaninate (#77).
According to the formula A, 20 ml (460 mg, 0.528 mg mol, 1 ml) 20 ml tetrahydrofuran, 0.07 mol (and 8 (diethylamine milliliters) are synthesized
<p dir="rtl">#77 (399 mg), which uses the next step without further purification;</p>
LC-MS m/z 649.5 [M+H+],
ZMV retention = 0.73 min;
٤٠٦٩
-٢٣٥-
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic product signals: δ [10.20 (d, J=7.4 Hz) and 10.49 (d, J=7.4 Hz), total 1H], 7.15 -7.28 (m, 5H), [5.20 (ddd, J=10.9, 7.2, 4.5 Hz) and 5.34-5.42 (m), total 1H], 3.65 and 3.68 (2 s, total 3H), 3.24 and 3.25 (2 s, total 3H), 3.15 and 3.15 (2 s, total 3H), 2.83 and 2.88 (2 br s, total 5 3H), [1.15 (d, J=6.6 Hz) and 1.18 (d, J=6.6 Hz) , total 3H].
Step 3. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) )-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3- 10
thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#78).
According to the general definition D, Mn 77# (399 mol, ≤0.52 mmol, 1 mol), 213) N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanine mol GFGF,
<p dir="rtl">15 0.628 milliliters of dichloromethane, 0.1 milliliters of dichloromethane, 0.628 milliliters of dichloromethane</p>
C. ػ The abandonment of the required material, the one that is transmitted in the same way Varied: SR: to 50: acetone (m heptane) #78 (231 mg, 46: in two steps).
LC-MS: m/z 970.7 [M+H+], 992.6 [M+Na+], 20
ZMV retention = 1.11 min; HPLC (Protocol C): Retention time = 9.260 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.19 (d, J=7.4 Hz) and 10.47 (d, J=7.8 Hz), total 1H], 7.89 ( d, J=7.4 Hz, 2H), 7.61-7.67 (m, 2H), 7.41 (br dd, J=7.4,
٤٠٦٩
-٢٣٦-
7.4 Hz, 2H), 7.14-7.36 (m, 8H), [5.20 (ddd, J=11, 7, 5 Hz) and 5.38 (ddd, J=11, 8, 4 Hz), total 1H], [4.41 (dd, J=8.6, 8.4 Hz) and 4.46 (dd, J=8.2, 8.2 Hz), total 1H], 3.65 and 3.68 (2 s, total 3H), 3.23 and 3.24 (2 s, total 3H), 3.13 (br s, 3H), 2.88 and 2.93 (2 br s, total 3H), 2.84 and 2.85 (2 s, total 3H), 1.31 and 1.32 (2 s, total 3H), [1.15 (d, J=6.6 Hz ) 5 and 1.18 (d, J=6.4 Hz), total 3H].
Step 4A. Synthesis:
N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1 -methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N- 10 methyl -L-valinamide (#79).
In accordance with Regulation A, a mixture of #78 (223 mg, 0.230 mg mol, 1 mol), 6 (dichloromethane mL, 0.04 mol) and 6 (diethylamine mL) is evacuated. Q #79 (146 MG, 85:) It is also possible to use silicone rubber bands to remove polystyrene foam.
<p dir="rtl">15 (Gradient level: t: to 5: methanol m heptane) T: to 10: methanol</p>
)dichloromethane m
HPLC (protocol A at 45°C): [+749.4[M+H, retention time = 7.315 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.20 (d, J=7.6 Hz) and 10.50 (d, J=8.0 Hz), total 1H], 7.79- 7.88 (m, 1H), 7.15-7.29 (m, 5H), [5.20 (ddd, J=11, 7, 4 20
Hz) and 5.38 (ddd, J=11, 8, 4 Hz), total 1H], [4.50 (dd, J=8.8, 8.6 Hz) and 4.56 (dd, J=9, 8 Hz), total 1H], 3.65 and 3.69 (2 s, total 3H), 3.24 and 3.25 (2 s, total 3H), 3.16 (br s, 3H), 2.93 and 2.97 (2 br s, total 3H),
2.10 and 2.11 (2 s, total 3H).
٤٠٦٩
-٢٣٧-
Step 4B. Synthesis:
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino }-1-methoxy-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt ( #80). 5
The 78# (170) 04 molecules c Water (1.5 ml). After stirring overnight, remove the water from the liquid. The residue is boiled at a boiling point of three meters with 10 heptane. After that, the residue is reduced to 2.2 milliliters (dimethyl sulfoxide) and purified by reverse-phase chromatography (Method C) with 80# litho (74 mg, 58:) solid.
LC-MS: m/z 734.6 [M+H+],
ZMV retention = 0.69 min; HPLC (protocol A at 45°C): [+734.4[M+H, retention time = 6.903 minutes (purity <96:):);
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 15 characteristic signals: δ 12.9 and 13.1 (2 v br s, total 1H), [10.12 (d, J=7.4 Hz) and 10.46 (d, J=7.8 Hz), total 1H], 8.77-8.89 (br m, 2H), [ 8.47 (d, J=8.6 Hz) and 8.51 (d, J=8.6 Hz), total 1H], 7.21-7.29 (m, 4H), 7.14-7.21 (m, 1H), [5.16-5.23 (m) and 5.38 (dd, J=11.3, 8.2, 3.9 Hz), total 1H], [4.51 (dd, J=9.0, 9.0 Hz) and 4.57 (dd, J=9.4, 8.6 Hz), total 20 1H], 3.24 and 3.24 (2 s, total 3H), 3.18 and 3.19 (2 s, total 3H), 2.96 and 3.00 (2 br s, total 3H), 1.51 and 1.53 (2 s, total 3H), 1.40 and 1.42
(2 s, total 3H), 1.14-1.19 (m, 3H), 0.74-0.81 (m, 3H).
Illustration:
٤٠٦٩
-٢٣٨-
N,2-Dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[( 1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N -methyl-L-valinamide (#84)
<img file="SA4069B1_D0200.tif" />
<img file="SA4069B1_D0201.tif" />
10
15
Step 1. Synthesis:
N2-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy- 2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1 -
oxoheptan-4-yl]-N-methyl-L-valinamide(#81).
According to the formula D, 5@# (620 mg) 1.18 mol C, 1 mol (10) dichloromethane, 0.1 mol amine magnesium (18#604) amine magnesium, 1.42
Approximately C. (It is the abandonment of the required material, which is not possible Irm silica gel (gradient level: p: to 30: acetone m heptane) giving #81 (737 mg, 58:).
HPLC (Protocol C): Retention time = 9.235 minutes;
٤٠٦٩
-٢٣٩-
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.81 (br d, J=8 Hz), total 1H], 7.89 (d, J=7.6 Hz, 2H), [7.80 (d, J=3.3 Hz) and 7.83 (d, J=3.1 Hz), total 1H], 7.70-7.75 (m, 2H), [7.64 (d , J=3.1 Hz) and 7.68 (d, J=3.3 Hz), total 1H], 7.55-7.60 (m, 1H), 7.38-7.44 (m, 2H), 7.13-7.35 (m, 5
7H), [6.31 (ddd, J=11, 8, 4.5 Hz) and 6.40-6.48 (m), total 1H], 3.23 and 3.24 (2 s, total 3H), 3.17 and 3.22 (2 s, total 3H) , 2.94 and 3.01 (2 br s, total 3H), [1.14 (d, J=6.4 Hz) and 1.17 (d, J=6.2 Hz), total 3H].
Step 2. Synthesis:
N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 10
3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-
thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#82).
According to general procedure A, from 81# (733 mg, 0.818 mM, 1 mL, 15 mM dichloromethane, 0.1 mol) and 7 (diethylamine mL) are synthesized.
<p dir="rtl">#82 (670 mg), which uses the next step without further purification.</p>
LC-MS: m/z 674.5 [M+H+],
ZMV retention = 1.29 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic product signals: δ [10.55 (br d, J=8 Hz) and 10.84 (br d, 20 J=8 Hz), total 1H ], [7.64 (d, J=3.1 Hz) and 7.69 (d, J=3.3 Hz), total 1H], 7.13-7.33 (m, 5H), 6.27-6.35 and 6.38-6.47 (2 m, total 1H) , 3.23 and 3.25 (2 s, total 3H), 3.15 and 3.19 (2 s, total 3H), 2.84 and 2.91 (2 br s, total 3H).
٤٠٦٩
-٢٤٠-
Step 3. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) )-1-methoxy-2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl] amino}-3-
thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L- 5 valinamide(#83).
According to general procedure D, from #82 (670 mg, >0.818 mmol, 1 mol), 5) ml dichloromethane, 0.16 mol γ-N-[(9H-fluoren 304(ylmethoxy)) carbonyl]-N,2-dimethylalanine mg, 0.896 mM mol,
<p dir="rtl">10 1.1 , 1.2</p>
And 440 (diisopropylethylamine microliters, 2.53 mg/mol, 3.1 ml) is used to synthesize the desired substance How much was transferred using the silica gelatin mixture (gradient level: SR: to 30: acetone m heptane) giving 83# (556 mg, 69: On two steps (.
LC-MS: m/z 994.7 [M+H+],
<p dir="rtl">15 Loss retention time = 0.69 minutes; HPLC (Protocol C): Retention time = 9.333 minutes (purity <98):</p>
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.53 (br d, J=8 Hz) and 10.80 (br d, J=8 Hz), total 1H], 7.86-7.91 (m, 2H), [7.80 (d, J=3.3 Hz) and 7.82 (d, J=3.2 Hz), total 1H], [7.64 (d, J=3.2 Hz) and 7.68 (d, J =3.2 Hz), total 1H], 7.62- 20
<p>7.66 (m, 2H), 7.38-7.44 (m, 2H), 7.28-7.36 (m, 5H), 7.19-7.26 (m, 2H), 7.12-7.17 (m, 1H), [6.31 (ddd, J= 11, 8, 4.5 Hz) and 6.44 (ddd, J=11, 8.5, 4.5 Hz), total 1H], [4.42 (dd, J=9, 8 Hz) and 4.48 (dd, J=8, 8 Hz) , total 1H], 3.22 and 3.24 (2 s, total 3H), 3.13 and 3.17 (2 s, total</p>
٤٠٦٩
-٢٤١-
3H), 2.89 and 2.97 (2 br s, total 3H), 2.84 and 2.85 (2 s, total 3H), [1.13 (d, J=6.4 Hz) and 1.16 (d, J=6.4 Hz), total 3H] .
Step 4. Synthesis:
N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[( 1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}- 5 3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]- N-methyl-
L-valinamide (#84).
In accordance with General Procedure A, from #83 (552 mg, 0.555 mol, 1 liter (10) dichloromethane ml, 0.05 mol (10) diethylamine ml) 10 is synthesized. Methanol, Silica, and purchase, and we will be seen. 10: Methanol Dichloromethane (Give 84#) 406 m, 95: (solid white feld.
LC-MS: m/z 772.8 [M+H+],
Loss retention time = 1.35 minutes; HPLC (Protocol 774.4 [M+H+]):A, retention time = 15 7.390 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [10.54 (br d, J=8 Hz) and 10.81 (br d, J=8 Hz), total 1H], 7.78-7.84 (m, 2H), [7.65 (d, J=3.1 Hz) and 7.69 (d, J=3.3 Hz), total 1H], 7.29-7.34 (m, 2H), 7.20-7.28 (m, 2H ), 7.14-7.19 (m, 1H), 6.27-6.35 and 6.40-6.48 (2 m, total 1H), [4.51 (dd, J=9, 8 Hz) and 4.57 20
(dd, J=9, 8 Hz), total 1H], 3.24 and 3.25 (2 s, total 3H), 3.16 and 3.21
<p>(2 s, total 3H), 2.94 and 3.00 (2 br s, total 3H), 2.09 and 2.10 (2 s, total</p>
3H), 1.08 and 1.09 (2 s, total 3H), 0.73-0.80 (m, 3H).
٤٠٦٩
-٢٤٢-
to prepare :
N,2-Dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-l-{(2S)-2-[(lR,2R)-l-methoxy-2-methyl-3-oxo-3 -{[(lS)-2-phenyl-l-(l,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-l-yl}-5-methyl-l-oxoheptan-4-yl]- N-methyl-L-valinamide (#88) 5
<img file="SA4069B1_D0202.tif" />
TFA, CH2CI2 quantitative
<img file="SA4069B1_D0203.tif" />
Step 1. Synthesis:
N2-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-[(3R,4S,5S)-3-methoxy-l-{(2S)-2-[(lR,2R)-l-methoxy- 2-methyl-3-oxo-3-{[(lS)-2-phenyl-l-(1,3-1820-2-)011000)propyl]pyrrolidin-l-yl}-5-methyl-l-10 oxoheptan-4-yl]-N-methyl-l-valinamide (#85).
To a mixture of 65 (5.48 g, 10.4 mmol, 1 equiv) and 19# (3.90 g, 10.4 mmol, 1 equiv) in dichloromethane (0.5 ml, 0.2 mol) Add diisopropylethylamine (5.51 mL, 3103 mmol, 3 15 equiv) and then ΗΑ6υ (1 409 g, 12 mmol, 1.2 equiv). After stirring overnight, the reaction mixture was concentrated by vacuum. The residue was removed in ethyl acetate (100 ml) and washed with 1 mol hydrochloric acid (302 ml) and saline (30 ml). The organic layer was dried over sodium sulfate, filtered, and concentrated by vacuum.
٤٠٦٩
-٢٤٣-
The waste material is removed from dichloromethane and filtered; The filtered material is purified by chromatography with silica gelatin (gradient level: grade: 50: acetone, heptane) to 85#7 20 J, 78: (solid matter.
LC-MS: m/z 880.6 [M+H+],
5 ZMV retention = 1.07 minutes.
Step 2. Synthesis:
N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S) -2-phenyl-1-(1,3-thiazol-2-
yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide (#86). 10
According to the standard formula A, 85 ml (5 ml, 5.68 mg ml, 1 ml). (10 tetrahydrofuran ml, 0.56 mol) and 3 (diethylamine ml) The required raw material is synthesized, which is purified by thermochromatography. m silica gel (gradient level: 0: to 10: methanol m dichloromethane) giving 86# (2.952 g, 79:) solid substance.
LC-MS: m/z 658.5 [M+H+], 680.5 [M+Na+], 15
ZMV retention = 0.66 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.64 (br d, J=8.4 Hz) and 8.90 (br d, J=8.8 Hz), total 1H], [7.77 (d, J=3.3 Hz) and 7.80 (d, J=3.3 Hz), total 1H], [7.63 (d, J=3.3 Hz) and 7.66 (d, J=3.3 Hz), total 1H], 7.12-7.31 (m, 5H), [5.39 20
(ddd, J=11.2, 8.4, 4.2 Hz) and 5.54 (ddd, J=11.9, 8.9, 4.0 Hz), total 1H], 3.15, 3.19, 3.20 and 3.26 (4 s, total 6H), 2.86 and 2.98 ( 2 br s, total
3H), [1.06 (d, J=6.6 Hz) and 1.11 (d, J=6.6 Hz), total 3H].
٤٠٦٩
-٢٤٤-
Step 3. Synthesis:
N-(tert-butoxycarbonyl)-N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2 -methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino} propyl]pyrrolidin-1-yl}-5-methyl-1 -
oxoheptan-4-yl]-N-methyl-L-valinamide (#87). 5
Coated mixture 86# (80.3 mg/ml, 0.122 mg/ml). ml, 1 ml (ml 4) dichloromethane ml, 0. 03 (Adds N-(tert 29.1(butoxycarbonyl)-N,2-dimethylalanine Mg) 0.134 mg. Garmimg molecule, 1.1 ml (thiol 64) diisopropylethylamine microliter, 0.365 mg Garmimg molecule, 3
10 (M) and 71.7 mol HATU, 0.183 mm mol, 1.5 mol. After stirring overnight, shake the reaction mixture to 6 (eth). yl acetate (ml) and rinse with ml of hydrochloric acid. 1 ml (2 x 2 ml) and 1 ml. The organic liquid must be extracted from sodium sulfate, filtered, and filtered. The waste material is removed from dichloromethane and filtered; The main focus of the facility is based on the following link: 15 grams of gelatin silica (gradient level: grade: to 50: acetone, heptane)
Littor No. 87 (58 mg, 50): Solid material with white puff.
LC-MS: m/z 857.7 [M+H+], 879.7 [M+Na+],
ZMV retention = 0.99 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.64 (br d, J=8 Hz) and 8.87 (br d, J=9 Hz), 20 total 1H] , [7.77 (d, J=3.3 Hz) and 7.80 (d, J=3.3 Hz), total 1H], [7.63 (d, J=3.2 Hz) and 7.66 (d, J=3.2 Hz), total 1H] , 7.13-7.31 (m, 5H), [6.95 (br d, J=8 Hz) and 7.06 (br d, J=8 Hz), total 1H], 5.35-5.42 and 5.515.58 (2 m, total 1H ), 3.15, 3.19, 3.20 and 3.26 (4 s, total 6H), 2.94 and
٤٠٦٩
-٢٤٥-
<p>3.03 (2 br s, total 3H), 2.83 and 2.84 (2 s, total 3H), [1.05 (d, J=6.7 Hz) and 1.11 (d, J=6.7 Hz), total 3H].</p>
Step 4. Synthesis:
N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -{[(1S)-2-phenyl-1-(1,3-thiazol-2- 5 yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl] -N-methyl-L-valinamide (#88).
MGLV MGGF 87# 58 MGGF, 0.068 mg MGGF Add 1 ml of dichloromethane (8 ml). After stirring for a while, add 1 ml.
10 At night, shake the mixture with water. The waste material was divided into 10 milliliters (ethyl acetate), washed with 10 milliliters of sodium bicarbonate, dried with sodium sulfate, filtered, and triturated to give 88# (52 mg, ml).
LC-MS 757.6 [M+H+],
ZMV retention = 0.69 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 15 characteristic signals: δ [8.64 (br d, J=8.6 Hz) and 8.87 (br d, J=8.6 Hz), total 1H], 7.80-7.85 (m, 1H), [7.77 (d, J=3.3 Hz) and 7.80 ( d, J=3.1 Hz), total 1H], [7.63 (d, J=3.1 Hz) and 7.66 (d, J=3.3 Hz), total 1H], 7.207.31 (m, 4H), 7.13-7.19 ( m, 1H), [5.39 (ddd, J=11, 8.5, 4 Hz) and 5.49-5.56 (m), total 1H], [4.51 (dd, J=9, 8 Hz) and 4.61 (dd, J= 9, 8 Hz), 20 total 1H], 3.16, 3.20, 3.21 and 3.25 (4 s, total 6H), 2.94 and 3.03 (2 br s, total 3H), 2.10 and 2.10 (2 s, total 3H), 1.16 (br s, 3H), 1.04-1.12 (m, 6H), 0.72-0.80(m, 3H).
٤٠٦٩
-٢٤٦-
Illustration:
N2-(3-Amino-2,2-dimethylpropanoyl)-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2 -methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1 -oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#95)
<img file="SA4069B1_D0204.tif" />
10
15
Step 1. Synthesis:
3-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}-2,2-dimethylpropanoic acid (#93).
250) 3-amino-2,2-dimethylpropanoic acid, hydrochloride salt to
mg, 1.63 mmol, 1 mol (4 dichloromethane), 0.4 mmol (add 859) diisopropylethylamine ml, 4.88 mmol Mgm, 3 Mgm. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFGFCFGFVVVVVVV Throughout ػ Carbonyl Chloride, 1.79 millimeters, J. I. The residue is separated into 3 ml (ethyl acetate) and washed with 1 ml hydrochloric acid (1 x 2 ml). The organic layer is dried under sodium sulfate, filtered, and purified by chromatography (GRM silica gel) Gradual level: 0: to 100: ethyl acetate (heptane) giving #93 (250 mg, 45:) lubrication.
٤٠٦٩
-٢٤٧-
1H NMR (400 MHz, DMSO-d6) δ 12.22 (s, 1H), 7.89 (d, J=7.4 Hz, 2H), 7.72 (d, J=7.4 Hz, 2H), 7.38-7.44 (m, 2H) , 7.27-7.35 (m, 3H), 4.18
4.30 (m, 3H), 3.16 (d, J=6.2 Hz, 2H), 1.05 (s, 6H).
Step 2. Synthesis:
N2-(3-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}-2,2- 5
dimethylpropanoyl)-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-
methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5- methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide (#94).
10 to #86 (100 mg, 0.152 mM, 1 H) M dichloromethane
(4 ml, 0.038 mol) and 0.5 ml (N,N-dimethylformamide) add #93 (51.6 mg, 0.152 mol, 1 mol) Then 80 (diisopropylethylamine) liter, 0.457 mmol, 3 (89.8 mg) HATU, 0.229 mg mol, 1.5 mol. The mixture is stirred for 18 hours and then concentrated with the solution. Leave the substance What is the difference?
15 ethyl acetate (6 milliliters) and washed with a suitable 1 ml of hydrochloric acid.
(2 x 2 milliliters) and 1 milliliter. The organic layer is dried with sodium sulfate, filtered, and filtered with elution. The filtrate is divided into 250 milliliters of dichloromethane and filtered Rheumatoid arthritis silica (Grade level: 0: to 50: acetone m heptane) Lithium 94# (90 mg, 60:) a white colored solid.
LC-MS: m/z 979.8 [M+H+], 1002.7 [M+Na+], 20
ZMV retention = 1.15 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic product signals: δ [8.64 (br d, J=8.6 Hz) and 8.86 (br d, J=8.6 Hz), total 1H] , 7.86-7.91 (m, 2H), [7.77 (d, J=3.3 Hz) and 7.79 (d,
٤٠٦٩
-٢٤٨-
J=3.3 Hz), total 1H], 7.67-7.73 (m, 2H), [7.63 (d, J=3.3 Hz) and 7.65 (d, J=3.3 Hz), total 1H], 6.87-6.95 (m, 1H), [5.39 (ddd, J=11, 8, 4 Hz) and 5.52 (ddd, J=11.5, 9, 4 Hz), total 1H], [4.44 (dd, J=8.4, 8.4 Hz) and 4.55 (dd, J=8.4, 8.4 Hz), total 1H], 3.16, 3.20, 3.21 and 3.25 (4 s, total 6H), 2.96 and 3.06 (2 br s, total 3H), 0.69-0.77 (m, 3H) . 5
Step 3. Synthesis:
N2-(3-amino-2,2-dimethylpropanoyl)-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2 -methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1 -
oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#95). 10
to 94# (86 mg, 0.088 mol/ml, 1 liter (1 mol) tetrahydrofuran ml, 0.04 mol/diethylamine ml). After stirring overnight, the reaction was concentrated by vacuum and transferred. The subject behind the night Trommatogoma erm abnormalities (method C) give #95 (55 mg, 72:).
LC-MS: m/z 757.5 [M+H+], 15
ZMV retention = 0.74 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [8.66 (br d, J=8 Hz) and 8.92 (br d, J=9 Hz), total 1H], [7.91 (br d, J=8 Hz) and 7.97 (br d, J=9 Hz), total 1H], [7.78 (br d, J=3.3 Hz) and 7.81 (d, J=3.1 Hz), total 1H ], 7.65-7.74 (br m, 3H), 20
[7.63 (d, J=3.3 Hz) and 7.67 (d, J=3.3 Hz), total 1H], 7.12-7.31 (m, 5H), [5.35-5.42 (m) and 5.45-5.52 (m), total 1H], [4.44 (dd, J=9, 9 Hz) and 4.55 (dd, J=9, 9 Hz), total 1H], 3.17, 3.20, 3.22 and 3.25 (4 s, total 6H), 2.96 and 3.05 (2 br s, total 3H), 1.25 and 1.25 (2 s, total 3H), 1.14 and
٤٠٦٩
-٢٤٩-
1.15 (2 s, total 3H), [1.06 (d, J=6.6 Hz) and 1.10 (d, J=6.4 Hz), total 3H], 0.72-0.80 (m, 3H).
Illustration:
N2-(3-Amino-2,2-dimethylpropanoyl)-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2 -methyl-3-oxo-3-[(2- 5
phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#97)
<img file="SA4069B1_D0205.tif" />
Step 1. Synthesis:
N2-(3-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}-2,2- 10
dimethylpropanoyl)-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[( 2-phenylethyl)amino]propyl}pyrrolidin-1-
yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide (#96).
to #73 (100 mg, 0.174 mM, 1 H) M dichloromethane
15 (4 ml, 0.04 mol) and 0.5 ml (N,N-dimethylformamide) add #93
(59.1 mg ml, 0.174 mg ml, 1 ml. Stir the mixture. For a period of 18 hours, then it starts with the blank, leaving the remaining content in the morning
٤٠٦٩
-٢٥٠-
<p dir="rtl">ethyl acetate (6 milliliters) and washed with an appropriate 1 molecule of hydrochloric acid (2 x 2 milliliters) and 1 mol mol. The organic layer is dried with sodium sulfate, filtered, and shaken If purification by chromatography of silica gel (level Gradient: R R: to 50: acetone m heptane) U R #96 (102 mg, 65:) a solid substance with white puff.</p>
LC-MS: m/z 896.7 [M+H+], 918.8 [M+Na+], 5
ZMV retention = 1.14 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic product signals: δ 7.88 (d, J=7.4 Hz, 2H), [7.83 (br dd, J=6, 5 Hz) and 8.03 (br dd, J=6, 5 Hz), total 1H], 7.67-7.73 (m, 2H), 7.36-7.48 (m, 3H), 7.22-7.35 (m, 4H), 7.13-7.21 (m, 3H), 6.86-6.96 10
(m, 1H), [4.44 (dd, J=8.6, 8.6 Hz) and 4.50 (dd, J=8.6, 8.6 Hz), total 1H], 3.18, 3.19, 3.26 and 3.29 (4 s, total 6H), 2.96 and 3.11 (2 br s, total 3H), 0.70-0.77 (m, 3H).
Step 2. Synthesis:
N2-(3-amino-2,2-dimethylpropanoyl)-N-{(3R,4S,5S)-3-methoxy-1- 15
[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-phenylethyl)amino]propyl}pyrrolidin-1-yl]-5-methyl-1 -oxoheptan-4-yl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#97).
to 96# (98 mg, 0.11 mM, 1 ml tetrahydrofuran, 0.04 mol (diethylamine 0.5 ml). After stirring overnight, the solution was centrifuged and purified The hidden topic Using the trophozoite trophozoite (Method C) give 97# (58 mg, 68:).
LC-MS: m/z 674.4 [M+H+], 696.4 [M+Na+],
٤٠٦٩
-٢٥١-
Loss retention time = 0.74 minutes; HPLC (Protocol 674.5 [M+H+]):A, retention time = 7.072 minutes;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ [7.92 (br d, J=8 Hz) and 7.97 (br d, J=8 Hz), total 1H], [7.86 (br dd, J=6, 5 Hz) and 8.07 (br dd, J=6, 5 Hz), total 1H], 5
<p>7. 64-7.74 (br m, 3H), 7.15-7.29 (m, 5H), [4.44 (dd, J=9, 9 Hz) and 4.50 (dd, J=9, 9 Hz), total 1H], 3.26 and 3.29 (2 s, total 3H), 3.18 and 3.20 (2 s, total 3H), 2.96 and 3.10 (2 br s, total 3H), 1.24 and 1.25 (2 s, total 3H), 1.14 and 1.16 (2 s, total 3H), 1.02-1.07 (m, 3H), 0.73-0.80</p>
(m, 3H). 10
Illustration:
2-methyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo -3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-
yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-vaLinamide, trifluoroacetic acid salt (#98) 15
<img file="SA4069B1_D0206.tif" />
To a mixture of 65.1 (1-(tert-butoxycarbonyl)-2-methyl-L-proline mg, 0.284 mg mol, 1.1 mol) and 86# (170 mg, 0.258 mg mol, 1 mol) M 5 (dichloromethane millilitre, 0.03 mol) (add 0.108) HATU
20 MGGF, 0.284 mg, 0.284 mg, 1.1 mg, 1.1 mg (139 mmol diisopropylethylamine, 0.800 mM, 3.1 mM). After stirring overnight, cool the reaction mixture to 0°C, add 3 ml dichloromethane. Then slowly add trifluoroacetic acid
٤٠٦٩
-٢٥٢-
<p dir="rtl">(2 milliliters of acid). The reaction mixture is stirred at room temperature for 5 minutes, allowed to reach room temperature, then stirred at room temperature for 30 minutes before being concentrated by eluviation. The residue is coated FD Degree of heptane, etc 3000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 or The residual material is purified by solvation of silica (MSF Toi mtfkfkfdrg: saffkfkfkr: lfkfkfy 10: methanol galfkf GFGF</p>
dichloromethane) and then diluted with a mild-phase chromate (Method C) with 98# litor (128 mg, 56:5) as a white colored solid.
LC-MS: m/z 769.4 [M+H+],
ZMV retention = 1.28 min; HPLC (protocol A at 45°C) [+m/z 769.4[M+H, 10 retention time = 7.146 minutes (purity <98:);
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 9.03-9.15 (br m, 1H), 8.77-8.86 (br m, 1H), 8.69-8.76 (m, 1H). ), [8.66 (d, J=8.2 Hz) and 8.92 (d, J=8.6 Hz), total 1H], [7.78 (d, J=3.1 Hz) and 7.80 (d, J=3.5 Hz), total 1H ], [7.63 (d, J=3.1 Hz) and 7.67 (d, J=3.1 Hz), total 1H], 7.12-7.31 (m, 5H), [5.38 (ddd, J=11, 15
<p>8, 4 Hz) and 5.47 (ddd, J=11, 9, 4 Hz), total 1H], [4.46 (dd, J=9.4, 9.0 Hz) and 4.55 (dd, J=9.0, 8.6 Hz), total 1H], 3.17, 3.20, 3.22 and 3.25 (4 s, total 6H), 2.98 and 3.04 (2 br s, total 3H), [1.06 (d, J=7.0 Hz) and</p>
1.09 (d, J=6.6 Hz), total 3H], 0.73-0.80 (m, 3H).
20 Illustration:
methyl amino(bicyclo[4.2.0]octa-1,3,5-trien-7-yl)acetate, hydrochloride
salt (#102).
٤٠٦٩
-٢٥٣-
<img file="SA4069B1_D0207.tif" />
Step 1. Synthesis:
ethyl (acetylamino)(bicyclo[4.2.0]octa-1,3,5-trien-7-
yl)cyanoacetate(#99).
<p dir="rtl">5 464(sodium mg, 20.2 mg/ml, 1.2 mg/ml) ٻ</p>
Absolute ethanol (40 ml, 0.42 mol/ml); to the resulting mixture add 2-ethyl 3.44((acetylamino)-2-cyanoacetate, 20.2 mol/ml). Tomorrow 20 minutes at 60°C, add more 7-bromobicyclo[4.2.0]octa-1,3,5-triene (3.092 g, 16.89 mg mol, 1 mol) The mixture thickens when it recondenses.
<p dir="rtl">10 Steam overnight, then filter and filter. The waste material is separated from water and extracted from ethyl acetate. The organic class is washed, as it is a millions, a sodium sulfate, a candidacy, and a vibration, give the oil of a new oil, no ػ ػ The yearly ػ M HEPTANE (Give 99#) 4.38 EGP (Design Balf Aas R.</p>
LC-MS: m/z 273.2 [M+H+], 15
ZMV retention = 2.36 minutes.
Step 2. Synthesis of acetylamino)(bicyclo[4.2.0]octa-1,3,5-trien-7-yl)acetic)
acid(#100)
٤٠٦٩
-٢٥٤-
The one who is a mm Restore (it is a millions of millions of 1 The mixture is thickened by re-thickening the steam overnight, then concentrated with a vacuum, adding 40 ml of water liter), and it flashes
<p dir="rtl">5 The aqueous layer is extracted with 3 × 30 ml of dichloromethane. The mixed organic layers are dried with sodium s sulphate, filtered and filtered, and the resulting oil is purified by hydrolysis of silica gel (M. A: dichloromethane, methanol: 20 gm dichloromethane, mixed with 0.02: trifluoroacetic acid; gradient level: row: to 40 : B)</p>
<p dir="rtl">10 High-water thermometer (column: Chiralpak AD-H, 21×250 mm; Filter material:</p>
15:85 methanol/carbon dioxide; Flooding rate: 65 g/min; Dehydration: 210 mM; Device: Berger Minigram Preparative SFC System). Isolate, second filtering method, giving 100# (600 mg, 17:17 in two steps) as a single enantiomer (retention time = 3.37 minutes, purity <99:).
LC-MS: m/z 220.3 [M+H+], 15
ZMV retention = 2.10 min;
1H NMR (400 MHz, CD3OD) δ 7.14-7.24 (m, 2H), 7.03-7.09 (m, 2H),
<p>4.59 (d, J=8.6 Hz, 1H), 3.87 (ddd, J=8.5, 5.3, 2.4 Hz, 1H), 3.35 (dd, J=14.5, 5.4 Hz, 1H, assumed; partially obscured by solvent peak), 3.10 (dd, J=14.4, 2.4 Hz, 1H), 2.00 (s, 3H). Optical rotation: [α]D25 +70.9°(c 20</p>
0.67, methanol)
Step 3. Synthesis:
amino(bicyclo[4.2.0]octa-1,3,5-trien-7-yl)acetic acid, hydrochloride salt (#101).
٤٠٦٩
-٢٥٥-
Heats up when steam recondenses overnight Mixture of #100 (200 mg, 0.912 mg
The reaction mixture is concentrated with the solution to give the 101# enantiomer. (195 mg) pale yellow solid The next step was used without further purification.
<p dir="rtl">5 Step 4. Synthesis:</p>
methyl amino(bicyclo[4.2.0]octa-1,3,5-trien-7-yl)acetate, hydrochloride
salt (#102).
Coating mixture #101 (195 mg/ml, >0.913 mg/ml, 1 ml) GF
<p dir="rtl">(20 methanol ml, 0.04 mol) added 0.666 (thionyl chloride ml),</p>
<p dir="rtl">10 9.13 mg, 10 ml (10 ml). Two hours later, when the vapor is re-condensed, the mixture is concentrated</p>
The reaction with the compound gives the 102# individual enantiomer (175 mg, 84 mg in two steps) as a solid compound.
LC-MS: m/z 192.3 [M+H+],
ZMV retention = 0.80 min;
GC-MS: m/z 192 [M+H+], 15
Retention time = 3.206 minutes;
1H NMR (400 MHz, CD3OD) δ 7.24-7.33 (m, 2H), 7.11-7.18 (m, 2H),
<p>4. 40 (d, J=6.9 Hz, 1H), 3.99-4.05 (m, 1H), 3.78 (s, 3H), 3.46 (dd, J=14.8, 5.4 Hz, 1H), 3.23 (dd, J=14.8, 2.5 Hz, 1H).</p>
20 Illustration:
(2R,3R)-3-Methoxy-2-methyl-3-[(2S)-pyrrolidin-2-yl]propanoic acid, hydrochloride salt (#103)
٤٠٦٩
-٢٥٦-
<img file="SA4069B1_D0208.tif" />
11# 4.09 mg, 14.2 mg mg 10 ml cyclopentyl methyl ether, 0.14 ml (10 ml) is added 4 titers of hydrogen chloride (37 milliliters of dioxane, 100 milliliters of mol. (7 meters). After 3
<p dir="rtl">5 In the morning, the feed mixture is concentrated in the form and carefully coated in a baking tray for one layer of the coating solution, three kilograms of Heptane No. 103 (1000 mg, 31:) is given. It is used in the next step without further purification.</p>
1H NMR (400 MHz, DMSO-d6) δ 9.92-10.06 (br s, 1H), 8.66-8.80 (br
s, 1H), 3.89 (dd, J=5.2, 4.9 Hz, 1H), 3.43-3.53 (m, 1H), 3.39 (s, 3H), 3.06-3.17 (m, 2H), 2.66 (qd, J= 7.1, 4.6 Hz, 1H), 1.71-2.03 (m, 4H), 10
1.11 (d, J=7.1 Hz, 3H).
Illustration:
2-Methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[1-(bicyclo[4.2.0]octa-1,3, 5-trien-7-yl)-2-methoxy-2-oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1- 15 oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#107),
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[bicyclo
[4.2.0]octa-1,3,5-trien-7-yl(carboxy)methyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5 -methyl-1-oxoheptan-
4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#108) 20
٤٠٦٩
-٢٥٧-
<img file="SA4069B1_D0209.tif" />
<img file="SA4069B1_D0210.tif" />
<img file="SA4069B1_D0211.tif" />
<img file="SA4069B1_D0212.tif" />
Step 1. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-5-methyl-1-oxo-1-(pentafluorophenoxy)heptan-4 -yl]-N-methyl-L-valinamide(#104). 5
to #32 (4 ml, 6.56 mol ml, 1 ml (20 ml dichloromethane, 0.33 ml) and 1.06 ml pyridine, 13.1 ml 2.25) pentafluorophenyl (2.25) added drip Trifluoroacetate ml, 13.1 mM, 2 M). Stir the reaction mixture for 1 hour.
<p dir="rtl">10 32# (360 mg/kg, 0.59 mg/kg)</p>
(0.6 ml dichloromethane, 1 mol) and 0.095 pyridine ml, 1.2 ml mol, 2 ml (0.203 pentafluorophenyl trifluoroacetate ml, 1.18 mol ml). Stir the reaction mixture for 15 minutes.
The mixture is gelled, washed twice with 1 standard hydrochloric acid, dried with 15 sodium sulfate, sprayed and coated. The yellow oil produced by ethyl acetate is previously synthesized with silica gel and transported by thermochromatography Silica gel (gradient level: SR: to 40: ethyl acetate m heptane) giving #104 (4.6 g, 83:) White puff foam froths on some contaminated material.
LC-MS: m/z 798.3 [M+Na+],
٤٠٦٩
-٢٥٨-
ZMV retention = 1.23 minutes.
Step 2. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-2-carboxy- 1-methoxypropyl]pyrrolidin-1-yl}-3-
methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide(#105). 5
The 104) M6 (dichloromethane milliliter, 0.4 Jealmat Jarim (Al -Malat Mel ( 2) dichloromethane 1.35 ml diisopropylethylamine, 7.73 ml mol, 3 ml.
<p dir="rtl">10 React for 16 hours, then adsorb with silica and purify by thermolysis of silica gel (gradient level: methanol to 20: methanol dichloromethane) giving #105 (1.67 g, 83:) white foam. The fraction of contaminated materials on the desired product (0.571 g).</p>
Processing and purification can also be done in the same manner using #104 (2.60 g, >3.35 mm).
<p dir="rtl">15 C. . (Full) Giving #105 (2.4 g, 92): Egyptian brown puffer foam. The contaminated fraction is generated on the contaminated product (1.7 g) of the previous contaminated fraction and is purified as described in Literature No. 105 further m) 1.30 g, yield of 1000000000000000000000000000000000000100</p>
<p dir="rtl">20 The explanations are in two steps.</p>
LC-MS: m/z 779.3 [M+H+], 802.3 [M+Na+],
ZMV retention = 1.05 minutes.
Step 3. Synthesis:
٤٠٦٩
-٢٥٩-
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[ 1-(bicyclo[4.2.0]octa-1,3,5-trien-7-yl)-2-methoxy-2-oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1 -yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide(#106). 5
Coating mixture #105 (225 mg/ml, 0.289 mg/ml). gm, 1 mtf) gm
Add 15 minutes (15 dichloromethane, 0.02 mol) and 1 (136 mg) N,N-dimethylformamide, 0.347 mol (1.2 mol). After 5 minutes, add For glycol 102# 72.4( amine magnesium, 0.318 Milligrams, 1 ml (1 ml)
10 And 203) diisopropylamine, 1.16 ml. gm, 3 mtf
<p dir="rtl">(5 milliliters of dichloromethane). After 24 hours, the reaction mixture was washed with ml of sodium sulfate, filtered, aerated with silica gel, and purified by chromatography of silica gel (gradient level: SR: to 50: acetone (m heptane) giving the pink enantiomer #106 (210 mg, 76:) lubricant.</p>
LC-MS: m/z 953.1 [M+H+], 15
Retention time = 3.99 minutes;
1H NMR (400 MHz, CDCl3), presumed to be a mixture of rotamers, characteristic signals: 7.76 (d, J=7.5 Hz, 2H), 7.57-7.64 (m, 2H), 7.40 (dd, J=7.5, 7.4 Hz, 2H), 7.28-7.34 (m, 2H), 4.82-4.88 (m, 1H), 3.95
<p>4 01 (m, 1H), 3.76 and 3.82 (2 s, total 3H), 3.30, 3.31, 3.34 and 3.35 20</p>
(4 s, total 6H), [1.20 (d, J=7.0 Hz) and 1.20 (d, J=7.0 Hz), total 3H].
Step 4A. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[1-(bicyclo[4.2.0]octa-1,3, 5-trien-7-yl)-2-methoxy-2-oxoethyl]amino}-1-
٤٠٦٩
-٢٦٠-
methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#107).
According to General Procedure A, 106# (25 mg, 0.026 mol/ml, 1 liter (10 m) dichloromethane, 0.003 mol/ml) and 4) diethylamine ml.
<p dir="rtl">5 Synthesis of the required raw material, it was purified by reverse-phase chromatography (Method C), giving the #107 reactive enantiomer (16 mg, 73:) as a solid.</p>
LC-MS: m/z 730.8 [M+H+],
ZMV retention = 2.13 min; HPLC (Protocol N): Retention time = 9.889 minutes.
Step 4B. Synthesis:
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3- 10
{[bicyclo[4.2.0]octa-1,3,5-trien-7-yl(carboxy)methyl]amino}-1-methoxy-
2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#108).
The single #108 enantiomer (94.5 mg, 57 mg) is synthesized. #106 (190 mg) is synthesized.
<p dir="rtl">15 0.200 mm mol) according to a procedure similar to those described for the synthesis of #41</p>
MF 40#.
LC-MS: m/z 716.8 [M+H+],
ZMV retention = 2.06 min; HPLC (Protocol N): Retention time = 9.137 minutes.
Illustration:
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1- 20
hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٢٦١-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide (#112)
<img file="SA4069B1_D0213.tif" />
<img file="SA4069B1_D0214.tif" />
<img file="SA4069B1_D0215.tif" />
Step 1. Synthesis:
tert-butyl (2S)-2-[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1-phenylpropan-2- 5 yl]amino}-1-methoxy-2-methyl- 3-oxopropyl]pyrrolidine-1-carboxylate (#109).
The 11) Dichloromethane, 0.3 molecu
<p dir="rtl">10 (Milliliter) add 3270 (mg) HATU, 8.35 mm g, 1.2 ml. After two minutes, add 1.07 (1.07) amine (1R,2S)-(+)-norephedrine mg, 6.96 mm G molecule, 1 meter) and 1 (94 milliliters of triethylamine, 13.9 mol How many millimeters of hydrochloric acid and millimeters of water? Sodium sulfate, filtered,</p>
<p dir="rtl">15 It is concentrated by electrophoresis, and purified by methylation of silica gelatin (gradient level: zero to 60: ethyl acetate m heptane) (LiT 109#) 2.18 C, 74: (solid material with white loofah.</p>
٤٠٦٩
-٢٦٢-
LC-MS: m/z 321.3 [(M - Boc)+H+],
ZMV retention = 3.14 min;
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.64 (d, J=8.6 Hz, 1H), 7.24-7.33 (m, 4H), 7.15-7.21 (m, 1H), 5.35 (br d, J=5 Hz, 1H), 4.45 (br dd, J=5, 5 Hz, 1H), 5
<p>3.91-4.00(m, 1H), 3.30-3.39(m, 1H), 3.26(s, 3H), 2.94-3.07(m, 1H),</p>
<p>2.04-2.14(m, 1H), 1.46-1.78(m, 4H), 1.40(s, 9H), 0.97-1.04(m, 6H).</p>
Step 2. Synthesis:
(2R,3R)-N-[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]-3-methoxy-2-methyl-3-[(2S)-pyrrolidin-2-yl]propanamide , trifluoroacetic acid salt 10 (#110).
According to the formula C, at °C 109# (414 mol, 0.984 mg mol, 1 mol), 5) dioxane ml, 0 2 grams of hydrogen chloride (15 grams) dioxane milliliters, 60 milliliters, 60 mol
<p dir="rtl">15 Synthesis of the desired compound. The mixture, A, is purified with a wild-type trophozoite (Method C) giving 110# (120 mg, 34): Question Sticky.</p>
LC-MS: m/z 321.1 [M+H+],
ZMV retention = 0.55 min;
1H NMR (400 MHz, DMSO-d6), characteristic signals: δ 7.90 (d, J=8.6 Hz, 1H), 7.28-7.36 (m, 4H), 7.20-7.27 (m, 1H), 4.46 (d, J =6.2 Hz, 1H), 20
<p>3.48 (dd, J=8.6, 2.3 Hz, 1H), 3.38 (s, 3H), 2.92-3.16 (m, 3H), 2.242.35 (m, 1H), 1.49-1.88 (m, 4H), 1.09 ( d, J=6.6 Hz, 3H), 1.01 (d, J=6.6</p>
Hz, 3H).
٤٠٦٩
-٢٦٣-
Step 3. Synthesis:
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[ (1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1- oxoheptan-4-yl]-N-methyl-L-valinamide (#111). 5
According to the standard formula D, #32 (140 mol, 0.230 mol, 1 mol), #110 (110 mol, 0.253 mol). 100 mg, 1.1 mM, 3 dichloromethane mL, 0.08 mM The desired crude product is synthesized, the desired crude product is synthesized. It is purified by chromatography with silica gel (gradient level: grade: to 40: acetone (heptane) (gives 111# (220 mg, 95:).
LC-MS: m/z 912.4 [M+H+], 935.4 [M+Na+],
ZMV retention = 2.15 minutes;
HPLC (Protocol B): m/z 912.5 [M+H+], 934.5 [M+Na+], 15
Retention time = 10.138 minutes (purity <94:);
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, characteristic signals: δ 7.89 (d, J=7.8 Hz, 2H), 7.66-7.75 (m, 2H), 7.41 (dd, J= 7.4, 7.4 Hz, 2H), 7.12-7.20 (m, 1H), [5.33 (d, J=4.7 Hz) and
<p>5.38 (d, J=4.7 Hz), total 1H], 3.15, 3.18, 3.22 and 3.23 (4 s, total 6H), 20</p>
<p>1.30, 1.33, 1.36 and 1.39 (4s, total 6H), 0.95-1.06 (m, 6H).</p>
Step 4. Synthesis:
٤٠٦٩
-٢٦٤-
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1-phenylpropan-2 -yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide ( #112).
<p dir="rtl">5 Apply to evaporation agent A, 111 #110 (210 mg, 0.230 mm). GF (GF)</p>
<p dir="rtl">(5 ml dichloromethane, 0.05 mol) and 5 (diethylamine ml) The required raw material is synthesized, purified by thermoglobulin silica gel (gradient level: 0 to 10: methanol ml dichloromethane) A mixture of synthetic fibers and solid materials. Diethyl ether and heptane are added and the mixture is filtered, yielding 112# (81 mg, 51:1) white colored solid.</p>
LC-MS: m/z 690.4 [M+H+],
ZMV retention = 1.10 min;
HPLC (Protocol A): m/z 690.5 [M+H+], 712.4 [M+Na+],
Retention time = 7.229 minutes (purity <90):
1H NMR (400 MHz, DMSO-d6), presumed to be a mixture of rotamers, 15 characteristic signals: δ [7.62 (br d, J=8 Hz), 7.88 (br d, J=8 Hz), 8.07 (br d, J=9 Hz) and 8.11 (br d, J=9 Hz), total 2H], 7.15-7.34 (m, 5H), [5.34 (d, J=4 Hz) and 5.41 (d, J=5 Hz), total 1H], 3.18, 3.21, 3.23 and 3.25 (4 s, total 6H), 2.93 and 3.08 (2 br s, total 3H), 1.15, 1.18, 1.21
and 1.25 (4 s, total 6H). 20
Illustration:
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٢٦٥-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt(115).
Fmoc
<img file="SA4069B1_D0216.tif" />
O
O
dimer acid#5
HATU, Hunig's base CH<sub>2</sub>Cl<sub>2</sub>
#67
62%
Fmoc
<img file="SA4069B1_D0217.tif" />
#113
Et2NH
CH2Cl2
67%
O
HN
H2
<img file="SA4069B1_D0218.tif" />
O
1. N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanine
HATU, Hunig's base, CH2Cl2
2. LiOH, THF, water
64%
O
<img file="SA4069B1_D0219.tif" />
O
#115
OH
Step 1. Synthesis:
10
15
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[{N-[(9H-fluoren-9-
ylmethoxy)carbonyl]-L-valyl}(methyl)amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate (#113).
To a stirred mixture of 5#12.1 dimer acid, 23 mmol and 67#11.5 mmol, 23 mmol. 10.8 mg dichloromethane (add 10.8) HATU, 27.6 mm (27.6 mm) Then there is Hunig's base (12.1 milliliters, 69 milliliters, 69 milliliters). The reaction changes to change at the temperature of the room for a period of 15 hours. The reaction changes to With a small bridle, rinse with 1 ml of ethyl acetate and wash with 1 ml of titration HCl twice. The organic layer is then washed, ml, dried with sodium sulfate, filtered, and centrifuged. After that, the mixture was purified by chromatography with silica gel (gradient level: 0 to 70 gm heptanes), yield 113# (12.3 gm, 62 gm). White.
LC-MS (Protocol Q): m/z 855.3 [M+H+], 877.2 [M+Na+],
٤٠٦٩
-٢٦٦-
ZMV retention = 2.32 minutes;
HPLC (Protocol R): /z 855.5 [M+H+],
Retention time = 9.596 minutes (purity <97:).
Step 2. Synthesis:
methyl N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5- 5
methyl-4-[methyl(L-valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalaninate (#114).
Applied to drying, drying pads A, 113 ml (12 ml, 14 ml). #114 is synthesized. (5.9 gm, 67): A white/slightly yellow solid substance after purification by chromatography with silica gel (gradient level: 0 to 25 methanol).
)dichloromethane m
LC-MS (Protocal Q): m/z 633.0 [M+H+],
ZMV retention = 1.19 minutes.
HPLC (Protocol A): /z 633.5 [M+H+], 15
Retention time = 7.142 minutes (purity <98:).
Step 3. Synthesis:
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- 20 oxobutyl}- N-methyl-L-valinamide-trifluoroacetic acid salt (#115).
٤٠٦٩
-٢٦٧-
2,N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N 7) dimethylalanine (260 mg, 0.411 mmol), #114 (260 mg, 0.411 mmol), and 188) HATU, 0.493 mm Hunig base, 0.82 mm Hunig base, 10 ml dichloromethane. Leave.
<p dir="rtl">5 The mixture was stirred at room temperature for 1 hour and 20 minutes. It reduces the interaction. THF (9 ml) is added to the raw material and to this stirred mixture, 49.2 mg lithium hydroxide, 2.06 mg mol (mol) ml, i.e. 3 ml ml water are added. The reaction is changed to reduce Apply at 100 degrees for 4 hours. The mixture is agitated and then purified by a medium-pressure, medium-pressure C18 chromatography (grading level: 5 to 45 m acetonitrile: 0.02 m TFA) 10 #115 (218 mg, 64:) a white colored solid.</p>
LC-MS (Protocol Q): m/z 718.7 [M+H+], 740.6 [M+Na+],
Retention time = 1.21 minutes. HPLC (Protocol A at 45°C): 718.4 m/z
[+M+H], retention time = 6.903 minutes.
1H NMR (400 MHz, DMSO-d6), δ 8.81-8.95 (m), 8.44-8.50 (m), 8.42 (d), 8.15 (d), 7.14-7.28 (m), 4.71-4.78 (m), 4.57-4.66(m), 4.49-4.56 15
(m), 4.41-4.48(m), 3.94-4.05(m), 3.72-3.79(m), 3.39-3.60(m), 2.95-3.33(m), 2.78-2.89(m), 2.69(s) , 2.43-2.50(m), 2.08-2.42(m), 1.60-1.92(m), 1.20-1.57(m), 0.84-1.11(m), 0.74-0.83(m).
Illustration:
2-methyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1- 20
methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3 oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan -4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#117), 2-methyl-L-prolyl-
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-
٤٠٦٩
-٢٦٨-
phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#118).
<tr><td><p><sub>OH</sub> #<sub>HC</sub>1<sub>uH</sub>1<sub>n2</sub>4<sub>iCg</sub>, <sub>l'</sub>H<sub>2s</sub>A<sub>ba</sub>T<sub>s</sub>U<sub>e</sub>, <sub>NO</sub>HN<sup>O</sup><sub>NOO</sub>N</p><p>74% O<sup>NH</sup></p><p>#116</p></td><td><p>TFA, CH2Cl2<sub>NH</sub><sup>H</sup>N<sup>O</sup>NN</p><p><sup>89%</sup><sub>#117</sub>CF3CO2HO<sup>NH</sup>O</p><p>O<sup>OO 1</sup><sub>2</sub><sup>.</sup><sub>.</sub><sup>L</sup>T<sub>T</sub><sup>i</sup><sub>F</sub>H<sup>O</sup><sub>A</sub>F<sup>H</sup><sub>,</sub>, <sub>C</sub>w<sub>H</sub>at<sub>2</sub>e<sub>C</sub>r<sub>l2NHO</sub>HN<sup>O</sup><sub>NOO</sub>N</p><p>74% (2 steps).CF3CO2HO<sup>NH</sup>O</p><p>#118 <sub>OH</sub></p></td></tr>
Step 1. Synthesis:
1-(tert-butoxycarbonyl)-2-methyl-L-prolyl-N-{(1S,2R)-4-{(2S)-2-
[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2-oxoethyl]amino}-1-methoxy-
2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]4-oxobutyl}-N-methyl-L-valinamide (#116).
10
15
to 114# inverted mol (1.02 mg, 1.61 mg mol, 1 mol) and 1-443 (tert-butoxycarbonyl)-2-methyl-L-proline mg, 1.93 mol. 1.2 mt) 12 milliliters of dichloromethane, add 735 milliliters of HATU, 1.93 milliliters of germanium, 1.2 milliliters of Hunig base (1.12 milliliters, 6.45 milliliters). m garmom molecule, 4 h). The reaction is left to stir at room temperature For two hours. The solution is reduced to ethyl acetate before washing with 0.5 milliliters of standard HCl. The organic materials are then dried with sodium sulfate, reduced to a small aggregate, then reduced to silica. Afterwards, the chromatography of silica (grade level: SR:-45: acetone m heptanes) is carried out, producing #116 (1.02 g, 74:) a white colored solid.
LC-MS (Protocol Q): m/z 844.3 [M+H+], 867.2 [M+Na+],
٤٠٦٩
-٢٦٩-
ZMV retention = 2.15 minutes.
Step 2A. Synthesis:
2-methyl-L-prolyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2 -oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- 5 oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#117).
To a mixture of 116# (450 mg, 0.533 mm g, 1 ml) 7 ml dichloromethane at 0°C, add 40 ml TFA Milligrams, grammolecular, 70 ml). Stir at 10°C for 5 minutes, then cool to 10°C while stirring for 20 minutes. The reaction is reduced, then dichloromethane is reduced
A small amount of methanol before it is reduced to silica. It is then shown that the silica gelatin (grading level: -20: methanol, ethyl acetate) produces 117# (396 mg, 89:) a white colored solid.
LC-MS (Protocol Q): m/z 744.5 [M+H+], 767.2 [M+Na+],
15 Retention time = 1.40 minutes; HPLC (Protocol A at 45°C): 744.5 m/z
[+M+H], retention time = 7.149 minutes (purity <91:).
1H NMR (400 MHz, DMSO-d6), δ 8.73-9.14 (m), 8.66 (br d), 8.50 (d), 8.22 (d), 7.12-7.25 (m), 4.67-4.74 (m), 4.41 -4.63(m), 3.93-4.00(m), 3.73(dd), 3.63(d), 3.46-3.57(m), 3.38-3.45(m), 3.26-3.23(m), 3.22-3.25(m) , 3.06-3.22(m), 2.99- 3.05(m), 2.93-2.97(m), 2.80- 20
2.89(m), 2.75-2.78(m), 2.64- 2.67(m), 2.46-2.50(m), 2.27- 2.43(m), 2.00-2.26(m), 1.85- 1.99(m), 1.70-1.83 (m), 1.52-1.69 (m),
<p>1 33- 1.51(m), 1.18-1.31(m), 0.98-1.07(m), 0.93-0.97(m), 0.82</p>
0.92(m), 0.71-0.78(m).
٤٠٦٩
-٢٧٠-
Step 2B. Synthesis:
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#118). 5
To mol of 116# mol (435 mg, 0.515 mm mol), 4 ml of THF followed by nitrogen, add 24.7 mg (LiOH, 1.03 mm mol, 2 mol). GF, AB, GF, 2 milliliters, ml, is different LC-MS analysis indicates methylation ester
<p dir="rtl">10 Dichloromethane is added to nitrogen. To this, the stirred mixture is added (3 ml TFA, 45.05 mg/mol, 80 ml). The mixture is stirred at room temperature For 30 minutes, the residue is purified using a thermometer. M C18 medium pressure mildew (gradient level: 5 to 60: acetonitrile, ml, ml 0.02: TFA, ml) 118# (396). Maj., 89: (Solid material made of white loofah.</p>
LC-MS (Protocol Q): m/z 730.2 [M+H+], 15
Retention time = 1.18 minutes; HPLC (protocol A at 45°C): 730.5 m/z
[+M+H], retention time = 7.088 minutes (purity <98:).
1H NMR (400 MHz, DMSO-d6), δ 9.04-9.13(m), 8.75-8.87(m), 8.70(d), 8.38(d), 8.11(d), 7.10-7.24(m), 4.66- 4.74(m), 4.48-4.64(m), 4.37-4.47(m), 3.91-3.99(m), 3.77(m), 3.47-3.56(m), 3.33-3.47(m), 20
3.08-3.30(m), 2.93-3.07(m), 2.75-2.86(m), 2.63-2.69(m), 2.45
2.50(m), 2.28-2.44(m), 2.03-2.27(m), 1.88-2.02(m), 1.68-1.86(m), 1.55-1.67(m), 1.30-1.47(m), 1.17-1.29 (m), 0.98-1.05 (m), 0.93
0.97(m), 0.83-0.92(m), 0.71-0.79(m).
٤٠٦٩
-٢٧١-
Illustration:
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo-3 -phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#123). 5
<img file="SA4069B1_D0220.tif" />
quant. (2 steps)
62%
#121
#32, HATU, Hunig's base CH2Cl2, DMF
<p>1. 4M HCl in dioxane, dioxane</p>
<p>2. Fmoc-OSu</p>
10% Na<sub>2</sub>CO<sub>3</sub>(aq)DME
Fmoc
<img file="SA4069B1_D0221.tif" />
#119
OH
tert-butyl L-phenylalaninate, hydrochloride salt
HATU, Hunig's base
CH<sub>2</sub>Cl<sub>2</sub>, DMF
79%
Fmoc
<img file="SA4069B1_D0222.tif" />
Fmoc
quant.
99%
diethylamine CH2Cl2
diethylamine CH2Cl2
<img file="SA4069B1_D0223.tif" />
#120
Step 1. Synthesis:
(2R,3R)-3-{(2S)-1-[(9H-fluoren-9-ylmethoxy)carbonyl]pyrrolidin-2-yl}-3-methoxy-2-methylpropanoic acid (#119).
10 10
(20 ml dioxane, 80 ml dioxane, 10 ml) are added. Leave the reaction to stir at a temperature Leave your bangs on for 3 hours before using the conditioner and applying it. Note: Next, the raw material is 30 ml of 10: Na2CO3, then the mixture is added to the mixture of 1 milliliter of Mn-1-{[(9H-fluoren).
15 2.96(9-ylmethoxy)carbonyl]oxy}pyrrolidine-2,5-dione, 8.77 mM
1.05 ml (1.05 ml) of DME. The mixture is stirred at a temperature of 30 ml to form heptanes:40/ethyl ace tate:40/methanol:20 (TLC) to consume dewatering primer from Boc The solution is atomized to a small batch, washed twice with ether, flashed to pH 2 with 2 mM HCl and then extracted with 3 ml of ether.
20 90 mg: methanol:10/dichloromethane. Washing muscle materials with sodium
٤٠٦٩
-٢٧٢-
Sodium sulfate is doped and dissolved before being dried, filtered, and centrifuged to a solid of 119# (3.4 g, tm).
LC-MS (Protocol Q): m/z 410.0 [M+H+],
ZMV retention = 1.81 minutes.
<p dir="rtl">5 Step 2. Synthesis:</p>
tert-butyl N-[(2R,3R)-3-{(2S)-1-[(9H-fluoren-9-ylmethoxy)carbonyl]pyrrolidin-2-yl}-3-methoxy-2-methylpropanoyl]-L -phenylalaninate (#120).
tert-butyl L-phenylalaninate, hydrochloride salt to milliliters of salt
10 (1.67 g, 6.5 mM mol, 1 mol) and #119 (5.9 g, 6.5 mM mol,
<p dir="rtl">1 50 ml dichloromethane, plus 5 ml DMF, HATU (2.9 g, 7.9 mg mol) The equation is 5.6 milliliters, 32 milliliters (32 milliliters of Hunig base), 5 percent. Stir at room temperature for 45 minutes. Reduce the solution, add ethyl acetate, wash with 0.5 mM HCl and 15 mM silica. After that, the formula is called silica (grade: grade: 25: acetone). Heptane (production #120) (3.14 g, 79): A yellowish-white solid.</p>
LC-MS (Protocol Q): m/z 613.1 [M+H+]
ZMV retention = 2.37 minutes.
Step 3: Synthesis
tert-butyl N-{(2R,3R)-3-methoxy-2-methyl-3-[(2S)-pyrrolidin-2- 20
yl]propanoyl}-L-phenylalaninate (#121).
٤٠٦٩
-٢٧٣-
To 120 milliliters of mixture (2.87 grams, 4.68 milliliters of mol, 1 liter) (20 milliliters of dichloromethane, add 10 milliliters of diethylamine, 95 milliliters). How many parts do you have, 20.5 meters? Add another 10 ml of diethylamine (10 ml, 95 mM Gram, 20.5 ml) and leave the reaction to stir at 5°C. R M M F 3 hours. The agent is concentrated in the oil and is added to the production of #121 (1.8 gm) solid mixture of yellowish-white oil.
LC-MS (Protocol Q): m/z 391.1 [M+H+]
ZMV retention = 1.05 minutes.
Step 4: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-[(3R,4S,5S)- 10 1-{(2S)-2-[(1R,2R)-3-{ [(2S)-1-tert-butoxy-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-
5-methyl-1-oxoheptan-4-yl]- N-methyl-L-valinamide (#122).
To 121# mol (0.55 mol, 1 mol, 1 mol) 10
<p dir="rtl">15 1 ml dichloromethane and 1 ml DMF, add #32 (0.62 ml, 1 ml mol, 1 ml) then 0.42 ml HATU mol (1.1 mol) and 0.72 Hunig base, 4.1 mol (Gram, 4 ml). The compound is stirred at a temperature for 21 hours. The compound is reduced, sealed with ethyl acetate, then washed with 0.5 standard HCl The organic layer is dried with sodium sulfate and filtered , and turtz for the</p>
<p dir="rtl">20 Smaller before being concentrated on silica. Next, the silica is chromated (gradation: SR:-40: acetone m heptane) to produce #122 (0.62 g, 62:) a white colored solid.</p>
LC-MS (Protocol Q): m/z 982.3 [M+H+]
ZMV retention = 2.44 minutes.
٤٠٦٩
-٢٧٤-
Step 5: Synthesis
2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo-3 -phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#123). 5
To a stirred mixture of 122# (600 mg, 0.611 mM Gram, 1 mL) 15 mL of dichloromethane, add 5 mL diethylamine, 50 mM GM, 80 mL. The reaction is then stirred to a GFARAR The mixture is concentrated for 3 hours and transferred to the mixture using a silica gel grinder (gradation: grade). R:-40: methanol ml
<p dir="rtl">10 dichloromethane (production #123) 0.46 g, 99:( solid.</p>
LC-MS (Protocol Q1): m/z 760.3 [M+H+]
ZMV retention = 0.83 min.
1H NMR (400 MHz, CD3OD), δ 7.14-7.30 (m), 4.70-4.78 (m), 4.564.64 (m), 4.05-4.19 (m), 3.87 (dd), 3.79-3.84 (m), 3.72-3.77(m), 3.62-3.70(m), 3.46-3.56(m), 3.37- 3.45(m), 3.33-3.36(m), 3.16- 15
<p>3.24(m), 3.09-3.11(m), 2.98-3.05(m), 2.95(d), 2.91(d), 2.87(d), 2.83(d),2.73-2.79(m), 2.40-2.51( m), 2.29-2.39(m), 2.16-2.28(m), 2.04-2.15(m), 2.01(s), 1.73-1.96(m), 1.50-1.68(m), 1.47-1.49(m), 1.46(s), 1.43(s), 1.38(s), 1.35(d), 1.23-1.32(m), 1.17-1.22(m),</p>
<p>1.15(d), 1.04-1.11(m), 0.94-1.03(m), 0.82-0.91(m). 20</p>
Tldhir
methyl N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-(3-amino-2,2-
dimethylpropanoyl)-L-valyl](methyl)amino}-3-methoxy-5-
٤٠٦٩
-٢٧٥-
methylheptanoyl]pyrrolidin-2-yl}-3-methoxy-2-methylpropanoyl]-L-
phenylalaninate (#126).
<img file="SA4069B1_D0224.tif" />
Fmoc-OSu 10% Na2CO3 DME
OH
#114, HATU, Hunig's base CH2Cl2
78%
Fmoc<sup>HNOH</sup>
O
#124
O 98%
Fmoc
H
<img file="SA4069B1_D0225.tif" />
#125
diethylamine THF
56%
H2N
H
<img file="SA4069B1_D0226.tif" />
#126
Step 1: Synthesis
10
15
20
3-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}-2,2-dimethylpropanoic acid (#124).
3-amino-2,2-dimethylpropanoic acid hydrochloride is added in ml of
(1 g, 6.5 mg mol, 1 mol) 10 ml Mg 10:Na2CO3 to mol
2.3(1-{[(9H-fluoren-9-ylmethoxy)carbonyl]oxy}pyrrolidine-2,5-dione MPH
6.5 mm mol Aqueous acids to hydrogen levels > 2 mL HCl concentrate, then extract 3 ml of 10 ml of methanol: 90 ml of dichloromethane. The organic materials are dissolved before washing with 1 ml of HCl and 1 ml of sodium sulfate. The organic layer is dried It is concentrated in the production line of #124 (2.2 EGP, 98:) Solid white puff pastry.
LC-MS (Protocol Q1): m/z 362.0 [M+Na+]
ZMV retention = 0.89 min.
Step 2: Synthesis
methyl N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-(3-{[(9H-fluoren-9-
ylmethoxy)carbonyl]amino}-2,2-dimethylpropanoyl)-L-
٤٠٦٩
-٢٧٦-
valyl](methyl)amino}-3-methoxy-5-methyl heptanoyl]pyrrolidin-2-yl}-3-methoxy-2-methylpropanoyl]-L-phenylalaninate (#125).
To mixed milliliters of 114# (200 mg, 0.316 mmol, 1 liter) m2 ml of dichloromethane, add 124# (107 mg, 0.316 mmol, 1 ml).
<p dir="rtl">5 One-third of the base (0.167 milliliters of Hunig, 0.948 mmol, 3 mol) and HATU (149 mg, 0.379 mmol). m, 1.20 equal). Yes. The most important ones are related to the younger ones, like the younger ones 10 ml</p>
ethyl acetate, washed twice with 5 milliliters of 1 ml HCl, and once with 5 milliliters of 1 ml of HCl. The organic layer is dried and labeled with sodium sulfate. Materials become concentrated
<p dir="rtl">10 Organic raw material is dichloromethane. Filter the solid matter. The organic layer is separated by vacuum and the mixture is purified by silica (gradation: grade: -50: acetone m heptane) to produce #125 (235 mg, 78:) a white solid.</p>
LC-MS (Protocol Q): m/z 954.2 [M+H+]
ZMV retention = 2.28 minutes.
15 Step 3: Synthesis
methyl N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-(3-amino-2,2-dimethylpropanoyl)-L-valyl] (methyl)amino}-3-methoxy-5-
methylheptanoyl]pyrrolidin-2-yl}-3-methoxy-2-methylpropanoyl]-L-phenylalaninate (#126).
<p dir="rtl">20 To mL of 125# (235 mg, 0.246 mm mol, 1 mL) m2</p>
Mallali, with a time, 10 mm Diethylaamine. AR MM Silica (gradation: grade: -30: methanol m ethyl acetate) production #126 (101 mg, 56:) a white colored solid.
٤٠٦٩
-٢٧٧-
LC-MS (Protocol Q): m/z 732.2 [M+H+]
ZMV retention = 1.32 minutes.
1H NMR (400 MHz, DMSO-d6), δ 8.51(dd), 8.28(d), 7.15-7.29(m),
5.77(s), 4.55-4.77(m), 4.44-4.54(m), 3.94-4.10(m), 3.73-3.79(m),
3.66(d), 3.49-3.60(m), 3.40-3.48(m), 3.10-3.36(m), 3.00-3.09(m),5
2.83-2.98(m), 2.57-2.77(m), 2.19- 2.46(m), 1.87- 2.14(m), 1.611.86(m), 1.36-1.55(m), 1.23-1.36(m), 1.12 -1.22(m), 0.97-1.11(m), 0.82-0.96(m), 0.73-0.81(m).
Tldhir
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert- 10
butoxy-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#130).
<img file="SA4069B1_D0227.tif" />
#6, HATU
Hunig's base CH2Cl2
Fmoc<sub>N</sub><sup>H</sup>N<sub>N</sub>O<sup>CH</sup>2<sup>Cl</sup>2
OOO quantity.
#127
#121, HATU
Hunig's base
<sub>Fmoc N</sub>H<sub>N</sub>O<sub>NOH</sub>CH2Cl2, DMF
OOO 62%
#128
78%
Fmoc<sub>N</sub>
<img file="SA4069B1_D0228.tif" />
81%
diethylamine CH2Cl2
HN
<img file="SA4069B1_D0229.tif" />
15 Step 1: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-1-tert-butoxy-3-methoxy-5-methyl-1-oxoheptan- 4-yl]-N-methyl-L-valinamide (#127).
٤٠٦٩
-٢٧٨-
into a round-bottomed flask containing 6# (4.7 g, 7.9 mM, 1 mM) and 3.2) N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanine g, 9.4 mM HATU molecule, 1.2 M (3.6 M) and a stir bar, adding 50 mL of HATU (3.6 M). ml, 9.4 mg ml, 1.2 ml) and base
<p dir="rtl">5 (5.5 milliliters Hunig, 32 milliliters, 4 ml). Leave the solution to stir at 100 degrees Celsius.</p>
The bangs last for 12 hours. The reaction is reduced to a smaller amount, such as ethyl acetate, before washing with 1 mM HCl, to mol. Then, the organic materials are dried with sodium sulfate, filtered, and reduced to silica. The waste material is purified by silica chromatography (gradation: 0-30: acetone m heptane) to produce #127 (4.2 g, 78:) a white solid.
LC-MS (Protocol Q): m/z 680.2 [M+H+] 10
ZMV retention = 2.52 minutes.
Step 2: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(2R,3S,4S)-1-carboxy-2-methoxy-4-methylhexan-3-yl]-N -methyl-L-valinamide, (#128). 15
To 1 mol mol of 127# solution (4.2 ml, 6.1 mol C, 1 ml) 21 ml of dichloromethane, add 90 ml Gram molecule, 10 ml (THF). The compound changes to change At a constant boiling temperature for 4 hours, the agent is concentrated in the adhesive, heated at a constant boiling point once by adding heptane, then adding 20 ml. #128 solid material with a slightly yellowish-white color (3.8 g, complete (.
LC-MS (Protocol Q): m/z 624.2 [M+H+]
ZMV retention = 2.01 min.
Step 3: Synthesis
٤٠٦٩
-٢٧٩-
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3- {[(2S)-1-tert-butoxy-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy- 5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#129). 5
To a mixture of 20 milliliters of dichloromethane and 2 milliliters of DMF, add 2.4 milliliters of DMF -, 3.1 mg mol C, 1 M(then 1.29) HATU Hunig, 3.39 milliliters Hunig base, 12.3 milliliters Hunig base, 1.1 milliliters E).
<p dir="rtl">10 It takes two hours for the baby to have sex. The reaction is reduced, removed from ethyl acetate before washing with HCl.</p>
<p dir="rtl">0.5 mmol. Organic materials are dried with sodium sulfate and then reduced to silica. The mixed material is transferred using a silica gel pad (gradation: silica R: -50: acetone m heptanes) production #129 (1.9 g, 62:) a solid substance with white fluff.</p>
LC-MS (Protocol Q): m/z 996.3 [M+H+]
<p dir="rtl">15 ZMV retention = 2.53 minutes.</p>
Step 4: Synthesis
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo -3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#130). 20
To 129 mixed milliliters of dichloromethane, add 4 ml of diethylamine liter, 40 mg mol, 50 ml). The solution was left to stir at a temperature of The temperature is 14 and a half hours. The reaction is stirred and heated at a constant boiling point once the heptanes are removed
٤٠٦٩
-٢٨٠-
Dichloromethane and a little diluted methanol before washing it on silica. The waste material is purified by silica thermolysis (gradation: sulfur: -20: methanol, ethyl acetate) to produce #130 (518 mg, 81:) a white solid.
LC-MS (Protocol Q): m/z 774.3 [M+H+]
<p dir="rtl">5 ZMV retention = 1.48 minutes.</p>
HPLC (Protocol A at 25 °C): m/z 774.5 [M+H+],
Retention = 7.733 min (purity < 98:).
1H NMR (400 MHz, DMSO-d6), δ 8.36 (d). 8.14(d), 7.81(t), 7.14-7.25(m), 7.01-7.07(m), 4.87-4.94(m), 4.78-4.85(m,), 4.67-4.76(m), 4.46-4.65( m), 4.29-4.40(m), 3.93-4.03(m), 3.70- 3.81(m), 3.49- 10
<p>3.60(m), 3.38-3.47(m), 3.29- 3.36(m), 3.15-3.28(m), 2.98-3.13(m), 2.94(br s), 2.74-2.89(m), 2.64-2.69( m), 2.18-2.45(m), 2.022.14(m), 1.90-2.01(m), 1.62-1.87(m), 1.40-1.55(m), 1.37(d), 1.201.33(m), 1.16(d), 1.01-1.10(m), 0.90-0.98(m), 0.82 -0.89(m), 0.69</p>
0.79(m). 15
Tldhir
2-methyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S) -1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide, trifluoroacetic acid salt (#131). 20
OH<sup>1</sup><sub>2</sub><sup>.</sup><sub>.</sub><sup>#</sup><sub>T</sub>H<sup>1</sup><sub>F</sub>u<sup>1</sup><sub>A</sub>n<sup>4</sup>i<sub>,</sub>g<sup>,</sup><sub>C</sub>'<sup>H</sup>s<sub>H</sub><sup>A</sup>ba<sup>T</sup><sub>C</sub>s<sup>U</sup><sub>l</sub>e<sup>,</sup>,CH2Cl2<sub>N</sub><sup>H</sup>N<sup>O</sup><sub>N</sub>N<sup>CF</sup>3<sup>CO</sup>2<sup>H</sup>
B<sup>N</sup>oc<sup>O, 2 2 HOOO</sup>O
54% (2 steps) NH
#131
O
٤٠٦٩
-٢٨١-
Step 1: Synthesis
2-methyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S) -1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N- methyl-L-valinamide trifluoroacetic acid salt (#131). 5
To mol% of 114# (164 mg, 0.259 mg mol, 1 mol) and 1-71.3(tert-butoxycarbonyl)-2-methyl-D-proline mol, 0.311 mg mol 1.2 ml (1.2 ml) 4 ml dichloromethane, add 118 mg HATU, 0.311 mg ml dichloromethane, 1.2 ml A) One-thousandth base (0.180 milliliters of Hunig, 1.04 milliliters of 10 mol, 4 liters). The agent is stirred at the lowest temperature. It takes 30 minutes to complete the meal. The highest solution is 3.5 milliliters of dichloromethane and 3.5 milliliters of dichloromethane. To this, the stirred mixture, add 1.5 milliliters of TFA, 20 mM, 76 mol. The solution is stirred at room temperature For the worlds, the time of birth (Method *J) Tutorial #131 (119 MG, 54): A solid wrapper made of 15 white foil.
HPLC (Protocol A at 45 °C): m/z 744.5 [M+H+],
Retention = 7.342 minutes (purity < 98:).
1H NMR (400 MHz, DMSO-d6), δ 9.08-9.18(m), 8.79-8.89(m), 8.76(t), 8.54(d), 8.29(d), 7.14-7.31(m), 4.70- 4.79(m), 4.57- 4.66(m), 4.45-4.55(m), 3.96- 4.04(m), 3.74- 3.80, 3.66(d), 3.48-3.61(m), 20
<p>3.40 -3.48(m), 3.09- 3.34(m), 3.00-3.09(m), 2.95-3.00(m), 2.832.93(m), 2.36- 2.53(m), 2.21-2.35(m), 2.10 -2.19(m), 1.99-2.10(m), 1.61-1.09(m), 1.36-1.53(m), 1.21-1.35(m), 1.02- 1.10(m),</p>
0.94- 1.0(m), 0.86- 0.93(m), 0.73- 0.82(m).
٤٠٦٩
-٢٨٢-
Tldhir
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-
hydroxy-1-phenyl propan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-
methyl-L-valinamide, trifluoroacetic acid salt (#134). 5
#110, HATU
Hunig's base
dichloromethane Fmoc
<img file="SA4069B1_D0230.tif" />
43%
diethylamine THF
82%
Fmoc<sup>HN</sup>N<sup>OH</sup>
O.O
#@5
O
H2N<sub>N</sub>
O.O
#133
<img file="SA4069B1_D0231.tif" />
1. 1-(tert-butoxycarbonyl)-2-methyl-L-proline HATU, Hunig's base dichloromethane
2. 4 M HCl in dioxane
dioxane
86% (2 steps)
<img file="SA4069B1_D0232.tif" />
#134
2H
Step 1: Synthesis
N~2~-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[( 1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl- 10 1- oxoheptan-4-yl]-N-methyl-L-valinamide (#132).
1.14 mg, 2.17 mg, 1 ml Add 10 milliliters of dichloromethane and 1.15 milliliters of Hunig's base, 6.52 milliliters of dichloromethane, 3 milliliters of Hunig's base GFAA, 1.02) HATU JFFAA, 1.02) 2.61 milligrams, 1.2 milligrams,
15 and 110# (0.776 gm, 2.17 mmol gm, 1 m). The reaction changes at a temperature
Wrap the room for 30 minutes, then apply a lotion. Leave the mixture in 50 ml of ethyl
acetate, washed twice with 25 ml of 1 ml HCl, and once with 25 ml of ml. Organic materials are dried and labeled as sodium sulfate. Organic materials are separated by filtering, 30 ml of dichloromethane, and the resulting precipitates are removed by filtration.
٤٠٦٩
-٢٨٣-
The organic materials are agitated by atomization and the residue is purified by thermolysis of silica (gradation: SR:-50: acetone m heptanes) to produce #132 (1.33 g, 81:) solid material.
LC-MS (Protocol Q): m/z 849.2 [M+Na+]
ZMV retention = 2.19 minutes.
<p dir="rtl">5 Step 2: Synthesis</p>
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl] amino }-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxo heptan-4-yl]-N-methyl-L-valinamide
(#133).
<p dir="rtl">10 To 132# inverted mol (1.33 ml, 1.60 mol, 1 ml)</p>
10 The reaction is left to stir at room temperature for 4 hours. The reaction is then stirred at room temperature for 4 hours Work by vacuum and purify the mixture using a silica gel. Grading: Grade R: -30: methanol (kg) ethyl acetate (production #133 (418 mg, 43:) a white colored solid.
LC-MS (Protocol Q1): m/z 605.2 [M+H+] 15
ZMV retention = 1.48 minutes.
Step 3: Synthesis
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1 -phenyl propan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N- 20
methyl-L-valinamide, trifluoroacetic acid salt (#134).
٤٠٦٩
-٢٨٤-
151 HATU (151 mg, 0.398 mM, 1.2 mM), 133# (201 mM, 0.332 mM, 1 mM) and -1-tert -butoxycarbonyl)-2-methyl-L 91.3( Proline mg, 0.398 mm mol, 1.2 mL Round-bottomed flask Screw on a stir bar to remove nitrogen. Add 5 mL of trichloromethane to the bottom 5 ml (0.231 Hunig ml, 1.33 ml, 4 ml). Turn it up by 1 degree
For pregnancies, 15 hours. After that, the connection between the condition is based on the condition and the words of the condition of the worlds are added. Next, 4 ml of dioxane is added to the evaporation material and then 4 ml dioxane (4 ml HCl, 20 mM mol, 50 ml). The reaction is then left to stir at room temperature for 1 hour. Then, the reaction is separated and the residue is purified by thermolysis.
<p dir="rtl">10 C18 Medium pressure reversed phase (gradation: 5 to 90: acetonitrile m M H O M M 0.02:</p>
TFA (as phase) Production #134 (237 mg, 86:) A white colored solid.
LC-MS (Protocol Q): m/z 716.3 [M+H+],
ZMV retention = 1.16 min;
HPLC (Protocol A at 45 °C): /z 716.5 [M+H+],
15 Retention ZM = 6.930 min (purity < 98:).
1H NMR (400 MHz, DMSO-d6), 9.12-9.21(m), 8.79-8.90(m), 8.708.78(m), 7.95(d), 7.64(d), 7.25-7.36(m), 7.16 - 7.23 (m), 4.74- 4.80 (m), 4.61- 4.69 (m), 4.41- 4.59 (m), 3.91- 4.06 (m), 3.78 (dd), 3.543.64 (m), 3.45- 3.51 ( m), 3.17- 3.36 (m), 3.02- 3.15 (m), 3.00 (br s),
<p>2.40-2.48(m), 2.24- 2.35(m), 1.91- 2.21(m),. 1.68- 1.90 (m), 1.61- 20</p>
1.68(m), 1.48- 1.59(m), 1.22- 1.35(m), 0.97- 1.09(m), 0.84- 0.97
(m), 0.74-0.83 (m).
Tldhir
٤٠٦٩
-٢٨٥-
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-
2-(methyl amino)-2-oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-
oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#140), N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)- 3-{[(1S)-2-amino-1- 5
benzyl-2-oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-
1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-
Valinamide, trifluoroacetic acid salt (#141), N,2-dimethylalanyl-N-
{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-oxo-2-
(propylamino)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin- 10
1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-
Valinamide, trifluoroacetic acid salt (#142), N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1 -benzyl-2-(diethylamino)-2-
oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-
methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, 15 trifluoroacetic acid salt (#143), N,2-dimethylalanyl-N-{(1S,2R) -4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-(tert-butylamino)-2-oxoethyl]amino}-1-methoxy-2- methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid
salt (#144). 20
٤٠٦٩
-٢٨٦-
L-phenylalanine
Hunig's base, DMF
41%
<img file="SA4069B1_D0233.tif" />
F
<img file="SA4069B1_D0234.tif" />
F
<img file="SA4069B1_D0235.tif" />
<img file="SA4069B1_D0236.tif" />
<img file="SA4069B1_D0237.tif" />
<img file="SA4069B1_D0238.tif" />
Fmoc
<img file="SA4069B1_D0239.tif" />
#138
<img file="SA4069B1_D0240.tif" />
#139
1M methyl amine in THF, THF
30%
#139
7M ammonia in methanol, THF
20%
<img file="SA4069B1_D0241.tif" />
<img file="SA4069B1_D0242.tif" />
<img file="SA4069B1_D0243.tif" />
#139
1M tert-butylamine in THF, THF
<img file="SA4069B1_D0244.tif" />
Step 1: Synthesis
#139
1M n-propylamine in THF, THF
20%
#139
1M diethylamine in THF, THF
30%
24%
٤٠٦٩
-٢٨٧-
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-5-methyl-1-oxo-1-(pentafluorophenoxy)heptan -4-yl]-N-methyl-L-valinamide (#135).
Add 2.44 pentafluorophenyl 3,3,3-trifluoropropanoate ml, 13.4
<p dir="rtl">5 Milliliters of dichloromethane, then 1.61 milliliters of pyridine, 20.1 milliliters gramm, 3 m, 3 m. The compound is left to stir at room temperature for 12 hours. The compound is concentrated with acetate and the residue is purified by silica chromatography (gradation: SR:-70: acetone m heptanes) to produce 135#. (5.2 c, 98 :( White puff foam.</p>
LC-MS (Protocol Q1): m/z 812.1 [M+Na+] 10
ZMV retention = 1.24 minutes.
Step 2: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-2- carboxy-1-methoxypropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxo heptan-4-yl]-N-methyl-L- 15
Valinamide(#136).
10 milliliters of dioxane, 25 milliliters of HCl, 3.7 ml (3.7 ml) Add 10 ml dioxane #11 (2.31 ml, 8.05 mm mol, 1.2 ml). Use to stir the oven at a boiling temperature for 6 hours.
<p dir="rtl">20 The interaction is based on production in Egypt. Add 5.3 milliliters of 135# (5.3 ml, 6.7 mM dichloromethane), 30 milliliters of dichloromethane to the previous residue, then 3.5 milliliters of Hunig base (3.5 milliliters, 20 mM mol, 3 hydroxide). Leave the reaction. Stir at room temperature for 4 hours before washing with 1 ml HCl, then dry the organic layer with sodium sulfate, filter it, and purify it</p>
٤٠٦٩
-٢٨٨-
Silica (20: -50: Ethyl Acetate) white egypt t.
LC-MS (Protocol Q1): m/z 793.3 [M+H+]
<p dir="rtl">5 ZMV retention = 1.07 minutes.</p>
Step 3: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) )-1-methoxy-2-methyl-3-oxo-3-(pentafluorophenoxy)propyl]pyrrolidin-1-yl}-5-methyl-1-
oxoheptan-4-yl]-N-methyl-L-valinamide (#137). 10
Add 1.3 milliliters pentafluorophenyl 3,3,3-trifluoropropanoate, 7.1 mmol, 2 ml to 2.8 mmol mol 136#, 3.5 mmol Sand, 1 liter (30 ml) of dichloromethane, mixed with Of 0.85 milliliters of pyridine, 10.6 milliliters of pyridine, 10.6 milliliters of pyridine (10.6 milliliters of pyridine). 15 is synthesized by acetate, and the waste material is purified by silica chromatography (gradation: SR:-70: acetone m heptane) Production #137 (3.1 g, 92:) Boiled white.
LC-MS (Protocol Q1): m/z 959.2 [M+H+]
ZMV retention = 1.28 minutes.
Step 4: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N- 20 [(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3 -{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-
٤٠٦٩
-٢٨٩-
3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#138).
To mixed milliliters of 137# (493 mg, 0.514 mmol, 1 liter) (4 ml of DMF, add 84.9) L-phenylalanine mg, 0.514 mmol, 1
<p dir="rtl">5 (then 0.27 milliliters Hunig base, 1.54 milliliters, 3 mol). For 12 hours, the mixture is concentrated with the compound and the resulting mixture is transported by silica chromate. (Gradation: SR:-100: ethyl acetate m heptane) Production #138 (200 mg, 41:) White foam foam.</p>
LC-MS (Protocol Q1): m/z 940.3 [M+H+]
<p dir="rtl">10 ZMV retention = 1.08 minutes.</p>
Step 5: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) )-1-methoxy-2-methyl-3-oxo-3-{[(2S)-1-oxo-1-(pentafluorophenoxy)-3-phenylpropan-2-yl]amino}propyl]pyrrolidin-1-yl }-5-methyl-1-oxoheptan-4-yl]-N-methyl- 15
L-valinamide (#139).
Add 5 milliliters of 138# (200 mg, 0.213 mm mol, 1 liter) mM dichloromethane GFGF-3,3,3 pentafluorophenyl
126) Trifluoropropanoate MgM, 0.426 MgM, 2 MgM, 2 MgM
20 (0.051 ml, 0.64 mg mol, 3 ml). The mixture is stirred at 100 degrees Celsius.
The bangs last for 12 hours. The reaction is agitated by atomization, and the waste material is purified by silica chromatography (gradation: 100: ethyl acetate, heptanes). Production of 139# (174 mg, 74:) as a result of blue oil.
٤٠٦٩
-٢٩٠-
LC-MS (Protocol Q1): m/z 1128 [M+Na+]
ZMV retention = 1.23 minutes.
Step 6A: Synthesis
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-(methyl amino)- 2-oxoethyl]amino}-1-methoxy-2-methyl-3- 5
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#140).
To 1 milliliter of 139# (20 mg, 0.018 mg/mol, 1 ml) add 1 ml of THF, 0.18/ml of methylamine millilitre, 0.18 10 mM, 10 ml), and stirred The mixture is reduced to a boil at room temperature for 3 hours
Freeze, filled with DMSO, and subject to purification (method J*). Freeze, dry, and concentrate to give 140# (4 mg). 30: (solid material with white plov.
LC-MS (Protocol Q1): m/z 731.2 [M+H+],
ZMV retention = 0.70 min.
1H NMR (400 MHz, methanol-d4), 7.30-7.41 (m), 4.71-4.78 (m), 4.58- 15
4.69(m), 4.04-4.15(m), 3.86-3.98(m), 3.73-3.78(m), 3.61-3.70(m), 3.50-3.58(m), 3.32-3.47(m), 3.23-3.26 (m), 3.17-3.22 (m), 3.073.15 (m), 2.95-2.98 (m), 2.76-2.91 (m), 2.68-2.75 (m), 2.63-2.66 (m), 2.43-2.51 ( m), 2.22-2.28(m), 1.99-2.11(m), 1.74-1.96(m), 1.21
<p>1.31(m), 1.17-1.20(m), 0.92-1.10(m), 0.79-0.89(m). 20</p>
Step 6B: Synthesis
٤٠٦٩
-٢٩١-
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-2-amino-1-benzyl-2-oxo ethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#141).
<p dir="rtl">5 Following a similar procedure, complete #140 using #139 (20 mg, 0.018 mmol</p>
Ammonia, 1 mol, 7 milliliters of ammonia, 0.026 milliliters, 0.18 milliliters of ammonia, 10 mol E) And the purification (method *J), we pray #141 (3 Majlis, 20): Solid white puff.
LC-MS (Protocol Q): m/z 717.2 [M+H+],
10 ZMV retention = 0.79 min.
1H NMR (400 MHz, methanol-d4), 7.22-7.30 (m), 7.14-7.21 (m), 4.574.4.80 (m), 4.02-4.17 (m), 3.92-3.98 (m), 3.84-3.91 ( m), 3.32-3.74(m), 3.17-3.27(m), 3.06-3.14(m), 2.77-3.05(m), 2.65(s), 2.43-2.51(m), 2.21-2.26(m), 1.98-2.13(m), 1.70-1.94(m), 1.32-1.69(m),
<p>1.16-1.31(m), 0.89-1.13(m), 0.80-0.88(m). 15</p>
Step 6C: Synthesis
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-
2-oxo-2-(propyl amino)ethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#142). 20
Following a similar procedure, #140 was completed using #139 (20 mg, 0.018 mmol
THF, 1 molecule, 1 n-propylamine molecule, THF, 0.18 milliliters, 0.18 mm.
٤٠٦٩
-٢٩٢-
(Method J*) and purification (method J*), we obtain #142 (3 mol, 20): a white solid.
LC-MS (Protocol Q): m/z 759.2 [M+H+],
ZMV retention = 0.74 min.
1H NMR (400 MHz, methanol-d4), 7.15-7.29 (m), 4.71-4.79 (m), 4.52- 5
4.68(m), 4.04-4.17(m), 3.87-3.99(m), 3.73-3.99(m), 3.73-3.79(m), 3.50-3.70(m), 3.34-3.49(m), 3.06-3.23 (m), 2.79-2.99 (m), 2.442.50 (m), 2.28-2.43 (m), 2.22-2.27 (m), 1.75-2.10 (m), 1.34-1.61 (m), 1.16-1.29 ( m), 0.92-1.10(m), 0.77-0.89(m).
<p dir="rtl">10 Step 6D: Synthesis</p>
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-
2-(diethyl amino)-2-oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4 -oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#143).
<p dir="rtl">15 Following a similar procedure, #140 was completed using #139 (20 mg, 0.018 mmol</p>
(Method J, 1 ml), 1) diethylamine, 1 mol/m THF, 0.18 mol/m, 10 ml) and purification (Method J*), n Psalms on #143 (4 mags, 30): Solid tmada White plov.
LC-MS (Protocol Q): m/z 773.3 [M+H+],
<p dir="rtl">20 ZMV retention = 0.77 min.</p>
1H NMR (400 MHz, methanol-d4), 7.16-7.33(m), 5.10-5.17(m), 4.96
5.07(m), 4.68-4.75(m), 4.60-4.65(m), 3.61-4.23(m), 3.35-3.67(m),
٤٠٦٩
-٢٩٣-
<p>3.16-3.26(m), 2.99-3.15(m), 2.78-2.94(m), 2.30-2.52(m), 2.19</p>
<p>2.28(m), 1.73-2.13(m), 1.83-1.45(m), 1.19-1.31(m), 0.92-1.18(m), 0.80-0.89(m).</p>
Step 6E: Synthesis
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl- 5
2-(tert-butyl amino)-2-oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt #144.
Following a similar procedure, #140 was completed using #139 (20 mg, 0.018 mmol
<p dir="rtl">10 THF, 0.18 milliliters, 0.18</p>
(mm mol, 10 ml) and purification (method J*), we obtain #144 (3.4 mg, 24:) a white solid.
LC-MS (Protocol Q1): m/z 773.3 [M+H+],
ZMV retention = 0.74 min.
1H NMR (400 MHz, DMSO-d6), δ 8.21 (d), 8.03-7.98 (m), 7.92 (d), 15
<p>7.81-7.62(m), 7.46-7.16(m), 4.83-4.69(m), 4.68-4.56(m), 4.214.07(m), 3.92-3.86(m), 3.83-3.80(m), 3.74 -3.65(m), 3.60-3.48(m), 3.47-3.36(m), 3.28-3.13(m), 3.11-3.01(m), 2.96-2.82(m), 2.692.62(m), 2.54- 2.43(m), 2.38-2.12(m), 2.00-1.76(m), 1.69-1.161</p>
(m), 1.60-1.53(m), 1.52-0.98(m), 0.94-0.86(m). 20
Tldhir
N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1-
hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٢٩٤-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#145).
Fmoc
<img file="SA4069B1_D0245.tif" />
F
F
1. (1S,2R)-2-amino-1-phenylpropan-1-ol Hunig's base, DMF
2. Piperidine
CFCO2H
<img file="SA4069B1_D0246.tif" />
Step 1: Synthesis
N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1R,2S)-2- 5
hydroxy-1-methyl-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#145).
To milliliters of 137# (300 mg, 0.313 mmol, 1 liter) m3
10 Milliliters of DMF, add 54.8 (1S,2R)-2-amino-1-phenylpropan-1-ol mg, 0.344 mg mol, 1.1 ml (1.164 ml). γr, 0.939 mmol mol, 3 (Compatible). The mixture is stirred at room temperature for 12 hours. Next, 20 milliliters of piperidine are added: 1 ml DMF, 2.2 mg A molecule of grammium, 7 isomorphic) and the reaction is left to stir at room temperature Purification (method J*) followed by concentration for two hours
15 Suitable test tubes yield 145# (190 mg, 74:) boiled white pulp.
LC-MS (Protocol Q): m/z 704.3 [M+H+],
ZMV retention = 0.67 min.
1H NMR (400 MHz, CD3OD), δ 7.97 (d), 7.73 (d), 7.37-7.41 (m), 7.27
<p>7.36(m), 7.19-7.25(m), 4.70- 4.75(m), 4.58-4.63(m), 4.49-4.54</p>
(m), 4.14-4.30 (m), 4.04-4.11 (m), 3.87 (dd), 3.63-3.77 (m), 3.51- 20
<p>3.58(m), 3.46-3.49(m), 3.38- 3.43(m), 3.25-3.37(m), 3.15- 3.23</p>
٤٠٦٩
-٢٩٥-
(m), 3.11- 3.14 (m), 3.01- 3.02 (m), 2.59-2.64 (m), 2.52-2.55 (m), 2.44-2.52 (m), 2.41-2.43 (m), 2.07-2.26 ( m), 1.73-2.0 (m), 1.65
<p>1.73(m), 1.59- 1.65(m), 1.51-1.59(m), 1.32- 1.46(m), 1.23- 1.26</p>
(m), 1.08-1.21(m), 0.94-1.07(m), 0.83-0.92(m).
<p dir="rtl">5 Tldhir</p>
3-methyl-D-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2 -oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (#146), 3-methyl-L-isovalyl- N-
{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2- 10
oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L -valinamide (#147), L-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-
2-methoxy-2-oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- 15 oxobutyl}-N-methyl-L-valinamide (#148), D-isovalyl-N-{ (1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2-oxoethyl]amino}-1-methoxy-2 -methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-
methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (#149).
٤٠٦٩
-٢٩٦-
Fmoc
<img file="SA4069B1_D0247.tif" />
<p>1. #114, Hunig's base HATU, CH<sub>2</sub>Cl<sub>2</sub></p>
<p>2. diethylamine THF</p>
69%
<img file="SA4069B1_D0248.tif" />
H2
O
N
<img file="SA4069B1_D0249.tif" />
O
#146
HN
<img file="SA4069B1_D0250.tif" />
O
<img file="SA4069B1_D0251.tif" />
<p>1. #114, Hunig's base HATU, CH<sub>2</sub>Cl<sub>2</sub></p>
<p>2. diethylamine THF</p>
Fmoc<sub>N</sub>H<sub>O</sub>
82%
O
<img file="SA4069B1_D0252.tif" />
#147
HN
Fmoc
<img file="SA4069B1_D0253.tif" />
NH<sub>O</sub>
<p>1. #114, Hunig's base HATU, CH2Cl2</p>
<p>2. diethylamine THF</p>
35%
<sup>H</sup>2<sup>N</sup>
<img file="SA4069B1_D0254.tif" />
O
#148
HN
Fmoc
NH
OH
O
<p>1. #114, Hunig's base HATU, CH2Cl2</p>
<p>2. diethylamine THF</p>
30%
<sup>H</sup>2<sup>N</sup>
O
<img file="SA4069B1_D0255.tif" />
HN
<img file="SA4069B1_D0256.tif" />
HN
#149
Step 1A: Synthesis
3-methyl-D-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2 -oxoethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl- L-valinamide (#146).
10
15
Malakat 114# (225), 0.356 mm ػ - isovaline ml, 0.356 ml ml ml, 1 ml ml 4 ml ml dichloromethane. Add 0.188 milliliters of Hunig's base, 1.07 milliliters of Hunig's base, 3 mL of 167 milliliters of Hunig's base, 0.427 milliliters of Hunig's base The solution is left to stir at room temperature for 12 hours. Work with ethyl acetate before washing twice with 1 ml of HCl and once with 1 ml of sodium sulfate. The organic liquid is removed with Genevac (4 ml of THF). Diethylamine milliliters, 19 mM, 53.4 M). Al-Alaal takes the time to turn the world over for 12 hours. The drug is based on using Genevac and then
٤٠٦٩
-٢٩٧-
By means of chromatography of silica (gradation: p-30: methanol, ethyl acetate) to produce 146# (183 mg, 69:) solid.
LC-MS (Protocol Q): m/z 746.4 [M+H+]
ZMV retention = 1.37 minutes.
1H NMR (400 MHz, DMSO-d6), δ 8.55 (d), 8.26- 8.36 (m), 7.88-8.03 5
(m), 7.81 (d), 7.41-7.53 (m), 7.13-7.30 (m), 7.01 (s), 4.71-4.79 (m), 4.44-4.70 (m), 3.96-4.04 (m), 3.70 -3.80(m), 3.62-3.69(m), 3.403.61(m), 2.76-3.35(m), 2.67-2.71(m), 2.56-2.58(m), 2.06-2.46(m), 1.61- 1.90(m), 1.14-1.54(m), 0.72-1.12(m).
<p dir="rtl">10 Step 1B: Synthesis</p>
3-methyl-L-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2 -oxoethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (#147).
<p dir="rtl">15 Add 114 #1 mol (224 mol, 0.354 mol, 1 mol) ml2.</p>
Dichloromethane S9-n-(9H-Fluoren 125 (YLMTHOXY) CARBONYL] -3-metyl-l-visovaline A (4 millions of dichloromethane. Hunig (0.187 milliliters, 1.06 milligrams, 3 ml) then HATU (167 milliliters), 0.425 milligrams, 20 milliliters. Ermam, 1.2 meters). Leave the reaction to stir at room temperature for 12 hours. The relationship is centered
Use ethyl acetate before washing twice with 1 ml of HCl and once with 1 ml of ml. The organic layer is dried and labeled with sodium sulfate. Yazil organic liquid from genevac. Add 4 (4 ml) THF, then 2 (2) diethylamine ml, 19 mM THF, 53.7 ml. The compound is stirred for 12 hours. The compound is concentrated using THF genevac. ـ
٤٠٦٩
-٢٩٨-
By means of silica chromatography (gradation: p-30: methanol, ethyl acetate) to produce 147# (216 mg, 82:) solid.
LC-MS (Protocol Q): m/z 746.6 [M+H+]
ZMV retention = 1.29 minutes.
1H NMR (400 MHz, DMSO-d6), δ 8.56 (m), 8.31-8.39 (m), 8.50 (d), 5
<p>8.30(br d), 7.87-8.01(m), 7.80(d), 7.40-7.53(m), 7.14-7.30(m), 4.45-4.78(m), 3.94-4.04(m), 3.70-3.79( m), 3.61-3.69(m), 3.423.59(m), 2.97-3.37(m), 2.80-2.92(m), 2.32-2.49(m), 2.05-2.30(m), 1.61-1.89(m ), 1.37-1.56(m), 1.14-1.135(m), 0.70-1.11(m).</p>
10 Step 1C: Synthesis
L-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2-oxoethyl] amino }-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (#148).
<p dir="rtl">15 Add 1 mol mol 114# (447 mol, 0.707 mol mol, 1 mol) ml 2</p>
ml ml ml dichloromethane ml MG MG MG MG MG MG MG MG GF-9-N-[(9H-fluoren 240( ylmethoxy)carbonyl]-L-isovaline mg, 0.707 mM, 1 mL, 4 mM dichloromethane. Base addition, 0.373 mM Hunig HATU, 2.12 mg mol, 3 ml (then 332 mg HATU, 0.425 mg mol, 1.2 ml).
<p dir="rtl">20 Allow the temperature to flip at one degree or another for 12 hours. The agent is concentrated in the form of ethyl acetate before washing twice with 1 ml of HCl, 1 ml and 1 ml of HCl M. The organic layer is dried and labeled with sodium sulfate. Yazel Al-Mib, Organic M. Genevac adds 4 milliliters of THF, 26.9 milliliters of THF, 19 milliliters of THF Shake the mixture to stir for 12 hours, then shake it using Genevac.</p>
٤٠٦٩
-٢٩٩-
Alloylation of trophic silica (gradation: -30: methanol, ethyl acetate) Production #148 (182 mg, 35:) Solid.
LC-MS (Protocol Q1): m/z 732.3 [M+H+]
ZMV retention = 0.71 min.
1H NMR (400 MHz, DMSO-d6), δ 8.56 (d), 8.46-8.52 (m), 8.30 (d), 5
<p>8.02-8.15(m), 7.98(d), 7.80(d), 7.40-7.53(m), 7.15-7.30(m), 4.704.80(m), 4.44-4.69(m), 3.96-4.05(m ), 3.70-3.79(m), 3.62-3.69(m), 3.41-3.59(m), 2.99-3.35(m), 2.31-2.95(m), 2.67-2.71(m), 2.552.59(m) , 2.32-2.48(m), 2.20-2.31(m), 1.97-2.19(m), 1.61-1.88(m), 1.37-1.56(m), 1.20-1.34(m), 1.14-1.19(m), 1.02-1.11(m), 0.97-10</p>
1.01(m), 0.86-0.96(m), 0.71-0.83(m).
Step 1D: Synthesis
D-isovalyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-benzyl-2-methoxy-2-oxoethyl] amino }-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4- 15 oxobutyl}-N-methyl-L-valinamide (#149).
Malakat 114# 447, 0.707 mm ADADADADAD Maj, 0.707 1 ml mol, 1 ml (20 ml) 4 ml dichloromethane. Add 0.373 milliliters of Hunig base, 2.12 milliliters of mol, 3 mol, then 332 milliliters of HATU, 0.425 milliliters of mol, 1.2 mol (...) The reaction is moved to turn at the temperature of the room for 12 hours. Work with a solution of ethyl acetate before washing twice, 1 ml of HCl, 1 ml, 1 ml, and 1 ml, to remove the layer Organic sodium sulfate is manufactured from Genevac
٤٠٦٩
-٣٠٠-
Add 4 milliliters of THF (4 milliliters of THF), 26.9 milliliters of THF Shake the mixture to stir for 12 hours. The mixture is shaken using Genevac and then mixed with a silica thermometer (gradation: zero). 30: methanol (m ethyl acetate) production #149 (154 mg, 30:) solid.
LC-MS (Protocol Q): m/z 732.0 [M+H+]5
ZMV retention = 1.24 minutes.
1H NMR (400 MHz, DMSO-d6), δ 8.55 (d), 8.38-8.46 (m), 8.29 (d), 8.03-8.14 (m), 7.97 (d), 7.81 (d), 7.40-7.53 ( m), 7.14-7.28(m), 7.02(s), 4.71-4.79(m), 4.43-4.69(m), 3.96-4.05(m), 3.71-3.80(m),
<p>3.62-3.70(m), 3.49-3.60(m), 3.40-3.48(m), 3.15-3.34(m), 3.10-10</p>
<p>3.14(m), 3.01-3.09(m), 2.94-3.00(m), 2.83-2.93(m), 2.65-2.71(m), 2.55-2.59(m), 2.32-2.48(m), 2.04-2.31 (m), 1.61-1.89(m), 1.371.52(m), 1.21-1.35(m), 1.15-1.20(m), 1.02-1.10(m), 0.75-1.01(m).</p>
Tldhir
1,2-dimethyl-L-prolyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1- 15
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (#151).
NH<sup>OH</sup>
O
Formaldehyde 37 wt. % in water
Palladium 10 wt. % on carbon methanol
OH
100%
<p>1. #114, HATU</p>
Hunig's base, CH2Cl2
<p>2. LiOH, water</p>
THF
69%
#150
20 Step 1: Synthesis of (150#) 1,2-dimethyl-L-proline
٤٠٦٩
-٣٠١-
A parr tube is inserted that wraps around 1 (2-methyl-L-proline molecule, 7.7 mg ml, 1 ml), 40 ml. Weight: 37 kg Formaldehyde, methanol: 2.1 ml, 77 mol C, 10 ml Weight: 313 Palladium (and 10 Palladium). گر ڪر ڪر ڪر ڪر
<p dir="rtl">5 40 hydrogen pounds per square inch for 12 hours. It removes the hydrogen and filters out the reaction</p>
Your back, your plate, your back, your back, your back, your back MF MF MF MF MF 50: 50, methanol: dichloromethane. The compound mixed with the lipstick is concentrated in the production of #150 (1.1 GGF, 100:) a solid black and white colored substance.
LC-MS (Protocol Q): m/z 144.0 [M+H+]
<p dir="rtl">10 ZMV retention = 0.17 min.</p>
Step 2: Synthesis
1,2-dimethyl-L-prolyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-
oxobutyl}-N-methyl-L-valinamide (#151). 15
Coated stirred mixture mixture #114 (125 ml, 0.198 mg ml, 1 ml. (150), #150 (37 mg, 0.26 mg, 1.3 mg), and 98) HATU (37 mg, 0.26 mg, 1.3). Add 5 ml dichloromethane, add 0.14 ml Hunig base, 0.80 ml mol, 4.1 ml. The reaction is stirred at 100 ml The number of rooms is 20 for an hour and the number is based on the figure 6. THF (millilitres) to the other substance. To this point, the stirred mixture is added to 14 (14 ml) LiOH, 0.59 ml. Leave the mixture to stir at room temperature for 90 minutes and evaporate The material evacuated by the thermostat is abnormally phased, medium pressure C18 (level
٤٠٦٩
-٣٠٢-
10
15
20
Graded: 5 to 40: acetonitrile (ml) 0.02: acetonitrile (ml) TFA (151# (147 mg, 69):) a white colored solid.
LC-MS (Protocol Q): m/z 744.3 [M+H+],
ZMV retention = 1.19 min; Protocol A (HPLC at 45°C):
m/z 744.4 [M+H+],
Retention time = 6.631 minutes (purity < 98:).
1H NMR (400 MHz, DMSO-d6), δ 9.57-9.71(m), 8.75(d), 8.42(d), 8.15(d), 7.14-7.29(m), 4.70-4.79(m), 4.40- 4.68(m), 3.95-4.03(m), 3.73-3.80(m), 3.37-3.61(m), 2.97-3.31(m), 2.79-2.88(m), 2.662.76(m), 2.54-2.58 (m), 2.31-2.43(m), 1.94-2.29(m), 1.57-1.91(m), 1.21-1.52(m), 0.85-1.10(m), 0.74-0.82(m)
Tldhir
1,2-dimethyl-D-prolyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (#153).
1. #114, HATU
Hunig's base, C.H<sub>2</sub>Cl<sub>2</sub>
2. LiOH, water
THF
00703598-0711
<img file="SA4069B1_D0257.tif" />
O
#153
OH
78%
<img file="SA4069B1_D0258.tif" />
OH
Formaldehyde 37 wt. % in water
Palladium 10 wt. % on Carbon
<sub>OH</sub>methanol
NH
O 100%
#152
00110381-0967
Step 1: Synthesis of (#152) 1,2-dimethyl-D-proline.
To a parr flask containing 432 (432 mg) 2-methyl-D-proline, 3.34 mm mol
Weight: 1 ml, 37 ml Formaldehyde, 1 ml
٤٠٦٩
-٣٠٣-
<p dir="rtl">11 The flask is placed on a shaker Parr and leave a pressure pressure of 30 pounds per square inch for 30 days. 48 hours. The hydrogen is removed and the material is washed through a layer of celite, which has been washed after, with 5 ml of methanol. The organic materials are concentrated in the solution, then the coating is dissolved in 152 ml of toluene. (517 mg, 100:) solid substance.</p>
1H NMR (400 MHz, methanol-d4): δ [3.61-3.56 (m, 1H), 3.07-2.96 (m, 1H), 2.68 (br s, 3H), 2.34-2.22 (m, 1H), 2.01- 1.88 (m, 1H), 1.87-1.73
(m, 1H), 1.40 (br s, 3H)].
<p dir="rtl">10 Step 2 Synthesis</p>
1,2-dimethyl-D-prolyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (#153).
15 To mix the mixed stirred mixture #114 (240 mg, 0.379 mg, 1 mcg). (,)
<p dir="rtl">#152 (71 mg, 0.49 mM, 1.3 mL) and 188) HATU (0.49 mM, 1.3 mL) 10 mL dichloromethane, 0.27 mL Hunig base added Mm Particle C Armm, 4.1 The mixture is left to stir at room temperature for one hour. The mixture is stirred. Add 6 milliliters of THF (6 milliliters) to the raw material. To this, the mixture</p>
20 The reaction is added to the mixture: 36 mg LiOH, 1.5 mm mol, 4 ml, 2 ml water. The reaction is left to stir at room temperature for one hour. The reaction is stirred with the mixture and stirred. The material mixed with a word Chromatogen RM, moderate phase, medium pressure C18 (gradient level: 5 to 40: acetonitrile mL water 0.02 mL: TFA mL phase) #153 (220 mg, 78:) a white colored solid.
٤٠٦٩
-٣٠٤-
LC-MS (Protocol Q): m/z 744.8 [M+H+],
ZMV retention = 1.16 min; Protocol A (HPLC at 45°C):
/z 744.4 [M+H+],
Retention time = 6.713 minutes (purity < 98:).
1H NMR (400 MHz, DMSO-d6), δ 9.72-9.85 (m), 8.65 (t), 8.41 (d), 5
8.14(d), 7.14-7.28(m), 4.69-4.79(m), 4.38-4.53(m), 3.95-4.04(m), 3.73-3.79(m), 3.37-3.62(m), 3.13-3.33 (m), 2.95-3.10 (m), 2.792.89 (m), 2.67-2.75 (m), 2.00-2.46 (m), 1.61-1.90 (m), 1.22-1.54 (m), 1.02-1.09 ( m), 0.95-1.01(m), 0.85-0.94(m), 0.75-0.83(m)
10 Tldhir
N~2~-[2,2-dimethyl-3-(methylamino)propanoyl]-N-{(1S,2R)-2-methoxy-4-{(2S)-2-[(1R,2R)-1 -methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-1 -[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#154). 15
HN
<img file="SA4069B1_D0259.tif" />
O
CF3CO2H
#154
<p>1. #50, Hunig's base dichloromethane</p>
<p>2. 4M HCl in dioxane dioxane</p>
HNOH
O
41 % (2 steps)
Step 1: Synthesis
N~2~-[2,2-dimethyl-3-(methylamino)propanoyl]-N-{(1S,2R)-2-methoxy-4-{(2S)-2-[(1R,2R)-1 -methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-1 -[(1S)- 20
٤٠٦٩
-٣٠٥-
1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#154).
To a screw-on flask containing #50 (100 mg, 0.152 mM C, 1 M) and 1 mL dichloromethane, add 2,2-dimethyl-3-(methylamino)propanoic
<p dir="rtl">5 36 mg acid, 0.152 mg mol, 1 ml (following 0.080 Hunig base),</p>
0.456 mg mol, 3 mol (66 mg HATU, 0.17 ml mol, 1.1 mol). Allow the solution to be stirred on a tray. The drug is mainly composed of ethyl peroxide for an hour after birth. acetate before washing, twice as much as 1 ml of HCl and once as 1 ml of sodium sulfate. The agent is dried and added
10 Dioxane (1 milliliter) contains 4 mol HCl (1 milliliter) dioxane, 4 milliliter mol
The reaction moves to invert at one point the temperature of the room for a period of 12 hours. The reaction is attached to the shape i. The material is transported using a medium pressure diaphragm C18 medium pressure diaphragm Gradient: 10: to 100 : acetonitrile 0.02: TFA (TFA) (production of 154# (55.8 mg, 41:) solid substance.
LC-MS (Protocol Q): m/z 771.8 [M+H+]. 1H NMR (400 MHz, DMSO- 15 d6), δ 8.70 (d), 8.45 (d), 7.90-8.15 (m), 7.82 (d), 7.75 (d), 7.55 (dd), 7.40 (dd), 6.90-7.10(m), 5.10-5.30(m), 4.45-4.55(b), 4.30-4.45(m), 4.20-4.30(m), 3.75-3.90(m), 3.50-3.60(m), 3.15 -3.40(m), 3.053.15(m), 2.85-3.05(m), 2.60-2.85(m), 2.25-2.40(m), 1.80-2.25(m),
<p>1.70-1.80(m), 1.20-1.60(m), 0.80-1.10(m), 0.05-0.80(m). 20</p>
Tldhir
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[{N-[2,2-dimethyl-3-
(methylamino)propanoyl]-L-valyl}(methyl)amino]-3-methoxy-5-
٤٠٦٩
-٣٠٦-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-
phenylalaninate, trifluoroacetic acid salt (#155).
HN
<img file="SA4069B1_D0260.tif" />
CF3CO2H
O.O
#155
<p>1. #114, Hunig's base dichloromethane</p>
<p>2. 4M HCl in dioxane dioxane</p>
17 % (2 steps)
HNOH
O
Step 1: Synthesis
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[{N-[2,2-dimethyl-3- 5
(methylamino)propanoyl]-L-valyl}(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate, trifluoroacetic acid salt (#155).
To a vial containing 114# (96.2 mg, 0.152 mM, 1 mL) and 10 mL dichloromethane, add 2,2-dimethyl-3-(methylamino)propanoic
<p dir="rtl">3 (6.1 mg acid, 0.152 mM, 1 mol) Hunig base (0.080 mg, 0.456 mM, 3 mol) and HATU (66 ml, 0.17 mM, 1.1 mol). Stir at room temperature for one hour. The compound is concentrated with 1 molecule of ethyl acetate before washing twice. Cl and the time of birth is full of maloul</p>
<p dir="rtl">15 Okay. The organic layer is dried and labeled with sodium sulfate. The interaction is based on the condition. Add 1 milliliter Dioxane (4 milliliters of HCl) to 1 milliliter dioxane, 4 milliliters of HCl, 26 mol. The reaction changes to reduce At a temperature of 12 hours, the temperature depends on the shape. The material is transported using a thermometer telescope RM C18 medium pressure inverter. Grade: 10: 100: acetonitrile 0.02: acetonitrile 0.02: TFA 0.02</p>
20 Phase) Production 155 # (22.2 mg, 17:).
1H NMR (400 MHz, DMSO-d6), δ 8.55 (d), 8.22 (d), 8.15-8.35 (m), 7.90-8.05 (m) 7.10-7.25 (m) 4.70-4.80 (m), 4.55- 4.65(m), 4.45-4.52
٤٠٦٩
-٣٠٧-
(m), 3.93-4.00 (m), 3.72-3.78 (m), 3.60-3.70 (m), 3.50-3.60 (m), 3.40-3.50 (m), 2.80-3.30 (m), 2.45-2.60 ( m), 2.00-2.45(m), 1.601.80(m), 1.35-1.50(m), 1.10-1.35(m).
Tldhir
methyl N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5- 5
methyl-4-[methyl(N-{[(2S)-2-methylpiperidin-2-yl]carbonyl}-L-
valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-
phenylalaninate, trifluoroacetic acid salt (#158), methyl N-{(2R,3R)-3-
methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-)
{[(2R)-2-methylpiperidin-2-yl]carbonyl}-L- 10
valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-
phenylalaninate, trifluoroacetic acid salt (#159)
<img file="SA4069B1_D0261.tif" />
<img file="SA4069B1_D0262.tif" />
<img file="SA4069B1_D0263.tif" />
<img file="SA4069B1_D0264.tif" />
Synthesis -2-2S)-1-(tert-butoxycarbonyl)-2-methylpi peridine)
(2R)-1-(tert-butoxycarbonyl)-2-methylpiperidine-carboxylic acid (#156) 15
2-carboxylic acid (#157)
٤٠٦٩
-٣٠٨-
1-(tert-butoxycarbonyl)-2-methylpiperidine-2-carboxylic acid
(500 mg, 2.06 mM Chiralcel OJ-H, 1 mM) by Chiralcel OJ-H chromatography (column: 21 x 250 mM Chiralcel OJ-H); Filter material: 10:90 carbon dioxide/ ethanol; Check rate: 65 g/min; Give the corresponding enantiomers. Isolate, filter row 5, the first (time to lose retention = 1.57 minutes) give 156 filters (140 magazines). GF, 28: ((The creation of alchemy is arbitrarily created by its S enantiomer).
1H NMR (400 MHz, CDCl3) δ 3.83-3.90 (m, 1H), 2.93-3.01 (m, 1H), 1.87-1.97 (m, 1H), 1.67-1.77 (m, 3H), 1.48-1.66 (m , 2H), 1.46 (s, 3H), 1.44 (s, 9H).
10 Optical rotation: (α]D25 -21.7° (c 0.40, chloroform). Isolate the second filtering (retention time = 2.22 minutes) giving 157 # counterfeiting (255 mg, 51:) (Tl The glands of Timothy are arbitrarily separated by their permission R enantiomer (.
1H NMR (400 MHz, CDCl3) δ 3.83-3.90 (m, 1H), 2.93-3.01 (m, 1H), 1.87-1.97 (m, 1H), 1.67-1.77 (m, 3H), 1.48-1.66 (m , 2H), 1.46 (s, 3H), 1.44 (s, 9H). 15
Optical rotator: (α]D25 +30.2°(chloroform).
Step 2A: Synthesis
methyl N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-{[( 2S)-2-methylpiperidin-2-yl]carbonyl}-L valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L- 20 phenylalaninate, trifluoroacetic acid salt (#158).
156# 8.3 ml, 0.034 ml ml, 1 mtf(ml)
(0.3 dichloromethane ml) and 0.05 (N,N-dimethylformamide ml), add
٤٠٦٩
-٣٠٩-
HATU (0.018 milliliters, 0.102 mmol) (e) Stir the mixture for 15 minutes and add #114 (23.4 mg, 0.037 mm mol, 1.1 ml) and stir at room temperature for 18 hours. Take 2.5 milliliters of dichloromethane and add 10:5 ml. citric acid milliliters). The layers are separated using a quartz phase original cartridge. Class
Dechloromethane (Dichloromethane) (Dichloromethane) (Dichloromethane (Dichloromethane) Purification by reverse phase thermolysis (method M*) results in 158#10 (10.6 mg, 49:).
HPLC (Protocol T): m/z 758.4 [M+H+],
ZMf retention = 2.53 min (purity <99:).
1H NMR (400 MHz, DMSO-d6), δ 8.74-8.90(m), 8.49-8.55(m), 8.24(d), 8.08-8.12(m), 7.94-8.01(m), 7.14-7.26(m ), 4.71-4.77(m),
<p>4.57-4.68(m), 4.44-4.55(m), 3.94-4.0(m), 3.73-3.78(m), 3.40-3.7215</p>
(m), 3.16-3.32(m), 2.98-3.16(m), 2.82-2.92(m), 2.47-2.56(m),
<p>2.38-2.44(m), 2.20-2.37(m), 2.08-2.19(m) 1.74-1.88(m), 1.611.73(m), 1.52-1.59(m), 1.22-1.52(m), 1.05( dd), 0.94-1.00(m),</p>
0.85-0.93(m), 0.74-0.79(m).
<p dir="rtl">20 Step 2B: Synthesis</p>
methyl N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-{[( 2R)-2-methylpiperidin-2-yl]carbonyl}-L-
valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalaninate, trifluoroacetic acid salt (#159).
٤٠٦٩
-٣١٠-
157# 7.8 ml, 0.032 ml (0.017) N,N-diisopropylethylamine mL, 0.096 mm (14.9 mg) HATU (22.1 mg, 0.035 mM). Stir for 15 minutes. 5 Erm, 1.1 meters) and it turns stubbornly At room temperature for 3 hours, then shake with a scalpel. The waste material is purified by chromatolysis of silica gel (gradient level: acetone to 80 m heptane) to produce a white colored solid (0.2 m dioxane ml) and 4 standard HCl (0.2 m dioxane ml) is added. Stir the mixture at low temperature for two hours and add 4 mM 10 dioxane (0.1 ml). Stir the mixture for two hours at low temperature It is concentrated in the form of shefa if purification
By chromatography of a mild phase (Method M*) with 159# (6.6 mg, 33:3).
HPLC (Protocol T): m/z 758.4 [M+H+],
Retention = 2.46 minutes (purity = 89:).
1H NMR (400 MHz, DMSO-d6), δ 8.86-8.95(m), 8.75-8.84(m), 8.488.54(m), 8.33-8.45(m), 8.22-8.27(m), 8.17-8.19 (m), 7.99-8.12 (m),15
<p>7.83-7.91(m), 7.13-7.29(m), 7.04-7.08(m), 4.69-4.76(m),4.55</p>
4.66(m), 4.45-4.53(m), 3.96-4.01(m), 3.41-3.78(m), 3.28-3.33(m), 3.24-3.27(m), 3.16-3.23(m), 3.11-3.15 (m), 3.02-3.10 (m),2.93
<p>3.02(m), 2.91-2.93(m), 2.84-2.91(m), 2.76-2.82(m), 2.69-2.71(m), 2.60-2.63(m), 2.53-2.55(m), 2.47-2.53 (m), 2.40-2.46 (m), 2.30-20</p>
<p>2.38(m), 2.20-2.30(m), 2.06-2.17(m), 1.75-1.87(m), 1.52-1.74(m), 1.35-1.51(m), 1.14-1.34(m), 1.01-1.08 (m), 0.92-1.0 (m), 0.85-0.94</p>
(m), 0.74-0.82 (m).
Tldhir
٤٠٦٩
-٣١١-
N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-
4-[methyl(N-{[(2S)-2-methylpiperidin-2-yl]carbonyl}-L-
valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-
phenylalanine, trifluoroacetic acid salt (#162), N-{(2R,3R)-3-methoxy-3-
[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-{[(2R)-2- 5
methylpiperidin-2-yl]carbonyl}-L-valyl)amino]heptanoyl}pyrrolidin-2-yl]-
2-methylpropanoyl}-L-phenylalanine, trifluoroacetic acid salt. (#163).
H2
<img file="SA4069B1_D0265.tif" />
39 %
<sup>1)</sup>#157, HATU, iPrNEt<sub>2</sub>, CH2Cl2, DMF
48 %
1) #156, HATU, iPrNEt<sub>2</sub>, CH2Cl2, DMF
<img file="SA4069B1_D0266.tif" />
quantity (two steps)
O
68 % (two steps)
O
1) LiOH water/THF
2) TFA, CH2Cl2
1) LiOH water/THF
2) TFA, CH2Cl2
Step 1A: Synthesis
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(2S)-1-(tert- 10)
butoxycarbonyl)-2-methylpiperidin-2-yl]carbonyl}-L-valyl)(methyl)amino]-
3-methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate (#160).
156 #106 mg, 0.436 mg, 1 mtf (mm)
15 3 (dichloromethane ml) and 0.5 (N,N-dimethylformamide ml) add add
0.228 (DIISOPROPYLETYAYALAMINE Millions, 1.31 mm A). It decreases for a period of 15 minutes and is 114) 276 1 ml) and stir at room temperature for two hours. Add 10 ml (10 ml) of dichloromethane and wash with 1 ml 0:
20 5 x 3 citric acid (ml). The organic layer is dried with sodium sulfate, filtered and centrifuged.
٤٠٦٩
-٣١٢-
The topic covered by the word “Shafaq”. The mixed substance is purified by silica gelation (gradient level: R to 80: acetone m heptane) to 160#14 5 mag, 39:(.
LC-MS (protocol Q1): m/z 858.8 [M+H+],
ZMV retention = 1.12 minutes.
<p dir="rtl">5 Step 1B: Synthesis</p>
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(2R)-1-(tert-)
butoxycarbonyl)-2-methylpiperidin-2-yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-methyl heptanoyl}pyrrolidin-2-yl]-3-methoxy-2-
methylpropanoyl}-L-phenylalaninate (#161).
<p dir="rtl">10 157 #109 mg, 0.448 mg, 1 mtf (mm)</p>
3 (Dichloromethane (and 0.5 (N, N-DIMTHYLFORMAMIDE) 3, 3 (205 (HAT), 0.538 millimeters, Jerm, 1.2, 1.2). Stir the mixture for 15 minutes and add #114 (284 mg, 0.448 mg mol, 1 mol). After stirring, Degree
<p dir="rtl">15 To condition the bangs for two hours, add the mixture with 10 ml dichloromethane, wash with 10 ml:</p>
<p dir="rtl">5 citric acid × 3 milliliters. The organic layer is dried with sodium sulfate, filtered, and centrifuged. The filtrate is purified by chromatography of silica gel (gradient level: 100: acetone M heptane) to 161 M. (185 mg, 48:).</p>
LC-MS (Protocol Q): m/z 858.3 [M+H+],
20 ZMV retention = 2.25 minutes.
Step 2A: Synthesis
٤٠٦٩
-٣١٣-
N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-{[(2S) )-2-methylpiperidin-2-yl]carbonyl}-L-valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalanine, trifluoroacetic acid salt (#162).
<p dir="rtl">5 160 #145 mg, 0.169 mg, 1 ml mtf (mm)</p>
<p dir="rtl">1 Add 25 milliliters (25 milliliters) of lithium hydroxide, 0.338 milliliters of water (0.75 milliliters). Stir the mixture At a temperature, leave the room for two hours and evaporate until dry. Add 2.5 ml dichloromethane and add 1 ml trifluoroacetic acid. Stir the reaction for 30 minutes, shake with a straw.</p>
<p dir="rtl">10 It is purified by medium-pressure reversed-phase C18 chromatography (gradient: zero to 100: acetonitrile M water 0.02 M: TFA as phase) to produce the order of 162# (145 mg, 100 mg). O (hard material with white plov.</p>
HPLC (Protocol U): m/z 744.5 [M+H+],
Retention = 7.121 min (purity = 98:).
1H NMR (400 MHz, DMSO-d6). δ 8.76-8.96(m), 8.52-8.58(m), 8.38- 15
<p>8.43(m), 8.11- 8.16(m), 7.27-7.30(m), 7.12-7.27(m), 7.01-7.05</p>
(m), 4.71-4.79 (m), 4.48-4.67 (m), 4.39-4.47 (m), 3.79-4.22 (m), 3.71-3.78 (m), 3.38-3.57 (m), 3.22-3.30 ( m), 3.14-3.23(m), 3.073.13(m), 2.96-3.06(m), 2.76-2.87(m), 2.66-2.68(m), 2.47-2.57(m), 2.42-2.44(m ), 2.06-2.40(m), 1.73-1.89(m), 1.51-1.72(m), 1.36- 20
<p>1.49(m), 1.20-1.35(m), 1.00-1.09(m), 0.95-0.99(m), 0.83-0.94</p>
(m), 0.73-0.80 (m).
Step 2B: Synthesis
٤٠٦٩
-٣١٤-
N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-4-[methyl(N-{[(2R) )-2-methylpiperidin-2-yl]carbonyl}-L-valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}-L-phenylalanine, trifluoroacetic acid salt (#163).
<p dir="rtl">5 Ranks #161 (185 mg, 0.216 mM, 1 mol) to rank</p>
The missing address is #163, using the description verb to add #162. The yeast was purified using a C18 medium-pressure slurry (gradient grade: p Flour: 85: acetonitrile ml water 0.02 ml: TFA ml (production 163# (127 mg, 68): a white colored solid.
HPLC (Protocol U): m/z 744.5 [M+H+],10
Retention = 7.077 min (purity = 98:).
1H NMR (400 MHz, DMSO-d6). δ 8.79-8.99(m), 8.36-8.49(m), 8.128.17(m), 7.31-7.34(m), 7.11-7.27(m), 7.05-7.09(m), 4.71-4.77(m), 4.54-4.68(m), 4.40-4.53(m), 3.88-4.39(m), 3.71-3.77(m),3.39
<p>3.58(m), 3.22-3.32(m), 3.10-3.22(m), 3.04-3.09(m), 2.92-3.03(m),15</p>
<p>2.77-2.88(m), 2.68-2.71(m), 2.47-2.57(m), 2.43-2.45(m),2.30</p>
<p>2.42(m), 2.03-2.29(m), 1.74-1.88(m), 1.52-1.73(m), 1.37-1.51(m), 1.17-1.37(m), 1.00-1.07(m), 0.95-0.99 (m), 0.84-0.93 (m), 0.73</p>
0.81(m).
<p dir="rtl">20 Tldhir</p>
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-fluoropyrrolidin-3-yl]carbonyl} -L-valyl)(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate, trifluoroacetic acid salt (#172), methyl N-{(2R,3R)-3-
٤٠٦٩
-٣١٥-
[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-fluoropyrrolidin-3-yl]carbonyl}-L-valyl)(methyl)amino]-3 -methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate, trifluoroacetic acid salt
(#173).
10% Pd/C methanol 45 PSI H2 Boc<sub>2</sub>O
O
NaOH aq, MeOH
<img file="SA4069B1_D0267.tif" />
OH
LiOH aq.
<img file="SA4069B1_D0268.tif" />
74%
O
<img file="SA4069B1_D0269.tif" />
SFC separation
#166
99% quantity.
#168
#164
O
<img file="SA4069B1_D0270.tif" />
10% Pd/C methanol 45 PSI H<sub>2 </sub>Boc<sub>2</sub>O
O.O
<sup>N</sup>M<sup>a</sup>e<sup>O</sup>O<sup>H</sup>H<sup>aq, FOH</sup>LiOH aq.<sup>FOL</sup>
NBoc NBoc
99% quantity.
#169 #171
63%
#165 #167
HN
<sup>.</sup>CFCO2H
O
45% (two steps)
<img file="SA4069B1_D0271.tif" />
O
1) #168, HATU iPrNEt<sub>2</sub>, CH2Cl2, DMF
2) TFA, CH2Cl2
<sup>.</sup>CFCO2H
H2
<img file="SA4069B1_D0272.tif" />
51% (two steps)
1) #169, HATU, iPrNEt2, CH2Cl2, DMF
2) TFA, CH2Cl2
Step 1: Synthesis of methyl (3R)-1-benzyl-3-fluoropyrrolidine-3-carboxylate
(#164) and (#165) methyl (3S)-1-benzyl-3-fluoropyrrolidine-3-carboxylate.
Known: methyl 1-benzyl-3-fluoropyrrolidine-3-carboxylate
(3900 mol, 16.4 mol, 1 mol) by solvation
10 Large (column: Chiralpak IC, 21 x 250 mm; Filter material: 5:95 carbon dioxide/propanol; Check rate: 65 g/min; Give the corresponding enantiomers. Isolate the first liquid (retention time = 3.37 minutes) to provide 164# (1720 mg, 36:) as the reactive enantiomer (the foam chemistry is arbitrarily divided by its R enantiomer).
٤٠٦٩
-٣١٦-
1H NMR (400 MHz, TMS-CDCl3; δ 7.17–7.30 (m, 5H), 3.74 (s, 3H),
3.65 (d, J = 12.9 Hz, 1H), 3.63 (d, J = 12.9 Hz, 1H), 2.86–3.03 (m,
3H), 2.61 (q, J = 8.0 Hz, 1H), 2.34–2.46 (m, 1H), 2.13–2.26 (m, 1H).
Optical rotor: (α]D25 +24.7° (chloroform). Isolate the second filtering phase (retention time 5 = 3.91 min) to convert 165# (1600 mg, 33:) as a single enantiomer (time diffusion). GF
The arbitrarily arganized ear (S enantiomer).
1H NMR (400 MHz, CDCl3; (CH3)4Si), δ 7.17–7.30 (m, 5H), 3.74 (s, 3H), 3.65 (d, J = 12.9 Hz, 1H), 3.63 (d, J = 12.9 Hz, 1H), 2.86–3.03 (
m, 3H), 2.61 (q, J = 8.0 Hz, 1H), 2.34–2.46 (m, 1H), 2.13–2.26 (m,
1H). 10
Optical rotator: (α]D25 - 23.3° (chloroform).
Step 2A Synthesis
1-tert-butyl 3-methyl (3R)-3-fluoropyrrolidine-1,3-dicarboxylate (#166).
164# (355 mg/ml, 1.50 mg/ml)
<p dir="rtl">15 And 400 (Di-tert-butyl carbonate) 1.8 ml, 1.2 ml (1.2 ml).</p>
<p dir="rtl">Add 15.5 methanol (15.5 milliliters) of Pd/C (10:70 mg). The mixture is hydrogenated at a pressure of 45 psi to be filled with a square layer of Parr for 22 hours. Then, it was filtered through celite, and the filtered antigen was concentrated by electrolyte and purified by chromatography gel. Silica (graded level: R to 30: ethyl acetate m heptane) to provide 166# fast lubrication (272 mg, 74:).</p>
1H NMR (400 MHz, CDCl3), δ 3.87 (s, 3H), 3.85-3.66 (m, 3H), 3.56 (m, 20
1H), 2.53-2.28 (m, 2H), 1.51 (s, 9H).
Step 2B: Synthesis
٤٠٦٩
-٣١٧-
1-tert-butyl 3-methyl (3S)-3-fluoropyrrolidine-1,3-dicarboxylate (#167).
It steps from #165 (362 mg, 1.53 mM, 1 mol) to #167 with a yield of 63: using the method described above gel #164.
1H NMR (400 MHz, CDCl3), δ 3.87 (s, 3H), 3.85-3.66 (m, 3H), 3.56 (m,
1H), 2.53-2.28 (m, 2H), 1.51 (s, 9H). 5
Step 3A: Synthesis
(3R)-1-(tert-butoxycarbonyl)-3-fluoropyrrolidine-3-carboxylic acid (#168).
To mmol mol 166# (272 mol mol, 1.10 mol mol, 1 mol) ml
<p dir="rtl">10 2.96 milliliters of methanol (add 2.5 milliliters of sodium hydroxide)</p>
Gram, 0.88 ml) and stir the solution at room temperature for three and a half hours. The agent is quenched with suitable 10: citric acid (5 ml), add 100 ethyl acetate (100 ml). The layers are removed and the organic layer is washed with 10 ml : citric acid, water, and 1 ml, dried with sodium sulfate, filtered and centrifuged to form #168, a white solid (253
15 Maj., 99:(.
1H NMR (400 MHz, CDCl3), δ 3.96-3.69 (m, 3H), 3.59 (m, 1H), 2.59
<p>2.33 (m, 2H), 1.51 (s, 9H). LC-MS (Protocol Q1): m/z 232.1 [M-H+],</p>
Retention time = 0.67 minutes. Chiral HPLC retention time: 3.39 min (purity = 99). Column: 4.6 mg GFCF 5-60: CO2/
<p dir="rtl">20 Methanol, flow rate 3 ml/min); optical rotor:</p>
[α]D25 4.8 (c= 0.52, MeOH)
Step 3B: Synthesis
٤٠٦٩
-٣١٨-
(3S)-1-(tert-butoxycarbonyl)-3-fluoropyrrolidine-3-carboxylic acid (#169).
To mmol 167# (238 mol, 0.963 mmol, 1 mol) methanol (2.6 ml) add mol Cloudy 2.5(sodium hydroxide) molecule
<p dir="rtl">5 Gram, 0.88 milliliters) and stir the agent at room temperature for three hours. The agent is quenched.</p>
Then, add 10 M:citric acid (5 ml) and add 100 ml (100 ml) of ethyl acetate, and the layers are separated. The organic layer is washed with 10 M: citric acid, water, 100 ml, dried, and leached H and it is arranged by Shat Ltw See #169 Hard Tamada with White Plum (221 mg, 99:).
1H NMR (400 MHz, CDCl3), δ 3.96-3.69 (m, 3H), 3.59 (m, 1H), 2.59- 10
2.33 (m, 2H), 1.51 (s, 9H). LC-MS (Protocol Q1): m/z 232.1 [M-H+],
Retention time = 0.67 minutes. Chiral HPLC retention time: 3.95 minutes (purity = 98): (Columns: Chiralpak AD-H, 4.6 mg x 25 kilograms). Flow rate: 5-60: CO2/Methanol, flow rate: 3 ml/min); Optical rotor:
[α]D25 -3.6 (c= 0.55, MeOH) 15
Step 4A: Synthesis
lithium(3R)-1-(tert-butoxycarbonyl)-3-fluoropyrrolidine-3-carboxylate (#170).
To mol of 168# (50 mg, 0.21 mm mol, 1 liter) 20 m methanol (0.2 ml) add 9.2 ml of lithium hydroxide (mg, 0.38 mm mol),
<p dir="rtl">1.8 ml of water (0.1 ml). After 0.3 ml, add 0.3 ml of tetrahydrofuran and stir the reaction at 45 °C for 18 hours. The reaction is agitated and the substance is boiled at its boiling point.</p>
٤٠٦٩
-٣١٩-
Constant (3 m2) toluene milliliters) to obtain #170 (51 mg, 100:) a white colored solid used in the next step without further purification.
Step 4B: Synthesis
lithium(3S)-1-(tert-butoxycarbonyl)-3-fluoropyrrolidine-3-carboxylate (#171). 5
To mol 169# (75 mg, 0.32 mmol, 1 ml) methanol (0.3 ml) add 13.8 mmol lithium hydroxide, 0.572 mmol (0.4 milliliters) After that, add 0.45 milliliters of tetrahydrofuran and stir the reaction at 45 °C for 18 hours. The reaction is stirred and the substance is stirred until
10 Toluene (3 ml) to reach 171# (77 mg, 100): a white solid, which is used in the next step without further purification.
Step 5A: Synthesis
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-
fluoropyrrolidin-3-yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L- 15 phenylalaninate, trifluoroacetic acid salt (#172).
To a suspension of 168# (36.9 mg, 0.158 mg/mol, 1 mol) and #114 (100 mg, 0.158 mg). 1 ml, 1 ml (0.8 ml) of N,N-dimethylformamide (ml) and 3.6 (dichloromethane) ml(add N,N-diisopropylethylamine)
20 (0.083 milliliters, 0.474 mg mol C, 3 Mg) HATU 60.7 MgCl, 0.158
One milligram of the molecule, 1 methylene, and the mixture is stirred at a temperature of 18 hours. The compound is mixed with ethyl acet ate and washed thoroughly with water, 10% citric acid (weight/pound), and ml. The organic layer and the sodium sulfate layer were shaken to the condition, giving 220 mg (164: theoretically) of the raw material.
٤٠٦٩
-٣٢٠-
<p dir="rtl">(23 m) dichloromethane (1.5 ml) and add 0.4 (0.4 ml) trifluroacetic acid. The mixture is stirred at room temperature for two hours and evaporated to dryness with a filter. Purification by mild phase chromatography (method M*) is #172 (15.8 mg, 51:)</p>
LC-MS (Protocol Q): m/z 748.9 [M+H+]
<p dir="rtl">5 ZMV retention = 1.29 minutes.</p>
1H NMR (DMSO- δ -9.43(m), 8.48-8.53(m), 8.40-8.44
(m), 8.34-8.39 (m), 8.22-8.30 (m), 8.09-8.16 (m), 7.87-7.91 (m),
7.77-7.83(m), 7.12-7.24(m), 4.56-4.72(m), 4.41-4.54(m), 3.924.00(m), 3.70-3.75(m), 3.39-3.66(m), 3.20 10
(m), 2.29- 2.45 (m), 2.15- 2.27 (m), 2.02-2.15 (m), 1.57-1.87 (m), 1.33- 1.51 (m), 1.19-1.30 (m), 1.02 (dd) , 0.82-0.97(m), 0.70-0.79
(m).
Step 5B: Synthesis
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3- 15
fluoropyrrolidin-3-yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate, trifluoroacetic acid salt (#173).
To a suspension of 169 #1 (36.9 mg, 0.158 mg/mol, 1 mol) and 114 #20 (100 mg, 0.158 mg). G-arm molecule, 1 ml (0.8 ml) N,N-dimethylformamide
Add 3.6 milliliters of dichloromethane (add N,N-diisopropylethylamine) 0.083 milliliters, 0.474 milliliters of mol HATU, 3 mol (60.7 mol) HATU, 0.158 mm mol, 1 mol) The reaction is reversed when Soak it at room temperature for 14 hours, mix it with ethyl acetate, and wash it thoroughly with water, 10: citric acid, suitable (weight/pound), and ml.
٤٠٦٩
-٣٢١-
Okay. The organic layer is dried with sodium sulfate and separated to give 180 mg (134: theoretically) of the middle grade. In a section of this, the middle grade (50 mg, 27:)
0.4 ml (stir) trifluroacetic acid (1.5 ml) and add (dichloromethane)
The mixture is at a boiling temperature for two hours and evaporated until it is dry in the oven. The purification is by means of
<p dir="rtl">5 173# (17.6 mg, 45:)</p>
LC-MS (Protocol Q): m/z 748.9 [M+H+]
ZMV retention = 1.29 minutes.
1H NMR (DMSO-d6) δ 9.35-9.50(m), 9.22-9.34(m), 8.47-8.52(m), 8.39-8.45(m), 8.30-8.37(m), 8.22-8.24(m), 8.09-8.13(m),7.80
7.85(m), 7.67-7.72(m), 7.09-7.24(m), 6.97-6.98(m), 4.65-4.72(m),10
<p>4.55-4.64(m), 4.41-4.50(m), 3.92-3.99(m), 3.42-3.75(m),3.32</p>
<p>3.39(m), 3.25-3.31(m), 3.21-3.24(m), 3.11-3.20(m), 3.06-3.11(M), 2.97-3.05(m), 2.95(br s), 2.83-2.88( m), 2.76-2.82(m), 2.65-2.70(m), 2.44-2.54(m), 2.15-2.42(m), 2.02-2.14(m), 1.57-1.84(m),</p>
<p>1.33-1.48(m), 1.19-1.30(m), 1.02(dd), 0.92-0.97(m), 0.82-0.91(m),15</p>
0.70-0.77(m).
Tldhir
(2S)-N-[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2, 4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4- 20 yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2 -
Carboxamide, hydrochloride salt (#178), (2R)-N-[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3- {[2-(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl -1-
٤٠٦٩
-٣٢٢-
0X0heptan-4-yl](methyl)amin0}-3-methyl-l-0X0butan-2-yl]-2-methylpiperidine-2-carboxamide, hydrochloride salt (*180).
<img file="SA4069B1_D0273.tif" />
<img file="SA4069B1_D0274.tif" />
Step 1: Synthesis
pentafluorophenyl (3R,4S,5S)-4-[{N-[(9H-fluoren-9- 5)
ylmethoxy)carbonyl]-L-valyl}(methyl)amino]-3-methoxy-5-methylheptanoate (**174).
To a solution of 5@# (19.43 g, 37.03 mmol, 1 equiv) in dichloromethane (0 1 mmol) and pyridine (5.86 g, 74.1 mmol, 2
<p dir="rtl">10 equiv) Add pentafluorophenyl trifluoroacetate (7.02 g, 74.1 mmol, 2 equiv) and stir the reaction at room temperature for 1 hour. The reaction was concentrated by vacuum and purified by silica gel chromatography (gradient level: 0 to 52 ethyl acetate in heptane) to provide 174# (23.58 g, 92%) as a yellow oil.</p>
LCMS (Protocol QI): m/z 691.2 [Μ+Η+],
15 Retention time = 1.23 minutes.
Step 2: Synthesis
٤٠٦٩
-٣٢٣-
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl] amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N~2~-[(9H-fluoren- 9-ylmethoxy)carbonyl]-N-methyl-L-valinamide (#175).
5 to mol of 174# (706 mg, 1.02 mM, 1 H) and 64# (311
Add 400 N,N -diisopropylethylamine mg, 3.07 mm mol, 3 ml. After 18 hours of stirring at room temperature GF , the compound is synthesized in the form of silica gel (gradient level: R to 100: ethyl acetate m heptane(
10 To supply #175 (560 mg, 68): solid white puff pastry.
LC-MS (Protocol Q1): m/z 611.8 [M+H+],
ZMV retention = 1.15 minutes.
Step 3: Synthesis
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl] amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3- 15 methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#176 ).
According to General Rule A, 175# (560 mg, 0.690 mg mol, 1 ml) dichloromethane (9 ml), and 6) N,N-diethylamine ml (gr), creating the desired raw compound, which is purified by Fluorescence globulin silica gel (gradient level: 0 to 20 50: methanol, dichloromethane) 176# (351 ml, 87 ml)
Asr R.
LC-MS (Protocol Q1): m/z 589.5 [M+H+],
ZMV retention = 0.72 min.
٤٠٦٩
-٣٢٤-
Step 4A: Synthesis
tert-butyl (2S)-2-{[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-( cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan- 4-
yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-2- 5 methylpiperidine-1-carboxylate (#177).
According to General Procedure D, from #176 (100 mg, 0.170 mg mol, 1 mol), #156 (53.8 mol, 0.221 mg mol, 1.3 mol), 4. 5) dichloromethane milliliters, 84.9 HATU MGGFCGFF, 0.221 ml CF E(
10 And 0.123 (N,N-diisopropylethylamine) milliliters, 0.697 milliliters, 4.1 milliliters If the desired message is left behind, the pictures are moved by a silica gel film (Gradient level: R to 100: ethyl acetate m heptane) To supply #177 (145 mg, ground water yield) solid white puff pastry.
LC-MS (Protocol Q1): m/z 814.7 [M+H+],
15 ZMV retention = 1.14 minutes.
Step 4B: Synthesis
tert-butyl (2R)-2-{[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-( cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan- 4-
yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-2- 20 methylpiperidine-1-carboxylate (#179).
According to General Procedure D, from #176 (100 mg, 0.170 mg mol, 1 mol), #157 (53.8 mol, 0.221 mg mol, 1.3 mol), 4. 5(dichloromethane
٤٠٦٩
-٣٢٥-
(84.9) (Hatu Majra ػ A, 4.1, a (, the desired use of the time RAM silica (graded level: RR to 100): ethyl acetate (m heptane) to provide #179 (155 mg, 5 milliliters of water) as a solid material with white fluff.
LC-MS (Protocol Q1): m/z 814.7 [M+H+],
ZMV retention = 1.14 minutes.
Step 5A: Synthesis
(2S)-N-[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2, 4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3- 10 oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-
yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide, hydrochloride salt (#178).
According to the general formula C, 177# (143 mg, 0.176 mg mol, 15 mol) and 4 mol dioxane (2 ml) create the desired substance. 145 MGV. The section is described as MGV HF A white colored solid.
1H NMR (400 MHz, DMSO-d6), δ 8.96-9.07 (m), 8.79-8.96 (m), 8.58 (d), 8.02- 8.08 (m), 7.77-7.83 (m), 7.25-7.31 (m ), 7.19-7.24(m),
<p>6.56-6.67(m), 6.12-6.21(m), 5.13-5.22(m), 4.72-4.81(m), 4.63-4.7020</p>
(m), 4.50-4.59(m), 4.07-4.16(m), 3.98-4.05(m), 3.80-3.86(m),
<p>3.55-3.76(m), 3.46-3.54(m), 3.38-3.44(m), 3.26-3.35(m), 3.183.24(m), 3.05-3.18(m), 2.98-3.04(m), 2.40 -2.55(m), 2.27-2.35(m),</p>
٤٠٦٩
-٣٢٦-
<p>2.08-2.27(m), 1.74-1.98(m), 1.50-1.74(m), 1.20-1.46(m), 0.731.16(m). LC-MS (Protocol Q1): m/z 714.6 [M+H+],</p>
ZMV retention = 0.76 min.
HPLC (Protocol U): m/z 714.5 [M+H+]
5 Retention = 7.124 minutes (purity = 91:).
Step 5B: Synthesis
(2R)-N-[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2, 4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-
yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2- 10 carboxamide, hydrochloride salt (#180).
According to the general formula C, 179# (162 mol, 0.199 mol C, 1 mol) and 4 mol C dioxane (2 mol). (It creates the desired substance (155 mg). Some of it contains A mixture of 1/1 mg of glycan (25 mg).
15 methanol/acetonitrile to provide 180# (20 mg, 83:) solid.
1H NMR (400 MHz, DMSO-d6), δ 9.02-9.13 (m), 8.83-8.93 (m), 8.398.46 (m), 8.00-8.06 (m), 7.78 (t), 7.24-7.30 (m ), 7.16-7.21(m), 6.546.65(m), 6.09-6.19(m), 5.11-5.18(m), 4.69-4.78(m), 4.59-4.68(m), 4.46-4.56(m) , 4.08-4.13(m), 3.95-4.03(m), 3.77-3.85(m), 3.54
<p>3.73(m), 3.43-3.53(m), 3.37-3.42(m), 3.24-3.33(m), 3.16-3.22(m), 20</p>
<p>3.03-3.15(m), 2.99-3.02(m), 2.89-2.98(m), 2.65-2.76(m), 2.412.54(m), 2.15-2.39(m), 2.07-2.15(m), 1.51 -1.94(m), 1.49(d), 1.38</p>
٤٠٦٩
-٣٢٧-
(t), 1.20-1.32(m), 1.02-1.09(m), 0.84-0.97(m), 0.73-0.81(m). LC-MS (Protocol Q1): m/z 714.6 [M+H+],
ZMV retention = 0.76 min
HPLC (Protocol U): m/z 714.4 [M+H+],
<p dir="rtl">5 Retention = 7.409 min (purity = 90:).</p>
Tldhir
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-
(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan -4-yl]-N-methyl-L-valinamide, formic acid salt (#182), N-[(3R,4S,5S)-1-{(2S)-2- 10
[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl }-3-methoxy-5-methyl-1-oxoheptan-
4-yl]-N~2~-{[(3R)-3-fluoropyrrolidin-3-yl]carbonyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#184), N-[(3R,4S) ,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy- 2- 15-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-
4-yl]-N~2~-{[(3S)-3-fluoropyrrolidin-3-yl]carbonyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#186).
٤٠٦٩
-٣٢٨-
<img file="SA4069B1_D0275.tif" />
Step 1A: Synthesis
1-(tert-butoxycarbonyl)-2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-( cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan- 5
4-yl]-N-methyl-L-valinamide (#181).
According to General Procedure D, from 176# (100 mg, 0.170 mg mol, 1 mol), 50.7(S)-1-(tert-butoxycarbonyl)-2-methyl-L-proline mol, 0.221 ml M GFGF 0.221 mM dichloromethane, 1.3 mM, 1.3 mM E) and 0.123 (N,N-diisopropylethylamine) milliliters,
0.697 mM mol, 4.1 mM, creating the desired raw material, purified by chromatography of silica gel (gradient level: MR to 100: ethyl acetate m heptane) to provide 181# (142 mg, 2 mM water yield). (.
LC-MS (Protocol Q1): m/z 800.6 [M+H+],
15 ZMV retention = 1.11 minutes.
Step 1B: Synthesis
tert-butyl (3R)-3-{[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-
(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-
٤٠٦٩
-٣٢٩-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-3-fluoropyrrolidine- 1-carboxylate (#183).
18.2 mg/ml, 0.076 mg/ml, 1 ml پاِ (عَقْعِم)
5 1.8 (dichloromethane ml) and 0.3 (N,N-dimethylformamide ml) add
(0.040 N,N-diisopropylethylamine ml, 0.228 mg mol, 3 mol) (following 29.2 mg HATU, 0.076 ml mol, 1 mol). After stirring for 10 minutes at °C GF, add 176 # (45 mg, 0.076 mg, 1 ml). Stir at room temperature for 18 hours and add HATU (29 mg, 0.076 mm).
10 1 gm molecule, 1 ml). After 8 hours, the compound is synthesized by the compound to form #183 (60 mg, ml), which leads to the next step without further purification.
LC-MS (Protocol Q1): m/z 826.6 [M+Na+],
ZMV retention = 1.05 minutes.
Step 1C: Synthesis
tert-butyl (3S)-3-{[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2- 15
(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-3-fluorocyclopentanecarboxylate ( #185).
20 171 #24 mg, 0.1 mg kgfgfg part c rmfkfkfm, 1 mtff(ffgffm
0.33 ml (add) N,N-dimethylformamide 2.35 ml (and) dichloromethane
(0.053 milliliters N,N-diisopropylethylamine, 0.300 mmol, 3 ml) (following 38.4 mg HATU, 0.100 mmol, 1 mol). After stirring at room temperature for 1 liter 0 minutes, 176 added # (58.9 mg, 0.1 mM, 1 mol). Stir
٤٠٦٩
-٣٣٠-
Boil at room temperature for 18 hours and add additional 38.4 mg HATU, 0.100 mg mol, 1 mol and 0.2 mM N,N-dimethylformamide R) and stir for an additional 9 hours. Shake The treatment with the solution gives 185# (80 mg, tm), which postpones the next step without further purification.
LC-MS (Protocol Q1): m/z 804.6 [M+H+], 5
ZMV retention = 1.05 minutes.
Step 2A: Synthesis
2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6- trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N- 10 methyl-L-valinamide, formic acid salt (#182).
According to the general formula C, 181# (136 mol, 0.170 mol C, 1 mol) and 4 mol C dioxane (2 mol). (It creates the desired substance (142 mg). A portion of it contains The crude residue (20 mg, 14 mg): 15 mg of a 1/1 mixture of methanol/acetonitrile, then purified by a reverse-phase thermometer.
(Method O) to obtain #182 (10 mg, 57: in two steps) a solid.
HPLC (Protocol U): m/z 700.4 [M+H+],
Retention = 7.106 min (purity < 90:).
1H NMR (400 MHz, DMSO-d6), δ 8.25-8.39 (m), 8.20-8.25 (m), 7.96
7.99(m), 7.74-7.77(m), 6.55-6.63(m), 6.10-6.18(m), 5.11- 5.18 20
(m), 4.66-4.72 (m), 4.51-4.61 (m), 4.46-4.50 (m), 3.96-4.01 (m), 3.37-3.86 (m), 3.20-3.36 (m), 3.11-3.19 ( m), 3.03-3.11(m), 2.983.03(m), 2.90-2.96(m), 2.77-2.79(m), 2.65-2.73(m), 2.57-2.63(m),
٤٠٦٩
-٣٣١-
<p>2.47-2.56(m), 2.36-2.46(m), 2.26-2.32(m), 2.14-2.25(m),2.03</p>
<p>2.10(m), 1.92-2.03(m), 1.72-1.92(m), 1.64-1.72(m), 1.60-1.64(m), 1.50-1.59(m), 1.39-1.48(m), 1.23-1.32 (m), 1.18-1.22 (m),1.12</p>
<p>1.14(m), 1.01-1.09(m), 0.83-1.00(m), 0.74-0.83(m), 0.70- 0.74</p>
(m).5
Step 2B: Synthesis
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl] amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N~2~-{[(3R)- 3-fluoropyrrolidin-3-yl]carbonyl}-N-methyl-L-valinamide trifluoroacetic acid salt (#184). 10
According to general procedure C, from 183# (61.1 mg, 0.076 mol ml, 1 ml), 0.3 ml dichloromethane, and 4 ml hydrochloric acid (0.9 ml dioxane) create the desired substance etc. (140) (Method M (Give it to others #184
15 (7.6 mg, 20: in two steps).
HPLC (Protocol T): m/z 704.5 [M+H+],
Retention = 2.50 minutes (purity = 84:).
1H NMR (400 MHz, DMSO-d6), δ 8.67-8.71 (m), 8.44-8.48 (m), 8.278.33 (m), 8.22-8.27 (m), 7.97-8.03 (m), 7.84-7.89 (m), 7.74-7.81 (m), 7.43-7.48 (m), 7.23-7.29 (m), 7.17-7.21 (m), 6.55-6.66 (m), 6.10-20
<p>6.19(m), 5.10-5.19(m), 4.66-4.75(m), 4.51-4.63(m), 3.96-4.04(m), 3.78-3.85(m), 3.65-3.73(m), 3.46-3.62 (m), 3.37-3.45 (m), 3.24</p>
<p>3.37(m), 3.21-3.24(m), 3.13-3.21(m), 3.02-3.13(m), 2.95-3.00(m), 2.80-2.82(m), 2.66-2.71(m), 2.47-2.57 (m), 2.24-2.46 (m),2.09-</p>
٤٠٦٩
-٣٣٢-
<p>2.24(m), 1.95-2.05(m), 1.49-1.93(m), 1.22-1.34(m), 1.02-1.09(m), 0.83-1.01(m), 0.74-0.82(m).</p>
Step 2C: Synthesis
N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl] amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3- 5 methoxy-5-methyl-1-oxoheptan-4-yl]-N~2~-{[(3S) -3-fluoropyrrolidin-3-yl]carbonyl}-N-methyl-L-valinamide, trifluoroacetic acid salt (#186).
According to the chemical formula C, 185# (80.3 mol, 0.1 mol mol, 1 mol), 0.4 mol (0.4 ml) of hydrochloric acid M
10 Dioxane (1.2 milliliters) The desired raw material is created, so that the portion (94 mg, 53:) is purified by
186 ml (11.8 mag, 32: in two steps).
1H NMR (400 MHz, DMSO-d6), δ 8.85-9.07(m), 8.29-8.41(m), 7.998.04(m), 7.76-7.84(m), 6.56-6.68(m), 6.12-6.21 (m), 5.12-5.21(m), 4.87-4.99(m), 4.69-4.79(m), 4.49-4.67(m), 3.98-4.06(m), 3.80-15
<p>3.87(m), 3.64-3.76(m), 3.55-3.64(m), 3.47-3.54(m), 3.39-3.46(m), 3.26-3.39(m), 3.22-3.25(m), 3.18- 3.22 (m), 3.06-3.14 (m), 2.98</p>
<p>3.01(m), 2.55-2.57(m), 2.42-2.49(m), 2.11-2.38(m), 2.09(s), 1.78-1.97(m), 1.72-1.77(m), 1.51-1.71(m) ), 1.24-1.36(m),1.07</p>
(dd), 0.83-1.03(m), 0.75- 0.82(m). HPLC (Protocol T): m/z 704.520
[M+H+],
Retention = 2.48 minutes (purity = 100:).
Tldhir
٤٠٦٩
-٣٣٣-
(2S)-N-[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan -4-
yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide, formate salt (#188), (2R)-N-[(2S)-1-{ [(3R,4S,5S)-3- 5
methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol) -2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-
1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide, formate salt (#190), N~2~-{[( 3R)-3-
fluoropyrrolidin-3-yl]carbonyl}-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2- 10
[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl] pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt. (#192), N~2~-{[(3S)-3-fluoropyrrolidin-3-yl]carbonyl}-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2 -[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1- 15
(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt.
(#194).
<img file="SA4069B1_D0276.tif" />
20 Step 1A: Synthesis
٤٠٦٩
-٣٣٤-
tert-butyl (2S)-2-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-
[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl] pyrrolidin-1-yl}-5-methyl-1-oxoheptan-
4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-2-methylpiperidine-1-carboxylate (#187). 5
According to standard procedure D, 86 ml (280 mg, 0.4 mg ml, 1 ml), #156 (100 mg, 0.4 mmol, 1 mol), 5 dichloromethane milliliters, 182) HATU 0.48 mm A, 1.1 A The most important thing
10 The desired raw material was purified by chromatolysis of silica gel (grading level: 0.01 to 0.05: methanol m dichloromethane) to provide 187# (220 mg, 62:) a white solid.
HPLC (Protocol V): m/z 883.57 [M+H+],
Retention = 3.23 minutes (purity = 95:).
15 Step 1B: Synthesis
tert-butyl (2R)-2-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy -2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-
thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-
4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-2-methylpiperidine-1-carboxylate (#189). 20
According to standard procedure D, 86 ml (400 mg, 0.6 mg ml, 1 ml), #157 (146 mg, 0.6 mM, 1 mL), 10 dichloromethane (mL), 259) HATU 0.72 millimeters ’millimeter A, 1.2, 1.1 ــ
٤٠٦٩
-٣٣٥-
The desired raw material was purified by chromatolysis of silica gel (grading level: 0.01 to 0.05: methanol to dichloromethane) to provide 189# (220 mg, 37:) a white solid.
HPLC (Protocol W): m/z 883.7 [M+H+],
5 Retention time = 4.12 minutes (purity = 95:).
Step 1C: Synthesis
tert-butyl(3R)-3-fluoro-3-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) -1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-
thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl }pyrrolidine-1-10 carboxylate (#191).
According to the standard formula D, 86# (300 mg, 0.45 mg ml, 1 ml),
#168 (106 mg, 0.45 mM, 1 mL), 10 dichloromethane (mL),
194) HATU MgCl, 0.54 mMgCl, 1.2 mMg) and diisopropylethylamine
15 (117 mg, 0.9 mm mol, 2 ml) The desired substance creates the raw material, which is purified by
Method 191 (159 mg, 40): A solid, white colored substance.
HPLC (Protocol X): m/z 873.4 [M+H+],
Retention = 3.32 minutes (purity = 99:).
20 Step 1D: Synthesis
tert-butyl(3S)-3-fluoro-3-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) -1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-
٤٠٦٩
-٣٣٦-
thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl }pyrrolidine-1-carboxylate (#193).
According to the standard formula D, 5#169 (300 mg, 0.45 mg, 1 mol), 5 #169 (106 mg, 0.45 mmol). c rm, 1 mL, 10 dichloromethane mL,
194) HATU (117 mg, 0.9 mM, 1.2 mL) and diisopropylethylamine (117 mg, 0.9 mM, 2 mL) create the desired substance, which It was purified by a double-phase thermometer (method P) to transform #193 (149 mg, 37): A hard, white plumed material.
HPLC (Protocol X): m/z 873.4 [M+H+], 10
Retention = 3.34 minutes (purity = 98:).
Step 2A: Synthesis
(2S)-N-[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan -4- 15 yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide, formic acid salt (#188).
According to the general formula C, 187# (20 mol, 0.023 mol C, 1 mol), 0.1 dichloromethane (0.1 mol), 0.1 mol (0.1 mol). 20 mm of hydrochloric acid (0.26 milliliters of dioxane) The desired raw material is created, ore is purified.
By inverse phase trommosynthesis (method *N) to arrive at #188 (11.6 mag, 61:);
HPLC (Protocol T): m/z 783.8[M+H+],
٤٠٦٩
-٣٣٧-
Retention = 2.53 minutes (purity = 96:).
1H NMR (400 MHz, DMSO-d6), δ 8.82-8.87 (m), 8.60-8.63 (m), 8.268.29 (m), 7.84-7.90 (m), 7.75-7.81 (m), 7.60-7.67 (m), 7.21-7.31 (m), 7.14-7.19 (m), 5.49-5.55 (m), 5.37-5.42 (m), 4.69-4.75 (m), 4.594.65 (m), 4.50-4.56 ( m), 3.95-4.01(m), 3.77-3.82(m), 3.54-3.61(m), 5
<p>3.47-3.53(m), 3.24-3.45(m), 3.14-3.23(m), 3.03-3.08(m), 2.963.03(m), 2.78-2.80(m), 2.64-2.73(m), 2.60 -2.62(m), 2.47-2.56(m), 2.31-2.45(m), 2.13-2.28(m), 2.00-2.07(m), 1.92-1.99(m), 1.711.86(m), 1.58- 1.70(m), 1.50-1.56(m), 1.38-1.49(m), 1.15-1.36</p>
(m), 1.08-1.14 (m), 1.03-1.07 (m), 0.90-1.02 (m), 0.83-0.90 (m), 10
0.73-0.80(m), 0.70-0.73(m).
Step 2B: Synthesis
(2R)-N-[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan -4- 15 yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]-2-methylpiperidine-2-carboxamide, formic acid salt. (#190).
According to the general formula C, 189# (20 mol, 0.022 mol C, 1 mol), 0.1 (0.1 dichloromethane), 0.1 mol (0.1 mol). 20 mm of hydrochloric acid (0.26 milliliters of dioxane) To create the desired raw material, the material is purified by reverse phase thermochromatography (method *N) to obtain 190# (13.2 mg),
):73
HPLC (Protocol T): m/z 783.7[M+H+],
Retention = 2.5 minutes (purity = 100:).
٤٠٦٩
-٣٣٨-
1H NMR (400 MHz, DMSO-d6), δ 8.83-8.86 (m), 8.60-8.62 (m), 8.248.27 (m), 7.83-7.89 (m), 7.78-7.80 (m), 7.75-7.77 (m), 7.64-7.66 (m), 7.60-7.63 (m), 7.20-7.31 (m), 7.13-7.19 (m), 5.49- 5.55 (m), 5.365.42 (m), 4.65-4.74 ( m), 4.60-4.65(m), 4.50-4.56(m), 3.95-4.01(m), 3.76-3.81(m), 3.53-3.62(m), 3.47-3.52(m), 3.22-3.45(m ), 3.14-5
<p>3.21(m), 2.97-3.05(m), 2.93-2.96(m), 2.79-2.86(m), 2.76-2.78(m), 2.65-2.68(m), 2.48-2.56(m), 2.37-2.43 (m), 2.29-2.35 (m), 2.172.27 (m), 2.04-2.11 (m), 1.93-2.00 (m), 1.70-1.85 (m), 1.53-1.69 (m), 1.36-1.48 ( m), 1.28-1.36(m), 1.13-1.26(m), 1.08-1.12(m), 0.98</p>
<p>1 07(m), 0.91-0.97(m), 0.84-0.91(m), 0.73-0.78(m). 10</p>
Method 2C: Synthesis
N~2~-{[(3R)-3-fluoropyrrolidin-3-yl]carbonyl}-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R, 2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1- yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt. 15 (#192).
According to the general formula C, 191# (10 mol, 0.011 mol C, 1 mol), 0.1 dichloromethane (0.1 mol), 0.1 mol (0.1 mol). Mm of hydrochloric acid (0.13 m dioxane ml) synthesis The desired raw material, the raw materials that are refined
<p dir="rtl">20 By factoring the chromatography of a reverse phase (method M*) to arrive at #192 (5.1 mol,</p>
):60
HPLC (Protocol T): m/z 773.5[M+H+ ],
Retention = 2.43 minutes (purity = 100:).
٤٠٦٩
-٣٣٩-
1H NMR (400 MHz, DMSO-d6) δ -9.44 (m), 9.17-9.21 (m), 8.91
(d), 8.63-8.69(m), 8.38-8.43(m), 8.22-8.27(m), 7.80(dd), 7.66(dd), 7.14-7.33(m), 5.49-5.57(m), 5.37 -5.45(m), 4.10-4.78(m),3.97
<p>4.06(m), 3.77-3.83(m), 3.33-3.65(m), 3.15-3.29(m), 2.95-3.09(m), 2.82-2.83(m), 2.67-2.71(m), 2.55-2.57 (m), 2.32-2.54 (m), 2.10-5</p>
<p>2.31(m), 2.09(s), 1.72-1.90(m), 1.57-1.72(m). 1.38-1.50(m), 1.15</p>
1.38(m), 1.09(dd), 0.85-1.0(m), 0.75-0.83(m).
Step 2D: Synthesis
N~2~-{[(3S)-3-fluoropyrrolidin-3-yl]carbonyl}-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R, 2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-10
phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt.
(#194).
According to the general formula C, 193# (10 mol, 0.011 mol C, 1 mol), 15 (0.1 dichloromethane ml), 0.1 (acetonitrile ml) and 4 mol C erm mf
Hydrochloric acid (0.13 m dioxane ml) The desired material is created, which is then purified by pure mildew (Method M*). .
):93
HPLC (Protocol T): m/z 773.8 [M+H+],
20 Retention = 2.42 minutes (purity = 100:).
1H NMR (400 MHz, DMSO-d6) δ 9.39-9.52(m), 9.21-9.35(m), 8.90(d), 8.63-8.69(m), 8.42-8.48(m), 8.29-8.34(m) , 7.80(dd), 7.66(dd), 7.22-7.33(m), 7.13-7.21(m), 5.47-5.57(m), 5.36-5.44(m), 4.434.93(m), 3.97-4.05( m), 3.64-3.83(m), 3.32-3.61(m), 3.15-3.29(m),
٤٠٦٩
-٣٤٠-
<p>3.06-3.09(m), 2.95-3.05(m), 2.89-2.95(m), 2.82-2.84(m), 2.672.72(m), 2.54-2.56(m), 2.48-2.53(m), 2.28 -2.48(m), 2.11-2.28(m), 2.09(s), 1.57-1.72(m), 1.38-1.47(m), 1.15-1.37(m), 1.09(dd),</p>
0.85-0.99(m), 0.78(t).
Tldhir
10
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(4- aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4 -yl]-N-methyl-L-valinamide, formate salt (#200), 1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[ (1R,2R)-3-{[(2S)-3-(4-aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-
oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, formate salt (#201).
H2N OtBu
O.O
#152
HATU, iPr2NEt, CH2Cl2,
N HN<sup>O.O</sup>
TFA
CH<sub>2</sub>Cl<sub>2</sub>
N HN<sup>O.O</sup>
<sub>FF</sub>F<sub>OFO</sub>F<sub>F</sub>FF
O OtBu
O
O OH
O
pyridine, CH<sub>2</sub>Cl<sub>2</sub>
#6 #195 #196
<sup>O</sup>
N HN
<img file="SA4069B1_D0277.tif" />
F
57 %
F
#197
#103 iPr2NEt, CH2Cl2,
<sup>O</sup>
<img file="SA4069B1_D0278.tif" />
39%
#198
<sup>FOF</sup>F<sup>F</sup>F<sup>O</sup>
pyridine, CH<sub>2</sub>Cl<sub>2</sub>
81% (three steps)
<sup>O</sup>
<img file="SA4069B1_D0279.tif" />
#199
F
F
F
<img file="SA4069B1_D0280.tif" />
15
٤٠٦٩
-٣٤١-
Step 1: Synthesis
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-tert-butoxy-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L- Valinamide (#195).
Apply to evaporation layer D, 6#6 (7.75 mg, 21.6 mg ml, 1 ml),
5 #152 (3.88 ml, 21.6 mml, 1 ml), 100) di chloromethane
(9.8 (Hatu) Approximation, 3.2 The desirable use is, which is transmitted by the Tellett, Silica (Grade level: 20 to 55 m: ethyl acetate, petroleum ether) to supply 195# (11.1 g, water yield) lubrication
<p dir="rtl">10 Plouffe insisted t.</p>
Step 2: Synthesis
1,2-dimethyl-D-prolyl-N-[(2R,3S,4S)-1-carboxy-2-methoxy-4-methylhexan-3-yl]-N-methyl-L-valinamide (#196).
According to the formula for B, 195# (11.1 mg, 21.6 mg mol, 1 ml),
15 (100 dichloromethane milliliters) and 40 (trifluoroacetic acid milliliters) create the formula.
The desired raw material, to obtain 196# (10.1 g, high yield) is used in the next step without further purification.
LC-MS (Protocol Z): m/z 428.5 [M+H+],
ZMV retention = 0.9 min.
<p dir="rtl">20 Step 3: Synthesis</p>
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-5-methyl-1-oxo-1-(pentafluorophenoxy)heptan-4-yl]-N-methyl-L -valinamide (#197).
٤٠٦٩
-٣٤٢-
to refrigerated milloles (°C) of 196# (4 g, 9.4 mmmol, 1 mol)
Dichloromethane (40 gm) Added dropwise pyridine 2.95 gm, 37.6 mg
A molecule of grams, 4 liters (following 3.9 milliliters of pentafluorophenyl trifluoroacetate)
<p dir="rtl">13.6 mM gm, 1.4 mM dichloromethane mL. Stir the mixture at</p>
<p dir="rtl">5 The temperature of the anus for the hour of birth, and the percentage is based on the line. The waste material was purified by thermolysis of silica gel (grading level: 1 to 10: methanol to dichloromethane) to provide (in three steps) a white colored solid material.</p>
Step 4: Synthesis
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-2-carboxy-1-methoxypropyl]pyrrolidin-1-yl }-3-methoxy-5-methyl-1-oxoheptan-4- 10
yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#198).
to refrigerated milloles (°C) of 197# (4 g, 7.4 mmmol, 1 mol)
Dichloromethane (25 milliliters) added dropwise (3.4 grams of diisopropylethylamine),
<p dir="rtl">2 6.3 mm mol, 3.5 ml (following mol 103#) 2.3 g, 7.6 mm mol,</p>
<p dir="rtl">15 1.02 ml (15 ml dichloromethane). After adding, the mixture is stirred at 15 °C.</p>
To remove the cost, see below. The mixed substance was transferred by chromatography with silica gel (gradient level: 1 to 10: methanol to dichloromethane) followed by further purification by chromatography Use an inverted phase (Method Q) to give 198# (1.57 g, 57.5:) solid solid. white
HPLC (Protocol X): m/z 597.49 [M+H+] 20
Retention time = 8.879 minutes (purity = 98:). Chiral HPLC: 3.328 minutes (purity = 98): Column: Chiralcel OJ-H, 4.6 x 250 mm, 5 μm; phase Rf: diethylamine: 0.05 (methanol) ml CO2: 5 to 40 mg within 15 minutes; flow rate: 2.35 ml/min.
٤٠٦٩
-٣٤٣-
Step 5: Synthesis
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3 -oxo-3-(pentafluorophenoxy)propyl]pyrrolidin-1-
yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#199).
<p dir="rtl">5 280 mg, 0.394 mg, 1 ml mtf (mm)</p>
<p dir="rtl">(2) dichloromethane ml (add 75 mg) pyridine, 0.94 mg mol, 2.4 ml (268 mg) pentafluorophenyl trifluoroacetate, 0.94 mg mol, 2.4 mol) 1.5 m dichloromethane (ml). Stir the mixture when Heat the room for two and a half hours, and the compound is concentrated in the mixture. The residue is purified by analysis.</p>
<p dir="rtl">10 Tormatogel silica (grading level: 1 to 10: methanol to dichloromethane)</p>
To save the salary #199 (279 mg, 39:) solid material with white loofah.
LC-MS (Protocol Q1): m/z 763.5 [M+H+],
ZMV retention = 0.93 min.
Step 6A: Synthesis
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)- 15
1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-(1,2,3,4-tetrahydroquinolin-6-yl)propan-2-yl]amino}-2-methyl- 3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt
(#200).
<p dir="rtl">20 To a mixture of #199 (25 mg, 0.033 mM, 1 H) and #215 (7.7</p>
(30.2 mg, 0.033 mm mol, 1 mL dichloromethane), add 30.2 mg (2.31 mm mol), 7 mL. Stir the reaction for 5 minutes Add 0.5 N (N-dimethylformamide milliliters). After stirring for a while
٤٠٦٩
-٣٤٤-
Sayyif and Nish, N-N-DiISOPROPYLAMIMINE, as well as M. 30.2, 2.31 mm Three-three E Mallalt (and decreases (and is 18). Add N,N-diisopropylethylamine Add (15.1 mg/ml, 1.15 mg/ml) GM, 3.6
<p dir="rtl">5 (100 ml) and 0.25 N,N-dimethylformamide (ml) and the reaction was stirred at room temperature for 48 hours. The reaction mixture was agitated and the crude product was purified by mild phase chromatography (method M*) giving 200 # (12.9 mg, 48:).</p>
HPLC (Protocol T): m/z HPLC (Protocol T): m/z 407.7,
double shilling [+2]; Retention = 1.69 min (purity = 100:).
1H NMR (400 MHz, DMSO-d6) δ - -8.67 (m), 10
<p>8.42-8.48(m), 8.19-8.24(m), 7.25-7.27(m), 7.12-7.14(m), 6.94</p>
<p>7.01(m), 6.88- 6.94(m), 6.78- 6.84(m), 6.67- 6.74(m), 6.57-6.64</p>
(m), 4.69-4.77 (m), 4.60-4.68 (m), 4.53-4.60 (m), 4.46-4.53 (m), 4.37-4.45 (m), 3.97-4.05 (m), 3.76-3.81 ( m), 3.62-3.67 (m), 3.53
<p>3.62(m), 3.44-3.52(m), 3.32-3.38(m), 3.27-3.32(m), 3.22-3.27(m),15</p>
<p>3.15-3.22(m), 3.06-3.14(m), 2.97-3.01(m), 2.92-2.96(m),2.74</p>
<p>2.83(m), 2.61-2.74(m), 2.57-2.61(m), 2.48-2.56(m), 2.37-2.46(m), 2.25-2.36(m), 2.00-2.20(m), 1.67-1.91 (m), 1.47-1.60 (m), 1.371.47 (m), 1.24-1.35 (m), 1.03-1.10 (m), 0.95-1.00 (m), 0.88-0.94</p>
(m), 0.76-0.83 (m).20
Step 6B: Synthesis
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(4- aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-
٤٠٦٩
-٣٤٥-
methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#201).
The one who is in the year 199) 25) (And Methyl 4-Aino-LHENYLALANANINATE Commercial) 8.8 M, 0.033 mm molecular 5 c 1.5 (Dichloromethane , adds -N,N
<p dir="rtl">(30.2 mg diisopropylethylamine, 2.31 mmol, 7 mL). Stir the reaction for 5 minutes and add (0.5 milliliters of N,N-dimethylformamide). After 4 hours, add N,N-diisopropyleth ylamine added (37.75 mg, 2.88 100 mg, 8.25 ml, and stir the mixture for 50 minutes. N,N-dimethylformamide is added additionally (0.75 10 milliliters) and the compound is stirred for 66 hours. The alternative products are purified by a mildly advanced chromatography machine (Method*M) giving #201 (14.3 mg, 56:1);</p>
HPLC (Protocol T): m/z 387.2,
double shilling [+2], retention time = 1.50 min (purity = 100:);
1H NMR (400 MHz, DMSO-d6) δ -9.84 (m), 8.57-8.66 (m), 8.468.51 (m), 8.23-8.29 (m), 7.18-7.28 (m), 7.11-7.16 (m ), 7.03-7.08 (m), 15
<p>6.97-7.02(m), 4.67-4.75(m), 4.58-4.66(m), 4.34-4.57(m), 3.954.03(m), 3.85-3.90(m), 3.73-3.81(m), 3.66 -3.72(m), 3.57-3.66(m), 3.50-3.57(m), 3.42-3.49(m), 3.32-3.38(m), 3.14-3.30(m), 2.953.11(m), 2.84- 2.94(m), 2.78-2.81(m), 2.63-2.74(m), 2.46-2.57(m), 2.34-2.45(m), 2.19-2.34(m), 1.97-2.19(m), 1.67-1.90 (m), 1.45- 20</p>
<p>1.62(m), 1.34-1.41(m), 1.21-1.34(m), 1.01-1.10(m), 0.82-0.99(m), 0.72-0.81(m).</p>
Tldhir
٤٠٦٩
-٣٤٦-
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[( 2S)-1-methoxy-1-oxo-3-(1,2,3,4-tetrahydroquinolin-6-yl)propan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl }-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, formate salt. (#207), 1,2-
dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(4- 5
aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-
methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide formate salt (#208), 1,2-dimethyl- L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy -1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3- 10
oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#209)
#150
HATU, iPr2NEt, CH2Cl2,
N HN<sup>O.O</sup>
<img file="SA4069B1_D0281.tif" />
#203
O OtBu
O
#202
H2N OtBu
O.O
89%
#6
F
#103 iPr2NEtCH2Cl2,
<img file="SA4069B1_D0282.tif" />
97%
F
#204
<sub>N</sub>O<sub>O</sub>
O<sup>F</sup><sub>F</sub><sup>F</sup>F<sup>O</sup>
N<sup>O.O</sup>
F<sup>F</sup>O<sup>FF</sup><sub>F</sub>
FF<sup>O</sup>
pyridine,CH<sub>2</sub>Cl<sub>2</sub>
82% two steps
pyridine, CH<sub>2</sub>Cl<sub>2</sub>
<img file="SA4069B1_D0283.tif" />
F
F
٤٠٦٩
-٣٤٧-
<img file="SA4069B1_D0284.tif" />
<img file="SA4069B1_D0285.tif" />
Step 1: Synthesis
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-tert-butoxy-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L- Valinamide (#202).
10
15
According to the letter D, 6# wrapper (4.3g, 12mmg, 1ml), 150# (2.15g, 12mmg, 1ml), 50 (dichloromethane milliliters), HATU (5.46). The desired raw material, 14 milliliters (14 milliliters) and diisopropylethylamine (8.17 milliliters) creates the desired raw material, which is purified By means of chromatography, silica gel (grading level: 20 to 55: ethyl acetate, petroleum ether) to #202 (5.2 g, 89): Oil of Egypt.
Step 2: Synthesis
1,2-dimethyl-L-prolyl-N-[(2R,3S,4S)-1-carboxy-2-methoxy-4-methylhexan-3-yl]-N-methyl-L-valinamide (#203).
According to Section B, 202# (5.2 g, 10.77 ml, 1 ml), 45 ml dichloromethane, and 20 ml trifluoroacetic acid. R) Creation of meaning
٤٠٦٩
-٣٤٨-
The desired raw material, to obtain #203 (7 g, high yield) is used in the next step without further purification.
Step 3: Synthesis
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-5-methyl-1-oxo-1-(pentafluorophenoxy)heptan-4-yl]-N-methyl-L -valinamide (#204). 5
10.77 mg mol, 1 mol (15 ml) dichloromethane ml (added dropwise 3.41 g) pyridine, 43.08 mg mol, 4 ml) fibrin 1 mol m pentafluorophenyl trifluoroacetate (6.03 g, 21.54 mmol, 2 ml (7 ml dichloromethane). Stir.
<p dir="rtl">10 The mixture is at room temperature for one hour, and the mixture is concentrated by the mixture. The waste material is transported by a silica compound (compact layer Insert: 1 to 10: methanol (kg dichloromethane) to supply grade #204 (8 g, 82: in two steps) a solid material in Egyptian cotton.</p>
Step 4: Synthesis:
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-2-carboxy- 15
1-methoxypropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-
yl]-N-methyl-L-valinamide (#205).
204 mg (8 ml, 10.77 mg mol, 1 ml) 25 mg dichloromethane (ml) added dropwise diisopropylethylamine
<p dir="rtl">20 (5.6 g, 43.08 mM, 4 mol) followed by #103 mmol (3.22 g, 10.77</p>
1000 mg, 1 ml dichloromethane (15 ml). Further, the mixture is stirred at room temperature for 16 hours and removed with water I. The waste material is purified by silica gelation. (Msgfgfgfgfmtf content: 1 kgfgfg 10: methanol kgfgf 205# dichloromethane (gives 2.2 g, 33:) as a solid in India.
٤٠٦٩
-٣٤٩-
HPLC (Protocol X): m/z 597.42 [M+H+],
Retention time = 8.729 min (purity < 97:), Chiral HPLC retention time: 2.87 min (purity = 89): Column: Chiralcel OD, 3-4.6 x 150 mm, 3 µm; phase: die Thylamine: 0.05 (ethanol) (ml). CO2 at 5: 40 during 12 minutes; rate 5: 2.5 ml/min.
Step 5: Synthesis
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3 -oxo-3-(pentafluorophenoxy)propyl]pyrrolidin-1-
yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide (#206).
<p dir="rtl">10 198# 0.28 mg, 0.47 mg ml kgf, 1 mtf) kgf</p>
<p dir="rtl">2 (2 ml) dichloromethane Add 75 mg (pyridine, 0.94 mmol) 268 mg pentafluorophenyl trifluoroacetate, 0.94 mg mol, 2 mol 1.5 dichloromethane milliliters). Stir the mixture at The room temperature will be at two and a half hours, and the center will be located in the following paragraphs. By phone</p>
<p dir="rtl">15 Traumatology of silica gel (grading level: 1 to 10: methanol to dichloromethane)</p>
To provide salary #206 (348 mg, 97:) solid material with white loofah.
LC-MS (protocol Q1): m/z 763.5 [M+H+],
ZMV retention = 0.9 min.
Step 6A: Synthesis
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)- 20
1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-(1,2,3,4-tetrahydroquinolin-6-yl)propan-2-yl]amino}-2-methyl- 3-oxopropyl]pyrrolidin-1-yl}-5-methyl-
٤٠٦٩
-٣٥٠-
1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt. (#207).
The order of the elements is 206# (25 mol, 0.033 mol, 1 mol) and 215# (7.7 mol, 0.033 mol). gram molecule) using the method described above for splicing
<p dir="rtl">5 #200. The pure product is purified using a reversed phase thermometer (Method M*).</p>
<p dir="rtl">#207 (11.7 mg, 44:).</p>
HPLC (Protocol T): m/z 407.6,
Double shilling [+2], retention time = 1.59 minutes (purity = 100:).
1H NMR (DMSO-d6) δ - -8.76 (m), 8.42-8.47 (m),
<p>8.23-8.29(m), 8.18-8.23(m), 7.24-7.27(m), 6.95-7.01(m), 6.89-10</p>
<p>6.94(m), 6.80-6.86(m), 6.70-6.78(m), 6.60-6.67(m), 4.69-4.77(m), 4.60-4.68(m), 4.46-4.60(m), 4.34-4.46 (m), 3.95-4.03 (m), 3.873.91 (m), 3.79-3.85 (m), 3.74-3.79 (m), 3.60-3.66 (m), 3.49-3.60</p>
(m), 3.41-3.49 (m), 3.12-3.35 (m), 3.04-3.12 (m), 2.89-3.04 (m), 2.68-2.83 (m), 2.61-2.67 (m), 2.45-2.55 ( m), 2.34-2.44 (m), 2.08-15
<p>2.33(m), 2.05-2.08(m), 1.92-2.05(m), 1.75-1.91(m), 1.65-1.75(m), 1.59-1.64(m), 1.34-1.58(m), 1.20-1.31 (m), 1.01-1.09 (m),0.94</p>
0.99(m), 0.84-0.93(m), 0.80-0.83(m), 0.72-0.80(m).
Step 6B: Synthesis
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-20
(4-aminophenyl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1- oxoheptan-
4-yl]-N-methyl-L-valinamide trifluoroacetic acid salt (#208).
٤٠٦٩
-٣٥١-
To a mixture of #206 (25 mg, 0.033 mM g, 1 mol), and commercially available 4-methyl amino-L-phenylalaninate (8.8 mg, 0.033 m m g, 1
N,N-diisopropylethylamine 1.5 milliliters (adds) dichloromethane (additional).
(30.2 mg, 2.31 mM mol, 7 M). Stir the reaction for 5 minutes and add N,N-
<p dir="rtl">5 0.5 milliliters of dimethyl formamide. After two and a half hours, add -N ,N</p>
DIISOPROPYLAMIMINE MS) 30.2, 2.31 mg 75 Melillas (and decreases for a period of 66, and it is completed by the time and the time By chromatography of a mild phase (method M*) giving #208 (13 mg, 51:1);
HPLC (Protocol T): m/z 387.2, 10
double shilling [+2], retention time = 1.58 min (purity = 100:);
1H NMR (400 MHz, DMSO-d6) δ -9.69 (m), 8.68-8.75 (m), 8.46
<p>8.50(m), 8.33-8.37(m), 8.22-8.31(m), 8.09-8.14(m), 7.17-7.27(m), 7.07-7.16(m), 6.99-7.05(m), 6.92-6.99 (m), 4.69-4.75 (m), 4.604.68 (m), 4.42-4.59 (m), 4.34-4.42 (m), 3.95-4.03 (m), 3.85-3.90 (m), 15</p>
<p>3.74-3.80(m), 3.65-3.72(m), 3.62-3.65(m), 3.42-3.62(m), 3.313.36(m), 3.24-3.30(m), 3.11-3.24(m), 3.03 -3.11(m), 2.96-3.03(m), 2.81-2.92(m), 2.65-2.76(m), 2.43-2.55(m), 2.34-2.43(m), 2.062.33(m), 1.93- 2.05(m), 1.75-1.89(m), 1.66-1.74(m), 1.58-1.65(m), 1.47-1.57(m), 1.34-1.43(m), 1.20-1.32(m), 1.10-1.14 (m), 1.00-20</p>
1.09(m), 0.83-0.99(m), 0.72-0.81(m).
Step 6C: Synthesis
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[( 2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-
٤٠٦٩
-٣٥٢-
methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide, trifluoroacetic acid salt (#209).
The compound contains 206# (25 mg, 0.033 mg, 1 mol) and 7.1) methyl-L-phenylalaninate hydrochloride, 0.033 mg gram molecule, 5 100) using the method described above to illuminate 200 # The raw product is purified by analysis
Temporarily phased chromatography (Method *M) giving #209 (10.3 mg, 41:).
HPLC (Protocol T): m/z 758.7 [M+H+],
Retention = 1.787 min (purity = 100:).
1H NMR (DMSO-d6) δ -9.70 (m), 8.70-8.75 (m), 8.50-8.56 (m),
<p>8.32-8.42(m), 8.24-8.26(m), 8.10-8.15(m), 7.14-7.27(m), 7.12-10</p>
<p>7.13(m), 6.98-7.00(m), 4.69-4.77(m), 4.55-4.67(m), 4.43-4.53(m), 3.94-4.02(m), 3.73-3.78(m), 3.62-3.68 (m), 3.48-3.60 (m),3.39</p>
<p>3.48(m), 3.23-3.33(m), 3.13-3.22(m), 3.08-3.13(m), 3.02-3.08(m), 2.96-3.01(m), 2.81-2.94(m), 2.76-2.80 (m), 2.66-2.75 (m),2.62</p>
<p>2.66(m), 2.46-2.55(m), 2.31-2.45(m), 2.09-2.29(m), 2.05-2.09(m),15</p>
<p>1.93-2.04(m), 1.74-1.88(m), 1.65-1.74(m), 1.59-1.65(m),1.36</p>
<p>1.52(m), 1.21-1.35(m), 1.01-1.08(m), 0.94-1.00(m), 0.83-0.94(m), 0.73-0.81(m).</p>
Tldhir
methyl (2S)-2-amino-3-(1,2,3,4-tetrahydroquinolin-6-yl)propanoate 20
٤٠٦٩
-٣٥٣-
N<sup>O</sup>
N
<sup>N</sup>B<sup>N</sup>P<sup>B</sup>O<sup>S</sup><sub>Br</sub><sup>N</sup>n-BuLi,THF<sup>N</sup>N a<sup>T</sup>c<sup>F</sup>e<sup>A</sup>t<sup>/</sup>o<sup>H</sup>n<sup>2</sup>it<sup>O</sup>ril<sup>/</sup>e<sub>HN COOMe</sub><sup>BE</sup>C<sup>to</sup>H<sup>3cN</sup>2<sup>2</sup>C<sup>,O</sup>l2
32% (2 steps) NO<sup>2</sup>74% (2 steps)
#210
#211 #212
<img file="SA4069B1_D0286.tif" />
H2, Pd-C EtOH
N COOMe H
80%
<img file="SA4069B1_D0287.tif" />
<img file="SA4069B1_D0288.tif" />
TFA
CH2Cl2
<img file="SA4069B1_D0289.tif" />
N
COOMe
#213
N COOMe H
85%
#214 #215
Step 1: Synthesis of (210#)6-(bromomethyl)quinoline
Stir in 1 mol of 6-methylquinoline (5 ml, 35 ml of mol, 1 mol),
<p dir="rtl">8.1(N-Bromosuccinimide gm, 45.5 mM gm, 1.3 mol) and benzoyl</p>
<p dir="rtl">5 840 mg peroxide, 3.5 mm mol, 0.1 ml carbon tetrachloride</p>
(100 milliliters) The vapor is re-condensed for 3 hours and then cooled to room temperature. The reaction mixture is filtered and the filtered material is filtered. The material is removed The filtrate is 100 milliliters (tetrahydrofuran) and filtered. The filtered material is used directly in the step The following requires additional purification.
Step 2: Synthesis
6-{[(2S,5R)-3,6-dimethoxy-5-(propan-2-yl)-2,5-dihydropyrazin-2- 10 yl]methyl}quinoline (#211).
To Melloor) -70 ° Celsi (M.-(2R) -3-6-DIMTHOXY-2- (ProPan-2-ly) 25.8 (2,5-Dihydropyrazine C C. Add 200 milliliters of tetrahydrofuran (2.5 n-butyllithium) dropwise,
15 64.4 ml, 161 mM mol, 2.3 ml) then stir for 30 minutes. Add dropwise
Millions of a p ػ ػ On the authority of ػ It decreases with the time of the bachelors of the status of the one. The additives are removed with ammonium chloride (100 ml) and extracted with 100 ethyl acetate.
20 (ml) The organic phase must be coated with sodium sulfate and concentrated with the solution. The waste material is purified
٤٠٦٩
-٣٥٤-
By means of a silica column chromatography (gradient level: 10 to 16 m: ethyl acetate, petroleum ether) to provide #211 (7.3 g, 32:32 in two steps) an asterisk solid.
LC-MS (Protocol Z): m/z 326.2[M+H+],
ZMV retention = 0.88 min.
<p dir="rtl">5 Step 3: Synthesis of (212#)methyl (2S)-2-amino-3-(quinolin-6-yl)propanoate</p>
To 211 mmol (7.3 g, 22.5 mm g, 1 ml) (25 ml) and acetonitrile (80 ml) added Add 9 milliliters (trifluoroacetic acid) to 100°C and stir at 10°C overnight. The organic layer was removed by elution and the aqueous layer was made basic to pH 9 M sodium carbonate, which was used directly in the next step.
Step 4: Synthesis
methyl(2S)-2-[(tert-butoxycarbonyl)amino]-3-(quinolin-6-yl)propanoate
(#213).
To 212 mol (5.2 g, 22.5 mmol, 1 mol) and 15 triethylamine (9.1 g, 90 mol, 4 mol) methanol, mixed with 30 ml methanol)
Add 17.5 milliliters of water (50 milliliters of di-tert-butyl dicarbonate (78.75 milliliters of di-tert-butyl dicarbonate) at 10°C, then stir the mixture at 10°C overnight. The mixture was filtered and washed Candidate M 20 (methanol milliliters x 2). The filtrate is extracted with (50 milliliters x 2) ethyl acetate and the organic phase is filtered. The waste material is purified by 20% silica column (gradient level: 25 to 50: ethyl acetate, petroleum ether) to provide 21 #3 (5.5g, 74g: in two steps) Lubricate with Egypt.
LC-MS (Protocol Z): m/z 331.2[M+H+],
٤٠٦٩
-٣٥٥-
ZMV retention = 0.76 min.
Step 5: Synthesis
methyl (2S)-2-[(tert-butoxycarbonyl)amino]-3-(1,2,3,4-
tetrahydroquinolin-6-yl)propanoate (#214)
<p dir="rtl">5 Stir a suspension of #213 (1.5 g, 4.55 mM g, 1 mol) and palladium.</p>
At 50°C (150 mg) of carbon (20 milliliters) of ethanol, followed by 30 pounds per square inch of hydrogen pressure overnight. The mixture is filtered through a mixture of celite and the filtered material is filtered with a filter. The waste material is purified by chromatography. Silica column (graded level: 40: ethyl acetate M petroleum ether) to provide 214# (1.2 C, 80:) lubrication.
1H NMR (400 MHz, CDCl3): δ 6.70 (d, 2H), 6.40 (m, 1H), 4.95 (m, 1H), 10
<p>4.49 (m, 1H), 3.77 (s, 3H), 3.28 (m, 2H), 2.97 (m, 2H), 2.71 (m, 2H),</p>
1.95 (m, 2H), 1.26 (s, 9H), HPLC (Protocol Y): m/z 357.0 [M+Na+]
Retention time = 5.304 minutes (purity < 98:). Chiral HPLC: Retention time 4.64 minutes (purity = 98): (Column: Chiralcel OJ-H, 4.6 x 150 mm, 5 µm; Metaphase:
<p dir="rtl">15 Diethylamine: 0.05 (ethanol) in 5 mg: 40 mg during 15 minutes; flow rate: 2.5 ml/min.</p>
Step 6: Synthesis
methyl (2S)-2-amino-3-(1,2,3,4-tetrahydroquinolin-6-yl)propanoate (#215).
<p dir="rtl">20 214 #214 (750 mg, 2.25 mg kgf, 1 mtf) kgf</p>
<p dir="rtl">20 (dichloromethane millilitres) added dropwise 2 (trifluoracetic acid) millilitres</p>
Set °C and then stir the mixture at 20°C overnight. It is permissible for the sake of the one that is approved by the one, and the abandonment of the one (MD).
٤٠٦٩
-٣٥٦-
Extract 30 milliliters (30 ethyl acetate/tetrahydrofuran). The organic phase should be combined with sodium sulphate and then aqueous to provide 215# (450 mg, 85:000) as a base oil.
1H NMR (400 MHz, CDCl3): δ 6.70 (d, 2H), 6.40 (m, 1H), 3.73 (s, 3H), 3.67 (m, 1H), 3.30 (m, 2H), 2.96 (m, 1H ), 2.75 (m, 3H), 1.96 (m, 2H),
<p>1.50 (br, 2H), 1.26 (br, 1H)., HPLC (Protocol Y): m/z 235.14 [M+H+] 5</p>
Retention time = 4.35 minutes (purity < 96:). Chiral HPLC: Retention time 5.71 minutes (purity = 98:). (Column: Chiralcel OJ-H, 4.6 x 150 mm, 5 µm; Dissimilar phase: diethylamine (0.05 ethanol) in 5 mg of carbon dioxide: 40 mg during 15 minutes; flow rate: 2.5 ml/min.
10 Tldhir
N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-fluoropyrrolidin-3-yl]carbonyl}- L-valyl)(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalanine, trifluoroacetic acid salt (#217), N-{(2R,3R)-3-[(2S)-1-
{(3R,4S,5S)-4-[(N-{[(3S)-3-fluoropyrrolidin-3-yl]carbonyl}-L- 15 valyl)(methyl)amino]-3-methoxy-5-methylheptanoyl }pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalanine, trifluoroacetic acid salt
(#219).
H2
#168, HATU, iPrNEt2, CHCl, DMF
<img file="SA4069B1_D0290.tif" />
86% (three steps)
O
91% (three steps)
#218
1) LiOH water/THF
2) TFA, CH2Cl2
#169, HATU, iPrNEt2, CH2Cl2, DMF
1) LiOH water/THF
2) TFA, CH2Cl2
20 Step 1A: Synthesis
٤٠٦٩
-٣٥٧-
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-1-(tert-)
butoxycarbonyl)-3-fluoropyrrolidin-3-yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-
methylpropanoyl}-L-phenylalaninate (#216).
<p dir="rtl">5 to #168 mmol (36.9 mg, 0.158 mmol, 1 mol) and #114</p>
(100 mg, 0.158 mg mol, 1 ml) dichloromethane (3.6 ml) and 0.8 (N,N-dimethylformamide ml), add 0.083 (ml) diisopropylethylamine ml, 0.474 ml G molecule, 3 halves) follows 60.7 (HATU mg, 0.158 mmol, 1 ml). Leave the solution to stir at room temperature for 18 hours, then add 10 ml (25 ml ethyl acetate), washed with water (again: citric acid (birth-time) and malolyl
Mgm (stratum and gland). The muscle layer is dried with sodium sulfate, filtered, and the substance released with the conditioner is concentrated to give 216 # raw (220 mg, 16 4: Theoretically) No, the next step is used without additional purification.
HPLC (protocol Q): m/z 848.6 [M+H+],
15 ZMV retention = 2.10 minutes.
Step 1B: Synthesis
methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3S)-1-(tert-butoxycarbonyl)-3- fluoropyrrolidin-3-yl]carbonyl}-L-valyl)(methyl)amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-
methylpropanoyl}-L-phenylalaninate (#218). 20
To 169 #169 (36.9 mg, 0.158 mg mol, 1 mol) and #114 (100 mg, 0.158 mg mol, 1 mol). (3.6 ml) dichloromethane (ml) and 0.8 (N,N-dimethylformamide) (Add 0.083 mg diisopropylethylamine, 0.474 mg mol, 3 mol) followed by 60.7 mg (60.7 mg HATU, 0.158 mol).
٤٠٦٩
-٣٥٨-
(Gramm, 1 H). The reaction is left to stir at room temperature for 18 hours, then the ethyl
25 milliliters of acetate, washed with water (once), 10 citric acid (once) and 1 milliliter (once). The muscle layer is dried Sodium sulfate is dissolved, filtered, and the substance sprayed with the filtrate is concentrated to transform #218. 180 mg, 134 (theoretically) are used in the following step:
<p dir="rtl">5 With additional purification.</p>
HPLC (protocol Q): m/z 848.6 [M+H+],
ZMV retention = 2.10 minutes.
Step 2A: Synthesis
N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3R)-3-fluoropyrrolidin-3-yl]carbonyl}- L-valyl)(methyl)amino]-3-methoxy-5- 10
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalanine, trifluoroacetic acid salt (#217).
To 216 milliliters of tetrahydrofuran (134 mg) (4 milliliters of tetrahydrofuran) is added
<p dir="rtl">1) Lithium hydroxide, 0.5 ml. Stir the mixture at room temperature.</p>
<p dir="rtl">15 It lasts for 18 hours and is based on Shafaq. The mixture is mixed with 2 milliliters of dichloromethane and 2 milliliters of trifluoroacetic acid. The mixture is stirred for 4 hours and shaken with a filter. The residual substance is purified by means of a filter How to reach a crooked line (Method *M) for accessing #217) 60 mg, 86: in two steps) fast.</p>
LC-MS (protocol Q): m/z 734.93 [M+H+],
20 ZMV retention = 1.19 minutes.
1H NMR (DMSO-d6) δ -12.83 (m), 9.30-9.43 (m), 9.17-9.28
(m), 8.34-8.41(m), 8.22-8.31(m), 8.08-8.15(m), 7.87-7.93(m),
<p>7.76-7.81(m), 7.11-7.23(m), 4.93-4.99(m), 4.81-4.88(m), 4.55-</p>
٤٠٦٩
-٣٥٩-
<p>4.71(m), 4.48-4.54(m), 4.37-4.45(m), 3.92-3.99(m), 3.69-3.75(m), 3.31-3.65(m), 3.25-3.30(m), 3.20-3.24 (m), 3.12-3.19 (m), 3.08</p>
<p>3.10(m), 2.97-3.07(m), 2.92-2.97(m), 2.75-2.84(m), 2.64-2.70(m), 2.43-2.57(m), 2.28-2.43(m), 2.15-2.26 5</p>
0.71-0.79(m).
Step 2B: Synthesis
N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[(N-{[(3S)-3-fluoropyrrolidin-3-yl]carbonyl}- L-valyl)(methyl)amino]-3-methoxy-5-
methylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L- 10 phenylalanine, trifluoroacetic acid salt (#219).
Add 1 mol of lithium hydroxide (0.5 ml) of crude oil (100 mg) (4 ml) of tetrahydrofuran (4 ml). The reaction is stirred at room temperature for 18 hours and then shaken off. The raw material is dichloromethane (2 milliliters) and 15 trifluoroacetic acid (2 milliliters) is added. The reaction is stirred for 4 hours and then agitated using a filter. The material is purified
The conclusion is made using a reversible phase thermometer (method M*) to reach 219% of the compound (60 mg, 91: in two steps).
LC-MS (protocol Q): m/z 734.97 [M+H+],
ZMV retention = 1.14 minutes.
1H NMR (400 MHz, DMSO-d6), δ 12.62-12.85 (m), 9.32-9.43 (m), 20
<p>9.13-9.26(m), 8.39-8.46(m), 8.30-8.39(m), 8.25-8.29(m), 8.088.13(m), 7.79-7.85(m), 7.67-7.72(m), 7.10 -7.23(m), 4.94-5.01(m), 4.83-4.89(m), 4.64-4.73(m), 4.56-4.63(m), 4.44-4.50(m), 4.37</p>
<p>4.44(m), 3.92-3.99(m), 3.60-3.74(m), 3.24-3.55(m), 3.11-3.24(m),</p>
٤٠٦٩
-٣٦٠-
<p>3.07-3.10(m), 3.02-3.06(m), 2.98-3.02(m), 2.93-2.97(m), 2.752.85(m), 2.68-2.69(m), 2.63-2.67(m), 2.45 -2.55(m), 2.26 -2.44(m), 2.15-2.25(m), 2.03-2.14(m), 1.55-1.87(m), 1.31-1.47(m),</p>
1.15-1.31(m), 0.98-1.05(m), 0.91-0.98(m), 0.82-0.91(m), 0.71
0.78 (m). 5
Tldhir
2-methylalanyl-N-{(3R,4S,5S)-1-[(2S)-2-{(3R,4R,7S)-7-benzyl-4-methyl-18-[(4S,5R)- 5-methyl-2-oxoimidazolidin-4-yl]-5,8,13-trioxo-2-oxa-6,9,12-triazaoctadecan-3-yl}pyrrolidin-1-yl]-3-methoxy-5- methyl-
1-oxoheptan-4-yl}-N-methyl-L-valinamide (#257). 10
H<sub>2</sub>N<sup>N</sup>Boc
<sup>H</sup>HATU, Hunig's base, DMF
Fmoc<sup>N</sup>OH
<img file="SA4069B1_D0291.tif" />
<img file="SA4069B1_D0292.tif" />
#253
Piperdine, DMF
<p>1. 4M HCl in dioxane</p>
<p>2. HATU, Hunig's base, DMF</p>
HO<sup>H</sup>N<sub>O</sub>
O
35%
<img file="SA4069B1_D0293.tif" />
N
<sup>O</sup>
NH
<img file="SA4069B1_D0294.tif" />
27%
#256, piperdine, DMF
50%
00703673-0529
#253, #105, HATU, Hunig's base. DMF
<img file="SA4069B1_D0295.tif" />
<img file="SA4069B1_D0296.tif" />
84%
<img file="SA4069B1_D0297.tif" />
#256
<img file="SA4069B1_D0298.tif" />
<img file="SA4069B1_D0299.tif" />
N
O
NH
<img file="SA4069B1_D0300.tif" />
<img file="SA4069B1_D0301.tif" />
#257
O.O
<img file="SA4069B1_D0302.tif" />
<img file="SA4069B1_D0303.tif" />
H
N
O
NH
Step 1: Synthesis
٤٠٦٩
-٣٦١-
9H-fluoren-9-ylmethyl [(2S)-1-({2-[(tert.)
butoxycarbonyl)amino]ethyl}amino)-1-oxo-3-phenylpropan-2-yl]carbamate (#253).
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L- using D following the general procedure
5 (500 mg) phenyl alanine, 1.29 mg mol, 1 mol(, -2) tert-butyl
207 (aminoethyl)carbamate mg, 1.29 mg mol, 1 mol, HATU (620 mg, 1.55 mg mol, 1.2 mol) and base 0.45 Hunig (2 milliliters, 2.58 mM, 2 H) m 6 milliliters of DMF produces #253 white powder solids (620 mg, 91:00) following the concentration of the mixture and recrystallization using ethyl acetate.
LC-MS (Protocol Q1): m/z 552.3 [M+Na+], 10
ZMV retention = 1.01 min.
Step 2: Synthesis
N-alpha-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-[2-({6-[(4S,5R)-5-methyl-2-oxoimidazolidin-4-yl]hexanoyl}amino)ethyl ]-L-phenylalaninamide (#254). 15
The BOCE is a bacterium, a time A, 8 millimeters, c The tracing is done by following the answer to the general statement D using a mixed article. Your back, your back, your back. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than
20 35.6(6-[(4S,5R)-5-methyl-2-oxoimidazolidin-4-yl]hexanoic acid mg,
0.166 mM mol, 1 mol, 73.2 mg HATU, 0.18 mol mol, 1.1 mol, and 0.087 Hunig base, 0.50 mol mol, 3 mol 2 ml DMF following purification) Method J) Production of #254 (35 mg, 34): white puff pastry solid.
٤٠٦٩
-٣٦٢-
LC-MS (Protocol Q1): m/z 626.3 [M+H+],
ZMV retention = 0.86 min.
Step 3: Synthesis
N-[2-({6-[(4S,5R)-5-methyl-2-oxoimidazolidin-4-yl]hexanoyl}amino)ethyl]-L-phenylalaninamide (#255). 5
I seek the sake of the lap, 35), 0.056 millimeters, c A, 20, (المرال الري المري الري الري الري الري الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم الم ان (Class R-30: methanol or dichloromethane) Etc. #253 (19 mg, 84:).
LC-MS (Protocol Q1): m/z 404.2 [M+H+], 10
ZMV retention = 0.48 min.
Step 4: Synthesis
N-[(9H-fluoren-9-ylmethoxy)carbonyl]-2-methylalanyl-N-{(3R,4S,5S)-1-[(2S)-2-{(3R,4R,7S)-7- benzyl-4-methyl-18-[(4S,5R)-5-methyl-2-oxoimidazolidin-4-yl]-5,8,13-trioxo-2-oxa-6,9,12-triazaoctadecan-3- 15 yl}pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl}-N-methyl-
L-valinamide (#256).
Follow the process of treatment D using #105 (36.6 MgCl, 0.047 mM C, 1 Mg), #255 (19 MgCl, 0 0.047 mg ml, 1 ml, 22.4 HATU ml, 20 0.056 mg ml Hunig, 1.2 milliliters (base 0.025 milliliters, 0.141 milliliters)
1.5 ml DMF purification (Method J) yields #256 (15 mg, 27:) a white solid.
٤٠٦٩
-٣٦٣-
LC-MS (Protocol Q1): m/z 1164.8 [M+H+],
ZMF retention = 0.99 min.
Step 5: Synthesis
2-methylalanyl-N-{(3R,4S,5S)-1-[(2S)-2-{(3R,4R,7S)-7-benzyl-4-methyl-18-[(4S,5R)- 5-methyl-2-oxoimidazolidin-4-yl]-5,8,13-trioxo-2- 5 oxa-6,9,12-triazaoctadecan-3-yl}pyrrolidin-1-yl]-3-methoxy-5 -methyl-
1-oxoheptan-4-yl}-N-methyl-L-valinamide (#257).
Preparation of treatment A using #256 (5 mg/kg, 0.004 mg/gm) (Method J) and 0.02 mg piperidine, 0.02 mM, 1 ml (50 ml) followed by purification (Method J) 257# (2 mg, 50): Non-loaf glass.
LC-MS (Protocol Q1): m/z 1164.8 [M+H+],
ZMF retention = 0.99 min.
1H NMR (400 MHz, DMSO-d6), δ 8.44-8.52 (m), 8.06-8.20 (m), 7.968.01 (m), 7.69-7.83 (m), 7.20-7.28 (m), 7.11-7.19 (m), 3.38-3.83 (m), 3.19-3.26 (m), 3.03-3.12 (m), 2.98 (s), 2.91 (s), 2.75 (s), 2.65-2.70 15
(m), 2.01-2.36 (m), 1.65-1.87 (m), 1.39-1.57 (m), 1.13-1.37 (m),
1.04-1.08(m), 0.74-1.01(m).
Tldhir
N-[5-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)pentanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S) -2-[(1R,2R)-3-{[(1S)-1-carboxy-2- 20
phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-
٤٠٦٩
-٣٦٤-
methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (mv#115).
<sub>O.O</sub>H<sub>D</sub>A<sub>M</sub>T<sub>F</sub>U<sub>,</sub> ,<sub>C</sub>H<sub>H</sub>u<sub>2</sub>n<sub>C</sub>ig<sub>l2</sub>'s base<sup>O</sup><sub>NN</sub>H<sub>NNN</sub>
<p><sup>NOH</sup>3.3% O<sup>OO O</sup></p>
<sup>O</sup>mv#115<sup>O NH</sup>O
OH
Step 1: Lighting
N-[5-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)pentanoyl]-N,2-5
dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy- 2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (mv#115).
<p dir="rtl">10 Malik Malik Malik Malik Malik Malik GFGF-1-5-(2,5-dioxo-2,5-dihydro-1H-pyrrol)</p>
12 (YL) Pentanoic Acid, 0.061 mm , DMF, 0.061 mm Leave the mixture to stir for 5 minutes before adding #115 (39 MgM, 0.047 mg MgM) salt. 0.4 ml, 15 ml dichloromethane, and 0.1 ml DMF. The reaction was left to stir at room temperature for three hours and 15 minutes before quenching by adding water to a small dose of TFA. It enters after that, the interaction. The raw material was mixed with DMSO and purified by reversed phase thermochromatography (Method J). The concentration was then appropriate (Genevac). In addition, next to you, by analyzing the inverse phase thermometer (method K) in the future Focused on suitability (Genevac).
<p dir="rtl">20 The material is then transferred to a small vial using dichloromethane and methanol before mixing (Genevac). HPLC (Protocol A at 45 °C):</p>
٤٠٦٩
-٣٦٥-
m/z 897.5 [M+H+],
Zmf retention = 9.149 min (purity < 97:).
Tldhir
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S) -2-[(1R,2R)-3-{[(1S)-1-carboxy-2- 5
phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-
methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide
(mc#115)
#113
96%
#250
Oxalyl chloride
OCH2Cl2
<sup>N</sup>OH<sub>100%</sub>
<img file="SA4069B1_D0304.tif" />
<img file="SA4069B1_D0305.tif" />
16%
triethylamine CH<sub>2</sub>Cl<sub>2</sub>
<img file="SA4069B1_D0306.tif" />
O
11%
#249
HATU, Hunig's base DMF, CH2Cl2
lithium hydroxide
THF, water H2
<img file="SA4069B1_D0307.tif" />
#250
OH
O
mc#115
OH
10 Step 1: Synthesis of 6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl chloride
(#248)
Malik Malik Malik Malik Malik Malik GFGF-1-6-(2,5-dioxo-2,5-dihydro-1H-pyrrol)
<p dir="rtl">3.15(yl)hexanoic acid, 14.9 mm 15 ml dichloromethane, add 1.61 ml (1.61 ml oxalyl chloride, 17.9 mm mol)</p>
15 A point and a node are followed by a DMF file. The drug is taken at one degree per room for three hours. The meaning of knowledge is based on knowledge. Multi-language text, multi-language text, multi-language text, multi-language text, multi-language text, multi-language text Heptane
٤٠٦٩
-٣٦٦-
And dichloromethane is then tritized. This process is repeated twice more to produce 248# solid (3.43g, 100:).
1H NMR (400 MHz, DMSO-d6): δ [7.02 (s, 2H), 3.43 (m, 2H), 2.53 (m, 1H), CH2.18 (m, 1H), 1.54 (m, 4H), 1.26 (m, 2H).]
<p dir="rtl">5 Step 2: Synthesis</p>
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-dimethylalanine (#249).
To 10 milliliters of dichloromethane, add 306 (N,2-dimethylalanine) mol ml, 2.61 mmol
<p dir="rtl">10 (1.09 milliliters of triethylamine, 7.84 millimeters of triethylamine). Leave the solution to stir.</p>
At 100°C, leave the room for three hours. Dichloromethane is added to the reactant and the organic layer is washed with three parts of water and two parts of ml of water. The organic layer is removed and then removed with sodium sulfate before the composition is removed. The mixed material is transferred using a silica chromatography machine (PR-30: methanol or dichloromethane) onto silica, which is
15 Pre-neutralized with triethylamine to produce #249 solid white puff (127 mg, 16:).
LC-MS (Protocol Q): m/z 309.0 [M-H],
ZMV retention = 0.96 min.
Step 3: Synthesis
N-{(2R,3R)-3-methoxy-3-[(2S)-1-{(3R,4S,5S)-3-methoxy-5-methyl-
4-[methyl(L-valyl)amino]heptanoyl}pyrrolidin-2-yl]-2-methylpropanoyl}- 20
L-phenylalanine (#250).
٤٠٦٩
-٣٦٧-
To 113# inverted milliliters (2.10 g, 2.46 mm g) m 10 ml THF, add 228 mol lithium hydroxide, 5.16 mm molecule) in 3 ml of water. Leave the solution to stir at room temperature for Two hours. The solution is added by adding 1 molecule of HCl, which is concentrated in the form of the solid composition of the egg. The resulting fiber content is 20 ml of acetonitrile and 5 ml of water. Then remove the aqueous layer and wash the organic layer with soap and water. The organic layer is dried with sodium sulfate, filtered, and concentrated by elution. Next, 20 ethyl acetate (20 milliliters) is added and the raw solid is stirred for 30 minutes, before filtration to produce #250 white solid (1.42 g, 94:).
LC-MS (Protocol Q): m/z 619.5 [M+H+],
10 ZMV retention = 1.10 min. Protocol A (HPLC at 45°C)
m/z 619.4 [M+H+],
ZMV retention = 6.732 minutes.
Step 4: Synthesis
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S) -2-[(1R,2R)-3-{[(1S)-1-carboxy-2- 15
phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L -valinamide
(mc#115).
To the millions of the millions of J. ػ ػ Stir for 1 hour at room temperature after adding #250 (762 mg, 1.23 mg mol). The reaction is left to stir for 3 hours. The reaction is agitated. Purification is followed by a modified stage (Method L).
٤٠٦٩
-٣٦٨-
Freezing produces 120#mc white colored steel (124 mg, 11:1). Protocol A (HPLC at 45°C);
m/z 911.5 [M+H+],
ZMV retention = 9.676 minutes.
Tldhir
10
15
20
N-[4-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)butanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S) -2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2- methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (mb#115).
<img file="SA4069B1_D0308.tif" />
O
mb#115
OH
#115
HATU, Hunig's base DMF, CH2Cl2
<img file="SA4069B1_D0309.tif" />
Step 1: Synthesis
N-[4-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)butanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S) -2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2- methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (mb#115).
ttttttttttttttttttttttttttttttttttttttttttttttttttt my Ii GF-1-4-(2,5-dioxo-2,5-dihydro-1H-pyrrol
<p dir="rtl">Add 1.2 (yl)butanoic acid (1.2), HATU (1.2) and Hunig's base (3) to stir for 30 minutes. Add GFAF, number 115 (1)</p>
٤٠٦٩
-٣٦٩-
A mixture of dichloromethane and DMF. The compound was monitored by LC-MS. The compound was concentrated and purification was carried out by thermophoresis developed with Medium pressure Isco (gradient level: 5: -100: water with acetonitrile).
Tldhir
N-[7-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)heptanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S) -2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2- methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (me#115).
<img file="SA4069B1_D0310.tif" />
#115
HATU, Hunig's base DMF, CH2Cl2
O.O
<img file="SA4069B1_D0311.tif" />
O
me#115
OH
10
Step 1: Synthesis
15
20
N-[7-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)heptanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S) -2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2- methoxy-1-[(1S)-o-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (me#115).
ttttttttttttttttttttttttttttttttttttttttttttttttttt my Ii GF-1-7-(2,5-dioxo-2,5-dihydro-1H-pyrrol)
<p dir="rtl">Add 1.2 yl(heptanoic acid), 1.2 HATU, and Hunig's base (3 liters) of DMF and dichloromethane. Stir for 30 minutes and added Next, #115 (1 triple) contains dichloromethane and DMF. The analysis is based on LC-MS</p>
٤٠٦٩
-٣٧٠-
Processing: Purification is completed by means of a thermometer with a medium pressure inverted phase Isco (gradient level: 5: -100: water with acetonitrile).
Tldhir
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-(4-{(8S,11S) ,12R)-12-(2-{(2S)-2-[(1R,2R)-3-{[(1S)-1- 5
carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-8-isopropyl-4,5,5,10-tetramethyl-11-[ (1S)-1-methylpropyl]-3,6,9-trioxo-2,13-dioxa-4,7,10-triazatetradec-1-yl}phenyl)-L-ornithinamide (mcValCitPABC#115).
mcValCitPABC-PNP
Hunig's base
2,6-Lutidine
HOAt, DMA
#115
<img file="SA4069B1_D0312.tif" />
O
<img file="SA4069B1_D0313.tif" />
ONH2
<img file="SA4069B1_D0314.tif" />
mcValCitPABC#115
<img file="SA4069B1_D0315.tif" />
<img file="SA4069B1_D0316.tif" />
O
OH
10
Step 1: Synthesis
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-(4-{(8S,11S) ,12R)-12-(2-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl- 3-oxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-8-isopropyl-4,5,5,10-tetramethyl- 15 11-[(1S)-1-methylpropyl]-3,6,9-trioxo -2,13-dioxa-4,7,10-triazatetradec-1-yl}phenyl)-L-ornithinamide (mcValCitPABC#115).
Uses 1 ml of mcCValCitPABC (1 mL), #D (mcCValCitPABC 100) and #115 (1 mL) DMF. Adds 4 (Hunig mL), 2,6-Luditine mL (4 mL), and 0.2 HOAT
<p dir="rtl">20 The components are synthesized and the purification is completed. Thank you very much.</p>
٤٠٦٩
-٣٧١-
Thrombophagatog ram urinary tract hypotension Isco (gradient level: 5 -1 00: MG MG MG MG
)acetonitrile
Tldhir
N-(21-amino-4,7,10,13,16,19-hexaoxahenicosan-1-oyl)-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2- [(1R,2R)-3-{[(1S)-1-carboxy-2- 5
phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L -valinamide (AmPeg6C2#115).
<sup>H</sup>2<sup>N</sup>
<img file="SA4069B1_D0317.tif" />
O
AmPeg6C2#115
OH
<p>1. #115</p>
HATU, Hunig's base
DMF, CH<sub>2</sub>Cl<sub>2</sub>
<p>2. piperdine</p>
Fmoc<sup>N</sup>O OH
10 Step 1: Synthesis
N-(21-amino-4,7,10,13,16,19-hexaoxahenicosan-1-oyl)-N,2-dimethylalanyl-N-{(1S,2R)-4-{(2S)-2- [(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-methoxy-1 -[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide (AmPeg6C2#115). 15
2,7,10,13,16,19,22-1-(9H-fluoren-9-yl)-3-oxo
Add 115% DMF. Oh, my God, I am watching you. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than CKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK Yours sincerely. GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK Cover
<p dir="rtl">20 LC-MS. When the compound is almost completely closed, add 5 (5) piperidine derivatives.</p>
٤٠٦٩
-٣٧٢-
Fmoc determination by LC-MS. The reaction is agitated and purification is completed by chromatography with a medium pressure Isco (gradient level: 5: -100: water with acetonitrile).
Tldhir
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(2S)-3-[4- ({N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-
yl)hexanoyl]glycyl}amino)phenyl]-1-methoxy-1-oxopropan-2-yl}amino)-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5 -methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide mcGly#201.
<img file="SA4069B1_D0318.tif" />
10
15
Step 1: Synthesis
methyl N-(tert-butoxycarbonyl)-4-({N-[6-(2,5-dioxo-2,5-dihydro-1H)
pyrrol-1-yl)hexanoyl]glycyl}amino)-L-phenylalaninate (#251):
1000 mg ml -methyl 4-amino-N-(tert-butoxycarbonyl)-L
<p dir="rtl">4.1) phenylalaninate, 15.3 mg gf, 1 mtf (ghf) -N,N</p>
N,N'-Dicyclohexylcarbodiimide (70 ml) Add dimethylformamide
<p dir="rtl">(2.9 g, 15.3 mM mol, 1 H) at 1°C. Stir the mixture at 30°C for 30 minutes. Add 1 mM mol-1-2-(6-(2,5-dioxo-2). 5-dihydro-1H-pyrrol 3(yl)hexanamido)acetic acid, 10.2 mM, 0.66 mM -N,N dimethylformamide (20 ml) at °C. Stir the mixture. Tomorrow is a degree for a thousand Arra</p>
٤٠٦٩
-٣٧٣-
Bangs for 3 days. Filter the mixture. The filtered material is poured with ice water (200 ml) and extracted with 200 ml EtOAc x 3. The extracted material is washed with 200 ml (200 ml), dried with Na2SO4 It is concentrated by the chemical formula to form #251 (1.8 g, 32.2: productivity) A solid material made in Egypt.
HPLC (Protocol Q2) [M+Na+] 567.3, 5
ZMV retention = 1.02 minutes
Step 2: Synthesis
methyl 4-({N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-)
yl)hexanoyl]glycyl}amino)-L-phenylalaninate (#252):
<p dir="rtl">10 251 #251 (800 mg, 1.47 mg) kgf, 1 mtf) kgf</p>
Add 16 dichloromethane milliliters (4.8 milliliters of TFA) at 1°C. The mixture is stirred at room temperature for two hours. The mixture is shaken by mouth. The waste material is separated from water and filtered. The filtered material is found to supply 252 # (800 mg, 97.5): Solid white puff pastry.
HPLC (Protocol Q3) [M+H+] 445.4,
15 ZMV retention = 0.90 min.
Step 3: Synthesis
1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(2S)-3-[4- ({N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]glycyl}amino)phenyl]-1-methoxy-1-oxopropan-2-yl}amino )-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl- 20
1-oxoheptan-4-yl]-N-methyl-L-valinamide (mcGly#201).
٤٠٦٩
-٣٧٤-
198# 198 mg/ml, 0.13 mg/ml, 1 mg/ml E) and #252 (60.3 mg, 0.18 mg mol, 1.4 ml (1.4 ml) N,N-dimethylformamide) add 64.2 ml HATU GFGF 0.13 mg diisopropyl ethylamine, 0.52 mg diisopropyl ethylamine, 0.52 mg diisopropyl ethylamine. A milliliter at a degree
<p dir="rtl">5 Layer the bangs for an hour or two. The critical acid mixture is balanced to give a crude product, which is purified by thermolysis of silica gel (by filtering with DCM/MeOH) in a file.</p>
<p dir="rtl">1:1 to 7:), then purified again by TLC (Methanol: 10:1 dichloromethane) giving mcGly (201#25 mg, 16.2:) as a white solid:</p>
ESI-MS: m/z 1023.59 [M+H+], HPLC (ProtocolEB)
<p dir="rtl">10 Retention time = 4 minutes (purity = 96:).</p>
1H NMR (DMSO-d6) δ(d, 0.5H),
<p>8.11 (m, 1H), 7.82 (m, 1H), 7.47 (d, 2H), 7.15 (m, 2H), 7.01 (s, 2H),</p>
<p>4.67 (m, 3H), 3.96 (m, 4H), 3.65 (m, 4H), 3.40 (m, 4H), 3.27 (m, 7H),</p>
<p>3.16 (m, 5H), 2.24 (m, 8H), 1.50 (m, 11H), 1.19 (m, 21H).</p>
15 Tldhir
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-
{[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexyl]amino}-1-oxo-3-
phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-
1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide
(MalC6Am#151). 20
<img file="SA4069B1_D0319.tif" />
MalC6Am#151
HATU
Hunig's base dichloromethane
DMF
<img file="SA4069B1_D0320.tif" />
H
O
86%
O
OH
<img file="SA4069B1_D0321.tif" />
٤٠٦٩
-٣٧٥-
Step 1: Synthesis
1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-{[6 -(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexyl]amino}-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl- 3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide 5
(MalC6Am#151).
Use the compound D using #151 (20 mg, 0.023 mg ml, 1 ml), 7) 1-(6-aminohexyl)-1H-pyrrole-2,5-dione mg, 0.030 mg mol, Base
10 0.016 milliliters, 0.092 milliliters, 0.092 milliliters, 1 3. MT (2 MT)
dichloromethane, 0.2 ml DMF, purification using C18 medium pressure medium phase acetonitrile (gradient: 5 to 80 mM water). 0.02: TFA (MalC6Am) (yields 151#18.4) MalC6Am, 86:( Mixing of serif oil/solid matter
LC-MS (Protocol Q): m/z 922.3 [M+H+], 15
ZMV retention = 1.43 min; Protocol A (HPLC at 45°C):
m/z 922.4 [M+H+],
Retention time = 7.203 minutes.
Tldhir
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-(4- 20
{(6S,9R,10R)-6-benzyl-10-[(2S)-1-{(3R,4S,5S)-4-[(1,2-dimethyl-L-
prolyl-L-valyl)(methyl)amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-
٤٠٦٩
-٣٧٦-
2-yl]-9-methyl-3,8-dioxo-2,11-dioxa-4,7-diazadodec-1-yl}phenyl)-
N~5~-carbamoyl-L-ornithinamide (mcValCitPABC#246)
<img file="SA4069B1_D0322.tif" />
45%
2
mcValCitPABC-PNP
Hunig's base
2,6-Lutidine
HOAt, DMA
<img file="SA4069B1_D0323.tif" />
mcValCitPABC#246
<sup>H</sup>2<sup>N</sup>
N
Step 1: Synthesis
N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-(4- 5
{(6S,9R,10R)-6-benzyl-10-[(2S)-1-{(3R,4S,5S)-4-[(1,2-dimethyl-L-
prolyl-L-valyl)(methyl) amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-2-yl]-9-methyl-3,8-dioxo-2,11-dioxa-4,7-diazadodec-1 -yl}phenyl)-
N~5~-carbamoyl-L-ornithinamide (mcValCitPABC#246).
10 Follow the process of treatment E using #246 (29.2 MgM, 0.035 mg MgM, 1
Matthew (28.8 (McVALCITPABC-PNP), 0.039 millimeters C 4, 4 ( Purification by C18 trompe l'oeil device
15 Medium pressure medium phase (gradient level: 5 to 50: acetonitrile mL water 0.02 mL TFA as phase) yields 246 #21(mcValCitPABC) mg, 45:) solid oil/solid mixture.
LC-MS (Protocol Q): m/z 1327.9 [M+H+],
ZMV retention = 1.36 minutes.
20 HERCEPTIN® laboratory and body studies
٤٠٦٩
-٣٧٧-
It is noted that with respect to the following HERCEPTIN® formulations, the absence of associated cell safety factors shows a significant high The original word or the upper part of the whole body when arranged in a double additive body.
Conduct a laboratory cell test
<p dir="rtl">5 Table, the cells, the (BT474), the T -Rotyda (, N87), the Al -Ma’atah, (,</p>
HCC1954 (Triocytoplasmosis) or MDA-MB-361-DYT2 (468-MDA-MB) Cell culture dishes with 96 eyes for 24 hours before treatment. The cells are treated with 3 times more than the original body tissue. Additives and drugs separated in sequence or in sequence (i.e., without following an additive or drug) in a double form in 10 consecutive terms Determine the cost of living in Libya
CellTiter 96® AQueous One Solution Cell Proliferation 10 for cell by test
Promega, Madison WI (MTS) after 96 hours of treatment. The relative cell excitability varies in percentage with the untreated control material. The value of IC50 is calculated using a growth factor
The results are evident from XLfit v4.2 (IDBS, Guildford, Surry, UK) 4 standards No. 203 m
Tables 20, 21(a) and 21(b).
15 Growth, intrusive patch, MDAMB-361 DYT2
High-quality studies are being conducted on antibody tracers and the drug Her2+ MDAMB-361 DYT2 cell line. 10 million tumor cells are grown to increase the number of tumor cells. Matrigel 50: Damages the skin of those with immunocompromised tumors that are susceptible to complications. The cost of saving the sword for a period of 6-8 weeks. When the tumor volume reaches between 250-350 mm3, 20 ml of drugs or delivery medium are given through an intravenous stop, followed by a medication tablet. Take 1 mg/mg of antigen antibody and treatment drug 4 tablets over 4 days (Q4dx4). It is measured by the size of the time, and the week, and the week, and the time, for the week, for the week, and the Caliper tool, and the Calipeer tool, and the next formula: ػ Al -War =) Al -Tawla x Display 2 ( / 2. By dividing the tumor size by the tumor size treated with carrier medium (T/C).
٤٠٦٩
-٣٧٨-
A series of MDAs are testing three different endogenous patch transmitters MDA-MB-361-DYT2 to potentiate their antitumor activity. The results of the representative study show four million salary changes in the average cost of treatment at a conveyor belt during a financial period Over a period of 50 days (Figure 1). To compare the results from the three studies, antineoplastic activity is equal to the volume of tumor treated with the drug.
<p dir="rtl">5 By the size of the treated tumor in transport medium (T/C). The T/C value plot (Figure 2) shows that each of the six levels causes complete (or nearly complete) tumor remission during an observation period of up to 107 days in the studies.</p>
The results for H(C)-mcMMAF, H(C)-vcMMAE, H(C)-#D54 and H(K) MCC-DM1 are clear from studies of the intrusive patch MDA-MB-361-DYT2.
<p dir="rtl">10 The tumor in the treatment group is compared to the control group (T/C) between the paired subjects (see Figure 5(G). These results show that H(C)-#D54 exhibits a consistent high efficacy HERCEPTIN® MDF (C)-mcMMAF, H(C)-vcMMAE and add-H(K)-MCC DM1 mcMAE, growth, c.</p>
Growth of an intrusive patch of the lumen N87 in the body (HERCEPTIN®)
<p dir="rtl">15 Studies are being conducted on the body of the antibody tracer substances and a drug derived from growth, a patch</p>
External to show the target using Khalifa N87 lines. 7.5 million tumor cells: matrigel Damage to the skin of immunocompromised skin 6-8 sections to reach the tumor size with a thickness of 250-350 mm3. Dredging is done by stopping a limb's vein and bolus with a medication tablet. Depending on the tumor's response to treatment, administer 1-10 mg/kg mL.
<p dir="rtl">20 Antibody tracers and treatment drug: 4 mg every 4 days. Monitor the change in weight and body weight.</p>
Experimental newspapers weekly. The tumor size is measured twice a week for the first 50 days and once a week after, using the Caliper tool and fits the following formula: Tumor size = (length x width2) / 2 days The liana is lightning before its size reaches 2500 mm3 The gallbladder after the first week of treatment is closely monitored by the authorities to restore the growth of the gallbladder. Stop it
<p dir="rtl">25 treatment.</p>
٤٠٦٩
-٣٧٩-
The test results for H(C)-mcMMAF, H(C)-vcMMAE, H(C)-#D54 and H(K MCC-DM1) reveal an intrusive patch of N87 particles. And 5. Growth, c.
<p dir="rtl">5 Pharmacological allergic and toxic allergic</p>
External drug formulations and non-toxic formulas are generated, based on the dose-generated studies of non-toxic and non-toxic formulas (see Tables 22 and 23). A document on the medicinal preparations of the herb and the toxic substances of the herb, including: The dosage form is given in the following doses:
<p dir="rtl">10 Rudiyah 3 mg/mg. Samples were collected for 336 hours. The toxic compounds vary greatly in number, including:</p>
H(C)-vc-MMAE is given as a single dose (Sprague-Dawley (Crl:CD (SD)))
Or H(C)-#D54 at doses of 3, 10, and 30 mg/ml, or H(C)-mc-MMAD or H(C)-mc-MMAF at 10, 30, and 100 mg/ml. The eyes collect for 336 hours. The levels of antibody recycling and ADC are measured using an ELISA test. The issue is slipping away
<p dir="rtl">15 The AUC for the antibody followed the ADC and the AUC for the ADC. It also shows the ratio of ADC to AUC for the antibody.</p>
The implications of the hug of the tinity of H (C)-#D54 and ADC The transmission of the traction, the traction. The ratio of ADC to Ab AUC is also provided for H(C)-#D54 gel.
20 H(C)-vc-MMAG. These results suggest that H(C)-#D54 for early exposure and that the ADC and/or
Link - MMAE must be more stable than H(C)-vc-MMAE.
Toxicity
Targeted independent toxicity of #D54 and of the comparator primers (mcValCitPABC‐MMAD and mcValCitPABC‐MMAE) associated with an uncross‐linked substrate
٤٠٦٩
-٣٨٠-
The recombinant antibody (IgG1) is evaluated as a toxicological ablative, dose-generated study.
Duration of two weeks. The doses consist of antibody-drug conjugates (ADCs), 3, 10 and 30 mg/kg, 5 torr/pack, and a similar formula is marked between the conjugates (3.8, 3.2 and 4, respectively). This includes For female studies and clinical observations
<p dir="rtl">5 At least daily, or weigh the body weekly. Clinical pathology (end of the night) and anatomy (day 1517) Microscopic analysis of 9 tissues or traces and any general signs.</p>
It notes the rate and frequency of change in body weight, its relationship and signs of illness at a dose.
<p dir="rtl">30 mg/vol for all associated substances and at a dose of 10 mg/vol for the associated substance MMAD. There are no clinical features or changes in body weight in the surviving groups.</p>
<p dir="rtl">10 The target members include the files of associated items listed by the subject.</p>
The dose combinations were kept alive completely. The conjugated substance at 10 mg/g contains residual epididymal organ lumen (5/5, lower to moderate), inflammation at the base of the heart (1/5 g, lower than moderate) and inflammation at the base of the heart (1/5 g, lower). Ḍam ṭilām āzīd um al-Qarnīyah (5/1, jaḥar, Ḍan, (below).
<p dir="rtl">15 3 mg/g, etc. There are changes related to the bone marrow, testicle, and epididymal vessel. Glory be to God</p>
Conjugate substance MMAE At a dose of 10 mg/g, there are changes in bone marrow, duct, epididymis and epididymis. At a dose of 3 mg/kg of the conjugated substance, there are color changes and cleavage followed by further deformation. In studies of similar design and in groups that are still alive, the conjugated substance may not have the presence of comparable conjugated substances in the bone marrow and also have the presence of dissipation or dispersion.
<p dir="rtl">20 M eld comparisons.</p>
Specifically, the MTD of the MMAE and the MMAE are equal to the MMAE The MTD of the MMAD pair is 3 kg/kg. The noxious effect level (NOAEL) of the conjugated substance is 3 mg/g, and the NOAEL is 1 mg/g. This study showed how to compare the body of the body of God
<p dir="rtl">25 #D54 M The fixed salaries prescribed by M.L.F.</p>
٤٠٦٩
-٣٨١-
Studies against IL-13Rα2 ADC in the laboratory and in the body
ADCs and antibodies against IL-13Rα2
The compound added to human immunoglobulin hu08 binds specifically to the future gene IL 13Rα2. The arrangements of amino acid and nucleotide are shown in Table 3. The Kabat CDRs are followed by a line.
Table 3: The amino acid and nucleotide arrangement of the human-identified HU08 antibody.
<tr><td><p dir="rtl">Ranking</p></td><td><p dir="rtl">Description</p></td><td><p dir="rtl">Definition Ranking No.</p></td></tr><tr><td><p>EVQLVESGGGLVQPGGSLRLSCAASGFTFS</p><p>RNGMSWVRQAPGKGLEWVATVSSGGSYIY</p><p>YADSVKGRFTISRDNAKNSLYLQMNSLRAE</p><p>DTAVYYCARQGTTALATRFFDVWGQGTLV</p><p>TVSS</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid for a heavy chain variable region hu08 (CDRs twisted into a line).</p></td><td><p>9</p></td></tr><tr><td><p>DIQMTQSPSSSLSASVGDRVTITCKASQDVG</p><p>TAVAWYQQKPGKAPKLLIYSASYRSTGVPS</p><p>RFSGSGSGTDFTLTISSLQPEDFATYYCQH</p><p>HYSAPWTFGGGTKVEIK</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid for a variable region of a string hu08 (CDRs that are wrapped around a line).</p></td><td><p>10</p></td></tr>
٤٠٦٩
-٣٨٢-
<tr><td><p>EVQLVESGGGLVQPGGSLRLSCAASGFTFS</p><p>RNGMSWVRQAPGKGLEWVATVSSGGSYIY</p><p>YADSVKGRFTISRDNAKNSLYLQMNSLRAE</p><p>DTAVYYCARQGTTALATRFFDVWGQGTLV</p><p>TVSSASTKGPSVFPLAPSSKSTSGGTAALG</p><p>CLVKDYFPEPVTVSWNSGALTSGVHTFPAV</p><p>LQSSGLYSLSSVVTVPSSSLGTQTYICNVNH</p><p>KPSNTKVDKKVEPKSCDKTHTCPPCPAPEL</p><p>LGGPSVFLFPPKPKDTLMISRTPEVTCVVVD</p><p>VSHEDPEVKFNWYVDGVEVHNAKTKPREE</p><p>QYNSTYRVVSVLTVLHQDWLNGKEYKCKV</p><p>SNKALPAPIEKTISKAKGQPREPQVYTLLPPS</p><p>REEMTKNQVSLTCLVKGFYPSDIAVEWESN</p><p>GQPENNYKTTPPPVLDSDGSFFLYSKLTVDK</p><p>SRWQQGNVFSCSVMHEALHNHYTQKSLSC</p><p>SPGK</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid heavy chain</p><p>CDRs(hu08</p><p dir="rtl">followed a line (.</p></td><td><p>11</p></td></tr><tr><td><p>DIQMTQSPSSSLSASVGDRVTITCKASQDVG</p><p>TAVAWYQQKPGKAPKLLIYSASYRSTGVPS</p><p>RFSGSGSGTDFTLTISSLQPEDFATYYCQH</p><p>HYSAPWTFGGGTKVEIK</p><p>TVAAPSVFIFPPSDEQLKSGTASVVCLLNNF</p><p>YPREAKVQWKVDNALQSGNSQESVTEQDS</p><p>KDSTYSLSSTLTLSKADYEKHKVYACEVTH</p><p>QGLSSPVVTKSFNRGEC</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid chain</p><p>CDRs(hu08</p><p dir="rtl">followed a line (.</p></td><td><p>12</p></td></tr>
٤٠٦٩
-٣٨٣-
<tr><td></td><td><p>GAGGTGCAGCTGGTGGAGTCTGGCGGCG</p></td><td><p>nucleotide arrangement</p></td><td><p>13</p></td></tr><tr><td></td><td><p>GACTGGTGCAGCCTGGCGGCTCTCTGAG</p></td><td><p dir="rtl">hu08 heavy chain</p></td><td></td></tr><tr><td></td><td><p>ACTGTCTTGTGCCGCCTCCGGCTTCACCT</p></td><td></td><td></td></tr><tr><td></td><td><p>TCAGTAGGAATGGCATGTCTTTGGGTGAGG</p></td><td></td><td></td></tr><tr><td></td><td><p>CAGGCCCCTGGCAAGGGCCTGGAGTGGG</p></td><td></td><td></td></tr><tr><td></td><td><p>TGGCCACCGTTAGTAGTGGTGGTAGTTAC</p></td><td></td><td></td></tr><tr><td></td><td><p>ATCTACTATGCAGACAGTGTGAAGGGGCG</p></td><td></td><td></td></tr><tr><td></td><td><p>GTTCACCATCTCCAGGGACAACGCCAAGA</p></td><td></td><td></td></tr><tr><td></td><td><p>ACTCCCTGTACCTCCAGATGAACTCCCTG</p></td><td></td><td></td></tr><tr><td></td><td><p>AGGGCCGAGGATACCGCCGGTGTACTACT</p></td><td></td><td></td></tr><tr><td></td><td><p>GTGCCAGACAAGGGACTACGGCACTAGC</p></td><td></td><td></td></tr><tr><td></td><td><p>TACGAGGTTCTTCGATGTCTGGGGCCAG</p></td><td></td><td></td></tr><tr><td></td><td><p>GGCACCCTGGTGACCGTGTCCTCTGCGT</p></td><td></td><td></td></tr><tr><td></td><td><p>CGACCAAGGGCCCATCGGGTCTTCCCCCT</p></td><td></td><td></td></tr><tr><td></td><td><p>GGCACCCTCCTCCAAGAGCACCTCTGGG</p></td><td></td><td></td></tr><tr><td></td><td><p>GGCACAGCGGCCCTGGGCTGCCTGGTCA</p></td><td></td><td></td></tr><tr><td></td><td><p>AGGACTACTTCCCGAACCGGTGACGGT</p></td><td></td><td></td></tr><tr><td></td><td><p>GTCGTGGAACTCAGGCGCCCTGACCAGC</p></td><td></td><td></td></tr><tr><td></td><td><p>GGCGTGCACACCTTCCCGGCTTGTCCTAC</p></td><td></td><td></td></tr><tr><td></td><td><p>AGTCCTCAGGACTCTACTCCCTCAGC</p></td><td></td><td></td></tr><tr><td></td><td><p>GTGGTGACCGTGCCCTCCAGCAGCTTGG</p></td><td></td><td></td></tr><tr><td></td><td><p>GCACCCAGACCTACATCTGCAACGTGAAT</p></td><td></td><td></td></tr><tr><td></td><td><p>CACAAGCCCAGCAACACCAAGGTGGACA</p></td><td></td><td></td></tr><tr><td></td><td><p>AGAAAGTTGAGCCCAAATCTTGTGACAAA</p></td><td></td><td></td></tr><tr><td></td><td><p>ACTCACACATGCCCACCGTGCCCAGCAC</p></td><td></td><td></td></tr><tr><td></td><td><p>CTGAACTCCTGGGGGGACCGTCAGTCTT</p></td><td></td><td></td></tr><tr><td></td><td><p>CCTCTTCCCCCCAAAACCCAAGGACACCC</p></td><td></td><td></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>TCATGATCTCCCGGACCCCTGAGGTCACA</p></td><td></td><td></td></tr><tr><td></td><td><p>TGCGTGGTGGTGGACGTGAGCCACGAAG</p></td><td></td><td></td></tr>
-٣٨٤-
<tr><td><p>GACATCCAGATGACCCAGTCCCCCTCTTC</p><p>TCTGTCTGCCTCTGTGGGCGACAGAGTGA</p><p>CCATCACCTGTAAGGCCAGTCAGGATGTA</p><p>GGTACTGCTGTAGCCTGGTATCAGCAGAA</p><p>GCCTGGCAAGGCTCCCAAGCTGCTGATC</p><p>TACTCGGCATCCTACCGGGTCCACTGGCGT</p><p>GCCTTCCAGATTCTCCGGCTCTGGCTCTG</p><p>GCACCGATTTCACCCTGACCATCTCCCTCC</p><p>CTCCAGCCTGAGGATTTCGCCACCTACTA</p><p>CTGCCAGCACCATTATAGTGCTCCGTGGA</p><p>CGTTTGGCGGCGGAACAAAGGTGGAGAT</p><p>CAAGACTGTGGCTGCACCATCTGTCTTCA</p><p>TCTTCCCGCCATCTGATGAGCAGTTGAAA</p><p>TCTGGAACTGCCTCTGTTGTGTGCCTGCT</p><p>GAATAACTTCTATCCCAGAGAGCCAAAG</p><p>TACAGTGGAAGGTGGATAACGCCCTCCAA</p><p>TCGGGTAACTCCCAGGAGAGTGTCACAG</p><p>AGCAGGACAGCAAGGACAGCACCTACAG</p><p>CCTCAGCAGCACCCTGACGCTGAGCAAA</p><p>GCAGACTACGAGAAACACAAAGTCTACGC</p><p>CTGCGAAGTCACCCCATCAGGGCCTGAGC</p><p>TCGCCCGTCACAAAGAGCTTCAACAGGG</p><p>GAGAGTGT</p></td><td><p>nucleotide arrangement</p><p dir="rtl">hu08 series</p></td><td><p>14</p></td></tr>
٤٠٦٩
-٣٨٥-
The human antibody against IL-13Rα2 is conjugated to a different molar of the drug, as shown in Table 4. Antibody and drug tracers, according to the methods of the drug.
Table 4: Anti-ADCs IL-13Rα2.
<tr><td><p dir="rtl">Label the corresponding ADC</p></td><td><p dir="rtl">Connection number - for ADC connector</p></td></tr><tr><td><p>hu08-vc-0101</p></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>hu08-mc-3377</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-#115</p></td></tr><tr><td><p>hu08-mc-0131</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-0#118</p></td></tr><tr><td><p>hu08-malpeg-6121</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_MalPeg6C2-</p><p>#117</p></td></tr><tr><td><p>hu08-malpeg-0131</p></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_Mal(H2O)Peg6C2-0#118</p></td></tr><tr><td><p>hu08-mc-6121</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-#117</p></td></tr><tr><td><p>hu08-vc-3906</p></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_mcValCitPABC-#226</p></td></tr><tr><td><p>hu08-vc-6780</p></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>hu08-mc-8261</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-#69</p></td></tr><tr><td><p>hu08-mc-3906</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-#226</p></td></tr>
٤٠٦٩
-٣٨٦-
<tr><td><p>hu08-MalPeg-8261</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_MalPeg6C2-</p><p>#69</p></td></tr><tr><td><p>huIgG8.84-vc0101</p></td><td><p>huIgG8.84-mcValCitPABC-#54</p></td></tr><tr><td><p>huIgG8.84-mc3377</p></td><td><p>huIgG8.84-mc-#115</p></td></tr>
In vitro cytotoxicity testing of ADCs against IL-13Rα2
Cell lines that express the IL-13Rα2 antigen and the corresponding negative cell line, are cultured with excess proteins and ADCs against IL-13Rα2 containing the hu08 antibody conjugated to multiple mutants of the gene. After four days, the Lebanese farm population is evaluated.
<p dir="rtl">5 The IC50 value is measured using a non-marking tag and given in nanometers of antibody/ml.</p>
Data showed that the antibody hu08v1.0/1.0 against IL-13Rα2 conjugated to auristatin stimulated the production of bacterial cell lines The IL-13Rα2 antibody tested (PC3MM2) has an IC50 ranging from 1.1 to 4.9 nanograms of antibody/ml. Or 7.3-32.7 PTH (Table 5). These ADCs are active against the Khalifa mixture. ٻ
10 glycosylated H460, IL-13Rα2, and cytoplasmic ADCs bound to glycosylated IL-13Rα2 , huIgG8.84-vc0101 and huIgG8.84-mc3377, activate against any cell line file.
Tested.
Table 5: IC50 value (nanograms of Ab/milliliter) of gel ADCs against IL-13Rα2 - human immunogenicity.
<tr><td colspan="3"><p dir="rtl">IC50 (nanogar Ab/ml)</p></td><td rowspan="2"><p>DAR</p></td><td rowspan="2"><p>ADC</p></td></tr><tr><td><p>H460</p></td><td><p>A375</p></td><td><p>PC3MM2</p></td></tr><tr><td><p>400000></p></td><td><p>3.8</p></td><td><p>2.5</p></td><td><p>3.2</p></td><td><p>hu08-vc0101</p></td></tr>
٤٠٦٩
-٣٨٧-
<tr><td><p>400000></p></td><td><p>2.2</p></td><td><p>1.2</p></td><td><p>4.3</p></td><td><p>hu08-mc3377</p></td></tr><tr><td><p>400000></p></td><td><p>2.1</p></td><td><p>1.3</p></td><td><p>3.2</p></td><td><p>hu08-mc-0131</p></td></tr><tr><td><p>400000></p></td><td><p>3.4</p></td><td><p>3.5</p></td><td><p>3.3</p></td><td><p>hu08-malpeg-6121</p></td></tr><tr><td><p>400000></p></td><td><p>4.9</p></td><td><p>2.9</p></td><td><p>2.9</p></td><td><p>hu08-malpeg-0131</p></td></tr><tr><td><p>400000></p></td><td><p>2.4</p></td><td><p>1.1</p></td><td><p>3.3</p></td><td><p>hu08-mc-6121</p></td></tr><tr><td><p>400000></p></td><td><p>2.9</p></td><td><p>1.5</p></td><td><p>3</p></td><td><p>hu08-vc-3906</p></td></tr><tr><td><p>400000></p></td><td><p>2.2</p></td><td><p>1.2</p></td><td><p>4</p></td><td><p>hu08 vc-6780</p></td></tr><tr><td><p>400000></p></td><td><p>400000></p></td><td><p>400000></p></td><td><p>3.7</p></td><td><p>huIgG8.84-vc0101</p></td></tr><tr><td><p>400000></p></td><td><p>400000></p></td><td><p>400000></p></td><td><p>4.3</p></td><td><p>huIgG8.84-mc3377</p></td></tr>
An intrusive patch grew after the skin on the body, using ADCs against IL13Rα2.
The new body hu08 is related to the academic body's future description -IL 13Rα2. The HU08 ADCs test 11 different connector combinations, including an external patch on the cellular body. Young children (under-treated) It was damaged, it was damaged, it was packed.
<p dir="rtl">5 PC3MM2. In advanced tumors, approximately 0.1 to 0.3 g (n = 8 to 10 i.v./treatment group) is given intravenously 4 ml over 4 days (4 q4d x 4 ml). Om Aadi (conveyor medium), hu08v1 .0/1.0 ADCs for connection points 0101-vc-,vc-6780,vc-6780</p>
،3906
MalPeg-0131, MalPeg-8261, mc-3377, mc-6121, mc-0131, mc-8261
10 6121-MalPeg, or 3906-MalPeg, and an unconjugated antibody (huIgG8.84) conjugated to MalPeg
0101-vc or 3377-mc, 2 or 3 ml drying unit. ADCs are dosed depending on the Ab complex. Measure the area and the gland weekly at the same time as its measurement, such as 3 mm = 0.5 × (width of the tumor) × (length of tumor).
٤٠٦٩
-٣٨٨-
Table 6 shows the scope of activity against tumors of different tested ADCs. The relative order of high is -hu08-vc-0101 > hu08-vc
6780 > hu08-mc-0131 > hu08-mc-6121 > hu08-mc-3906 > hu08-MalPeg-0131 > hu08-MalPeg-6121 > hu08-MalPeg-3906 > > hu08-
8261-mc. At a dose level of 3 mg/kg, mc-0101-hu08-vc and -hu08-3377-mc show anti-tumor activity for the unconjugated antibody (huIgG8.84) conjugated to mc 01-vc or 3377-mc has similar activity To compare the carrier medium.
Table 6: High ADCs against IL-13Rα2 mNMA, PC3MM2 intrusive patch
<tr><td colspan="8"><p dir="rtl">Intrusive patch PC3MM2, size (m3 +/- SEM)</p></td><td rowspan="2"><p dir="rtl">Dosage</p><p dir="rtl">(mjfjfjfjfjf/jjj)</p><p>Q4dx4</p></td><td rowspan="2"><p>ADC</p></td></tr><tr><td><p dir="rtl">Today</p><p dir="rtl">52</p></td><td><p dir="rtl">Today</p><p dir="rtl">42</p></td><td><p dir="rtl">Today</p><p dir="rtl">30</p></td><td><p dir="rtl">Today</p><p dir="rtl">20</p></td><td><p dir="rtl">Today</p><p dir="rtl">16</p></td><td><p dir="rtl">Today</p><p dir="rtl">8</p></td><td><p dir="rtl">Today</p><p dir="rtl">3</p></td><td><p dir="rtl">Today</p><p dir="rtl">1</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>1707</p><p>±</p><p>133</p></td><td><p>1149</p><p>±</p><p>82</p></td><td><p>638</p><p>±</p><p>27</p></td><td><p dir="rtl">p t</p></td><td><p dir="rtl">The carrier</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>1176</p><p>±</p><p>51</p></td><td><p>1036</p><p>±</p><p>60</p></td><td><p>642</p><p>±</p><p>36</p></td><td><p>2</p></td><td><p>hu08-</p><p>MalPeg</p><p>-3906</p></td></tr>
٤٠٦٩
-٣٨٩-
<tr><td></td><td></td><td></td><td></td><td></td><td><p>1429</p></td><td><p>1088</p></td><td><p>642</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>mc-</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>158</p></td><td><p>121</p></td><td><p>51</p></td><td></td><td><p>8261</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>778</p></td><td><p>1004</p></td><td><p>637</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>mc-</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>83</p></td><td><p>73</p></td><td><p>44</p></td><td></td><td><p>0131</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>1000</p></td><td><p>947</p></td><td><p>638</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>MalPeg</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>126</p></td><td><p>85</p></td><td><p>36</p></td><td></td><td><p>-6121</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>1040</p></td><td><p>1085</p></td><td><p>649</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>MalPeg</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>88</p></td><td><p>54</p></td><td><p>39</p></td><td></td><td><p>-0131</p></td></tr><tr><td><p>532</p></td><td><p>207</p></td><td><p>113</p></td><td><p>201</p></td><td><p>243</p></td><td><p>557</p></td><td><p>899</p></td><td><p>646</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>vc-0101</p></td></tr><tr><td><p>151</p></td><td><p>49</p></td><td><p>17</p></td><td><p>20</p></td><td><p>28</p></td><td><p>49</p></td><td><p>54</p></td><td><p>36</p></td><td></td><td></td></tr><tr><td></td><td></td><td><p>230</p></td><td><p>217</p></td><td><p>279</p></td><td><p>652</p></td><td><p>850</p></td><td><p>641</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>vc-6780</p></td></tr><tr><td></td><td></td><td><p>133</p></td><td><p>45</p></td><td><p>55</p></td><td><p>54</p></td><td><p>100</p></td><td><p>28</p></td><td></td><td></td></tr>
٤٠٦٩
-٣٩٠-
<tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>821</p><p>±</p><p>93</p></td><td><p>909</p><p>±</p><p>63</p></td><td><p>636</p><p>±</p><p>37</p></td><td><p>2</p></td><td><p>hu08-mc-6121</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>806</p></td><td><p>875</p></td><td><p>637</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>mc-</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>70</p></td><td><p>48</p></td><td><p>26</p></td><td></td><td><p>3906</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>1220</p></td><td><p>991</p></td><td><p>645</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>2</p></td><td><p>MalPeg</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>115</p></td><td><p>71</p></td><td><p>34</p></td><td></td><td><p>-8261</p></td></tr><tr><td></td><td></td><td><p>230</p></td><td><p>110</p></td><td><p>6</p></td><td><p>38</p></td><td><p>433</p></td><td><p>339</p></td><td></td><td></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>3</p></td><td><p>hu08-</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>vc0101</p></td></tr><tr><td></td><td></td><td><p>230</p></td><td><p>110</p></td><td><p>6</p></td><td><p>14</p></td><td><p>45</p></td><td><p>18</p></td><td></td><td></td></tr><tr><td><p>902</p></td><td><p>616</p></td><td><p>346</p></td><td><p>78</p></td><td><p dir="rtl">p t</p></td><td><p>41</p></td><td><p>385</p></td><td><p>337</p></td><td></td><td><p>hu08-</p></td></tr><tr><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>3</p></td><td><p>mc3377</p></td></tr><tr><td><p>364</p></td><td><p>243</p></td><td><p>147</p></td><td><p>36</p></td><td><p dir="rtl">p t</p></td><td><p>12</p></td><td><p>36</p></td><td><p>21</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>1017</p></td><td><p>581</p></td><td><p>365</p></td><td></td><td><p>huIgG8.</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>3</p></td><td><p>84-</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>168</p></td><td><p>47</p></td><td><p>22</p></td><td></td><td><p>vc0101</p></td></tr>
٤٠٦٩
-٣٩١-
<tr><td></td><td></td><td></td><td></td><td><p>544</p></td><td><p>295</p></td><td><p>459</p></td><td><p>328</p></td><td></td><td><p>huIgG8.</p></td></tr><tr><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>GT</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>10</p></td><td><p>84-</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>mc3377</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>258</p></td><td><p>121</p></td><td><p>63</p></td><td><p>27</p></td><td></td><td></td></tr>
GT = the final set due to the size of the difference
Studies of ADC against Notch in vitro and in the body
Antibodies and ADCs against Notch
The antigenic antibodies are linked to the human race, hu28 and hu75, and the antigenic antibodies
5 Human hybrids - drag, ch28 and ch75, special pores of the Notch receptor. Amino arrangements are available
acid
The nucleotide gel hu28 and hu75 m Table 7. The Kabat CDRs follow a line.
Table 7: Arrangements of the amino acid and nucleotide of the anti-Notch antibody that are similar to the human trait.
<tr><td><p dir="rtl">Ranking</p></td><td><p dir="rtl">Description</p></td><td><p dir="rtl">Definition Arrangement Arrangement No.</p></td></tr><tr><td><p>EVQLVESGGGLVQPGGSLRLSCAASGFTFRDYG</p><p>MTWVRQAPGKGLEWVAYISSGSNYIYYAEAAVKG</p><p>RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARR</p><p>GPFVLDAWGQGTLVTVSS</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid for variable logic heavy chain</p><p>CDRs(hu28</p><p dir="rtl">followed a line (.</p></td><td><p>15</p></td></tr>
٤٠٦٩
-٣٩٢-
<tr><td><p>EVQLVESGGGLVQPGGSLRLSCAASGFTFRDYG</p><p>MTWVRQAPGKGLEWVAYISSGSNYIYYAEAAVKG</p><p>RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARR</p><p>GPFVLDAWGQGTLVTVSSASTKGPSVFPLAPSS</p><p>KSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS</p><p>GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI</p><p>CNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP</p><p>ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV</p><p>SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS</p><p>TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI</p><p>EKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT</p><p>CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD</p><p>SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL</p><p>HNHYTQKSLSLSPG</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid heavy chain</p><p>CDRs(hu28</p><p dir="rtl">followed a line (.</p><p dir="rtl">Your logic is constant.</p><p dir="rtl">Human IgG1</p></td><td><p>16</p></td></tr>
٤٠٦٩
-٣٩٣-
<tr><td></td><td><p>GAGGGTGCAGCTGGTGGAGTCTGGGGGAGGCT</p><p>TGGTCCAGCCTGGGGGGTCCCTGAGACTCTC</p></td><td><p dir="rtl">Translation: GFV</p><p>nucleotide</p></td><td><p>17</p></td></tr><tr><td></td><td><p>CTTGTGCAGCCTCTGGATTCACTTTCAGGGACT</p></td><td><p dir="rtl">Heavy machine series</p></td><td></td></tr><tr><td></td><td><p>ATGGAATGACCTGGGTCCGCCAGGCTCCAGG</p></td><td><p>hu28</p></td><td></td></tr><tr><td></td><td><p>GAAGGGGCTGGAGTGGGTGGCCTATATTAGTA</p></td><td></td><td></td></tr><tr><td></td><td><p>GTGGTAGCAATTACATCTATTATGCAGAAGCG</p></td><td></td><td></td></tr><tr><td></td><td><p>GTGAAGGGCCGATTCACACATCTCCAGAGACAA</p></td><td></td><td></td></tr><tr><td></td><td><p>CGCCAAGAACTCACTGTATCTGCAAATGAACA</p></td><td></td><td></td></tr><tr><td></td><td><p>GCCTGAGAGCCGAGGACACGGCTGTGTATTAC</p></td><td></td><td></td></tr><tr><td></td><td><p>TGTGCGAGACGAGGCCCGTTTGTTTTGGATGC</p></td><td></td><td></td></tr><tr><td></td><td><p>CTGGGGCCAGGGAACCCTGGTCACCGTCTCC</p></td><td></td><td></td></tr><tr><td></td><td><p>TCAGCGTCGACCAAGGGCCCATCGGTCTTCCC</p></td><td></td><td></td></tr><tr><td></td><td><p>CCTGGCACCCTCCTCCAAGAGCACCTCTGGG</p></td><td></td><td></td></tr><tr><td></td><td><p>GGCACAGCGGCCCTGGGCTGCCTGGTCAAGG</p></td><td></td><td></td></tr><tr><td></td><td><p>ACTACTTCCCCGAACCGGTGACGGTGTCGTGG</p></td><td></td><td></td></tr><tr><td></td><td><p>AACTCAGGCGCCCTGACCAGCGGCGGTGCACA</p></td><td></td><td></td></tr><tr><td></td><td><p>CCTTCCCGGCTGTCCTACAGTCCTCAGGACTC</p></td><td></td><td></td></tr><tr><td></td><td><p>TACTCCCTCAGCAGCGTGGTGACCGTGCCCTC</p></td><td></td><td></td></tr><tr><td></td><td><p>CAGCAGCTTGGGCACCCAGACCTACATCTGCA</p></td><td></td><td></td></tr><tr><td></td><td><p>ACGTGAATCACAAGCCCAGCAACACCAAGGTG</p></td><td></td><td></td></tr><tr><td></td><td><p>GACAAGAAAGTTGAGCCAAATCTTGTGACAA</p></td><td></td><td></td></tr><tr><td></td><td><p>AACTCACACATGCCCACCGTGCCCAGCACCTG</p></td><td></td><td></td></tr><tr><td></td><td><p>AACTCCTGGGGGGACCGTCAGTCTTCCTCTTC</p></td><td></td><td></td></tr><tr><td></td><td><p>CCCCCAAAACCCAAGGACACCCTCATGATCTC</p></td><td></td><td></td></tr><tr><td></td><td><p>CCGGACCCCTGAGGGTCACATGCGTTGGTGGTG</p></td><td></td><td></td></tr><tr><td></td><td><p>GACGTGAGCCACGAAGACCCTGAGGTCAAGTT</p></td><td></td><td></td></tr><tr><td></td><td><p>CAACTGGTACGTGGACGGCGTGGAGGTGCAT</p></td><td></td><td></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>AATGCCAAGACAAAGCCGCGGGAGGAGCAGT</p></td><td></td><td></td></tr><tr><td></td><td><p>ACAACAGCACGTACCGTGTGGTCAGCGTCCTC</p></td><td></td><td></td></tr>
-٣٩٤-
<tr><td><p>DIQMTQSPSSLSSASVGDRVTITCKASQSINRYLH</p><p>WYQQKPGKAPKLLIYNANGLQTGVPSRFSGSGS</p><p>GTDFTLTISSLQPEDFATYYCLQHNTWPDTFGG</p><p>GTKVEIK</p></td><td><p dir="rtl">amino order</p><p dir="rtl">ACID for a variable region A line (.</p></td><td><p>18</p></td></tr><tr><td><p>DIQMTQSPSSLSSASVGDRVTITCKASQSINRYLH</p></td><td><p dir="rtl">amino order</p></td><td><p>19</p></td></tr><tr><td><p>WYQQKPGKAPKLLIYNANGLQTGVPSRFSGSGS</p></td><td><p dir="rtl">acid</p></td><td></td></tr><tr><td><p>GTDFTLTISSLQPEDFATYYCLQHNTWPDTFGG</p></td><td><p dir="rtl">hu28</p></td><td></td></tr><tr><td><p>GTKVEIKRTVAAPSVFIFFPSDEQLKSGTASVVCL</p></td><td><p dir="rtl">CDRs (CDRs)</p></td><td></td></tr><tr><td><p>LNNFYPREAKVQWKVDNALQSGNSQESVTEQD</p></td><td><p dir="rtl">Line(</p></td><td></td></tr><tr><td><p>SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL</p></td><td><p dir="rtl">Your logic is constant.</p></td><td></td></tr><tr><td><p>SSPVTKSFNRGEC</p></td><td><p dir="rtl">human kappa</p></td><td></td></tr>
٤٠٦٩
-٣٩٥-
<tr><td><p>GACATCCAGATGACCCAGTCTCCATCCTCCCCT</p><p>GTCTGCATCTGTAGGAGACAGAGTCACCATCA</p><p>CTTGCAAAGCAAGTCAGAGTATTAACAGGTACT</p><p>TACACTGGTATCAGCAGAAACCAGGGAAAGCC</p><p>CCTAAGCTCCTGATCTATAATGCAAACGGGTTTG</p><p>CAAACGGGGGTCCATCAAGGGTTCAGTGGCA</p><p>GTGGATCTGGGACAGATTTCACTCTCACCATC</p><p>AGCAGTCTGCAACCTGAAGATTTTGCAACTTAC</p><p>TACTGTTTTGCAGCATAATACGTGGGCCGGACAC</p><p>GTTTGGCGGAGGGACCAAGGTGGAGATCAAA</p><p>CGGACCGTGGCCGCTCCTTCCGTGTTCATCTT</p><p>CCCCCCTTCCGACGAGCAGCTGAAGTCTGGCA</p><p>CCGCCTCTGTGGTGTGTCTGCTGAACAACTTC</p><p>TACCCCCGGGAGGCCAAGGTGCAGTGGAAGG</p><p>TGGACAACGCTCTGCAGTCCGGCAACTCCCAG</p><p>GAGTCTGTGACCGAGCAGGACTCCAAGGACA</p><p>GCACCTACTCCCTGTCCTCTACCCTGACCCTG</p><p>TCCAAGGCCGACTACGAGAAGCACAAGGTGTA</p><p>CGCCTGTGAGGTGACCCACCAGGGCCTGTCC</p><p>TCTCCTGTGACCAAGTCCTTCAACCGGGGCGA</p><p>GTGC</p></td><td><p dir="rtl">Translation: GFV</p><p>nucleotide</p><p dir="rtl">Your series</p><p>hu28</p></td><td><p>20</p></td></tr>
٤٠٦٩
-٣٩٦-
<tr><td><p>EVQLVESGGGLVQPGGSLRLSCAASGYAFTDY</p><p>WMTWVRQAPGKGLEWVAEISPNSGGTNFNEKF</p><p>KGRFTISVDNAKNSLYLQMNSLRAEDTAVYYCAR</p><p>GEIRYNWFAYWGQGTLVTVSS</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid for variable logic heavy chain</p><p>CDRs(hu75</p><p dir="rtl">followed a line (.</p></td><td><p>21</p></td></tr><tr><td><p>EVQLVESGGGLVQPGGSLRLSCAASGYAFTDY</p><p>WMTWVRQAPGKGLEWVAEISPNSGGTNFNEKF</p><p>KGRFTISVDNAKNSLYLQMNSLRAEDTAVYYCAR</p><p>GEIRYNWFAYWGQGTLVTVSSASTKGPSVFPLA</p><p>PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA</p><p>LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ</p><p>TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP</p><p>APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV</p><p>DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY</p><p>NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP</p><p>APIEKTISKAKGQPREPQVYTLPPSREEMTKNQV</p><p>SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP</p><p>VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM</p><p>HEALHNHYTQKSLSLSPG</p></td><td><p dir="rtl">amino order</p><p dir="rtl">acid heavy chain</p><p>CDRs(hu75</p><p dir="rtl">followed a line (.</p><p dir="rtl">Your logic is constant.</p><p dir="rtl">Human IgG1</p></td><td><p>22</p></td></tr>
٤٠٦٩
-٣٩٧-
<tr><td></td><td><p>GAGGGTGCAGCTGGTGGAGTCTGGGGGAGGCT</p><p>TGGTCCAGCCTGGGGGGTCCCTGAGACTCTC</p></td><td><p dir="rtl">Translation: GFV</p><p>nucleotide</p></td><td><p>23</p></td></tr><tr><td></td><td><p>CTGTGCAGCCTCTGGTTATGCATTCACTGACTA</p></td><td><p dir="rtl">Heavy machine series</p></td><td></td></tr><tr><td></td><td><p>CTGGATGACCTGGGTCCCCGCAGGCTCCAGGG</p></td><td><p>hu75</p></td><td></td></tr><tr><td></td><td><p>AAGGGGCTGGAGTGGGTGGCCGAAATTTCTC</p></td><td></td><td></td></tr><tr><td></td><td><p>CTAACAGTGGTGGTACTAACTTCAATGAAAAGT</p></td><td></td><td></td></tr><tr><td></td><td><p>TCAAGGGCCGATTCACACATCTCCGTTGACAAC</p></td><td></td><td></td></tr><tr><td></td><td><p>GCCAAGAACTCACTGTATCTGCAAATGAACAG</p></td><td></td><td></td></tr><tr><td></td><td><p>CCTGAGAGCCGAGGACACGGCTGTGTATTACT</p></td><td></td><td></td></tr><tr><td></td><td><p>GTGCGAGAGGGGAAATCCGGTTACAATTGGTTT</p></td><td></td><td></td></tr><tr><td></td><td><p>GCTTACTGGGGCCAGGGAACCCTGGTCACCG</p></td><td></td><td></td></tr><tr><td></td><td><p>TTCTCCTCAGCGTCGACCAAGGGCCCATCGGTC</p></td><td></td><td></td></tr><tr><td></td><td><p>TTCCCCCTGGCACCCTCCTCCAAGAGCACCTC</p></td><td></td><td></td></tr><tr><td></td><td><p>TGGGGCACAGCGGCCCTGGGCTGCCTGGTC</p></td><td></td><td></td></tr><tr><td></td><td><p>AAGGACTACTTCCCCGAACCGGTGACGGTGTC</p></td><td></td><td></td></tr><tr><td></td><td><p>GTGGAACTCAGGCGCCCTGACCAGCCGGCGTG</p></td><td></td><td></td></tr><tr><td></td><td><p>CACACCTTCCCGGCTGTCCTACAGTCCTCAGG</p></td><td></td><td></td></tr><tr><td></td><td><p>ACTCTACTCCCTCAGCAGCGTGGTGACCGTGC</p></td><td></td><td></td></tr><tr><td></td><td><p>CCTCCAGCAGCTTGGGCACCCAGACCTACATC</p></td><td></td><td></td></tr><tr><td></td><td><p>TGCAACGTGAATCACAAGCCCAGCAACACCAA</p></td><td></td><td></td></tr><tr><td></td><td><p>GGTGGACAAGAAAGTTGAGCCCAAATCTTGTG</p></td><td></td><td></td></tr><tr><td></td><td><p>ACAAAACTCACACATGCCCACCGTGCCCAGCA</p></td><td></td><td></td></tr><tr><td></td><td><p>CCTGAACTCCTGGGGGGACCGTCAGTCTTCCT</p></td><td></td><td></td></tr><tr><td></td><td><p>CTTCCCCCCAAAACCCAAGGACACCCTCATGA</p></td><td></td><td></td></tr><tr><td></td><td><p>TCTCCCGGACCCCTGAGGTCACATGCGTGGTG</p></td><td></td><td></td></tr><tr><td></td><td><p>GTGGACGTGAGCCACGAAGACCCTGAGGTCA</p></td><td></td><td></td></tr><tr><td></td><td><p>AGTTCAACTGGTACGTGGACGGCGTGGAGGT</p></td><td></td><td></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>GCATAATGCCAAGACAAAGCCGCGGGAGGAG</p></td><td></td><td></td></tr><tr><td></td><td><p>CAGTACAACAGCACGTACCGTGTGGTCAGCGT</p></td><td></td><td></td></tr>
-٣٩٨-
<tr><td><p>DIQMTQSPSSLSSASVGDRVTITCKASQNVGNNIA</p><p>WYQQKPGKAPKLLIYYASNRYTGVPSRFSGSGY</p><p>GTDFTLTISSLQPEDFATYYCQRLYNSPFTFGGG</p><p>TKVEIK</p></td><td><p dir="rtl">amino order</p><p dir="rtl">ACID for a variable region A line (.</p></td><td><p>24</p></td></tr><tr><td><p>DIQMTQSPSSLSSASVGDRVTITCKASQNVGNNIA</p></td><td><p dir="rtl">amino order</p></td><td><p>25</p></td></tr><tr><td><p>WYQQKPGKAPKLLIYYASNRYTGVPSRFSGSGY</p></td><td><p dir="rtl">acid</p></td><td></td></tr><tr><td><p>GTDFTLTISSLQPEDFATYYCQRLYNSPFTFGGG</p></td><td><p dir="rtl">hu75</p></td><td></td></tr><tr><td><p>TKVEIKRTVAAPSVFIFFPSDEQLKSGTASVVCLL</p></td><td><p dir="rtl">CDRs (CDRs)</p></td><td></td></tr><tr><td><p>NNFYPREAKVQWKVDNALQSGNSQESVTEQDS</p></td><td><p dir="rtl">Line(.</p></td><td></td></tr><tr><td><p>KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS</p></td><td><p dir="rtl">Your logic is constant.</p></td><td></td></tr><tr><td><p>SPVTKSFNRGEC</p></td><td><p dir="rtl">human kappa</p></td><td></td></tr>
٤٠٦٩
-٣٩٩-
<tr><td><p>GACATCCAGATGACCCAGTCTCCATCCTCCCCT</p><p>GTCTGCATCTGTAGGAGACAGAGTCACCATCA</p><p>CTTGCAAGGCCAGTCAGAATGTGGTAATAAT</p><p>ATAGCCTGGTATCAGCAGAAACCAGGGAAAGC</p><p>CCCTAAGCTCCTGATCTATTATGCATCTAACCG</p><p>GTACACTGGGGTCCCATCAAGGGTTCAGTGGCA</p><p>GTGGATATGGGACAGATTTCACTCTCACCATC</p><p>AGCAGTCTGCAACCTGAAGATTTTGCAACTTAC</p><p>TACTGTCACGTCTTTACAATTCTCCATTCACG</p><p>TTCGGCGGAGGGACCAAGGTGGAGATCAAAC</p><p>GGACCGTGGCCGCTCCTTCCGTGTTCATCTTC</p><p>CCCCCTTCCGACGAGCAGCTGAAGTCTGGCAC</p><p>CGCCTCTGTGGTGTGTCTGCTGAACAACTTCT</p><p>ACCCCCGGGAGGCCAAGGTGCAGTGGAAGGT</p><p>GGACAACGCTCTGCAGTCCGGCAACTCCCAG</p><p>GAGTCTGTGACCGAGCAGGACTCCAAGGACA</p><p>GCACCTACTCCCTGTCCTCTACCCTGACCCTG</p><p>TCCAAGGCCGACTACGAGAAGCACAAGGTGTA</p><p>CGCCTGTGAGGTGACCCACCAGGGCCTGTCC</p><p>TCTCCTGTGACCAAGTCCTTCAACCGGGGCGA</p><p>GTGC</p></td><td><p dir="rtl">Translation: GFV</p><p>nucleotide</p><p dir="rtl">Your series</p><p>hu75</p></td><td><p>26</p></td></tr>
The human anti-Notch antibodies, hu28 and hu75, and the human-human anti-Notch antibodies, ch28 and ch75, are related to a different strain of different species, including HA The following is in Table 8. Damage to the substance associated with a drug Antibody according to the methods of producing the antibody.
٤٠٦٩
-٤٠٠-
Table 8: ADCs against Notch
<tr><td><p dir="rtl">Corresponding ADC label</p></td><td><p dir="rtl">Connection number - for ADC connector</p></td></tr><tr><td><p>hu28-vc0101</p></td><td><p>Notch-28-v1010-hG1-(C)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>hu28-vc6780</p></td><td><p>Notch-28-v1010-hG1-(C)_mcValCitPABC-</p><p>#112</p></td></tr><tr><td><p>hu75-vc0101</p></td><td><p>Notch-75-v1913-hG1-(C)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>hu75-vc6780</p></td><td><p>Notch-75-v1913-hG1-(C)_mcValCitPABC-</p><p>#112</p></td></tr><tr><td><p>ch28-vc0101</p></td><td><p>Notch-28-cG1-(C)_mcV alCitPABC-#54</p></td></tr><tr><td><p>ch28-vc6780</p></td><td><p>Notch-28-cG1-(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>ch28-mc0101</p></td><td><p>Notch-28-cG1-(C)_mc-#54</p></td></tr><tr><td><p>ch28-mc0131</p></td><td><p>Notch-28-cG1-(C)_mc-0#118</p></td></tr><tr><td><p>ch28-mc3377</p></td><td><p>Notch-28-cG1-(C)_mc-#115</p></td></tr><tr><td><p>ch28-mc8261</p></td><td><p>Notch-28-cG1-(C)_mc-#69</p></td></tr><tr><td><p>ch28-MalPeg6C2-0131</p></td><td><p>Notch-28-cG1-(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>ch28-MalPeg6C2-8261</p></td><td><p>Notch-28-cG1-(C)_MalPeg6C2-#69</p></td></tr><tr><td><p>ch28-me0131</p></td><td><p>Notch-28-cG1-(C)_me-0#118</p></td></tr>
٤٠٦٩
-٤٠١-
<tr><td><p>ch28-m(H2O)c-0131</p></td><td><p>Notch-28-cG1-(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>ch75-vc0101</p></td><td><p>Notch-75-cG1-(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>ch75-vc6780</p></td><td><p>Notch-75-cG1-(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>ch75-mc0131</p></td><td><p>Notch-75-cG1-(C)_mc-0#118</p></td></tr><tr><td><p>ch75-mc3377</p></td><td><p>Notch-75-cG1-(C)_mc-#115</p></td></tr><tr><td><p>ch75-MalPegC2-0131</p></td><td><p>Notch-75-cG1-(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>ch75-MalPeg6C2-8261</p></td><td><p>Notch-75-cG1-(C)_MalPeg6C2-#69</p></td></tr><tr><td><p>ch75-me0131</p></td><td><p>Notch-75-cG1-(C)_me-0#118</p></td></tr><tr><td><p>ch75-m(H2O)c-0131</p></td><td><p>Notch-75-cG1-(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>huNeg8.8-vc0101</p></td><td><p>huNeg8.8-(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>huNeg8.8-vc6780</p></td><td><p>huNeg8.8-(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>huNeg8.8-mc0131</p></td><td><p>huNeg8.8-(C)_mc-0#118</p></td></tr><tr><td><p>huNeg8.8-mc3377</p></td><td><p>huNeg8.8-(C)_mc-#115</p></td></tr><tr><td><p>huNeg8.8-me0131</p></td><td><p>huNeg8.8-(C)_me-0#118</p></td></tr><tr><td><p>huNeg8.8-MalPeg6C2-</p><p>8261</p></td><td><p>huNeg8.8-(C)_MalPeg6C2-#69</p></td></tr><tr><td><p>ch2H6-mc8261</p></td><td><p>ch2H6-(C)_mc-#69</p></td></tr>
In vitro cytotoxicity tests of ADCs against Notch
٤٠٦٩
-٤٠٢-
Anti-Notch ADCs are evaluated on 1) endogenous Notch protein expressing cell lines: HCC2429 (human lung cancer), OVCAR3 Ovarian carcinoma (ovarian carcinoma) and 468-MDA-MB (breast carcinoma), 2) modified cell lines that express Notch protein in a different way: -MDA -MB 468/hNotch and U2OS/hNotch, and 3) Negative offset cell line (SW900) using indicator
Cell lines were grown at MTS 5 MTS (Promega, Madison, WI).
Anti-Notch ADCs are found in the human body, hu28 and hu75, and test There are also anti-Notch antibodies in the human hybrids - GGR, ch28 and ch75, which are paired with linker homologs for a different gene. For specificity of ADCs against Notch, untargeted adducts (huNeg8.8-ADCd ADCs or ch2H6-ADCs) 10 were also tested on the cell lines. Each farm is being evaluated by the European Union. The IC50 value was evaded by someone who changed their logic and presented the counterfeit with a weapon.
Milliliters. The drug antibody ratio (DAR) is also available.
Table 9 shows the amount of IC50 (Nagar Ab/ml) for non-Notch ADC treatments The HCC2429 and MDA-MB-468/hNotch cell lines showed 15 reaction times, and the data showed that ADCs against Notch are human-like - Dysfunctional cell lines that become active and cause cell death include cancer cell lines that express and exhibit abnormalities: MDA-MB-468/hNotch, HCC2429 Notch, OVCAR3, MDA-MB-468/hNotch, and U2OS/hNotch, which are not the SW900-negative adjuvant cell line. Show Notch. Comparable, unused ADCs either lose the high potency (LP) and thus generate a low IC50 for less than 20%, or are less active at the highest doses tested s vs. Notch, IC50 values are equal to or greater than the IC50 values of most comparable ADCs. It is not high in the laboratory and is referred to as LP.
Table 9: IC50 values (nanograms of Ab/ml) of ADCs against human-associated Notch
<tr><td><p>SEM ± (milliliter/nanogar) IC50</p></td><td><p>DA</p></td><td><p>ADC</p></td></tr>
٤٠٦٩
-٤٠٣-
<tr><td><p>SW9</p><p>00</p></td><td><p>U2OS/</p><p>hNotc h</p></td><td colspan="2"><p>MDA-</p><p>MB-468/</p><p>hNotch</p></td><td><p>MDA-</p><p>MB-</p><p>468</p></td><td><p>OVC</p><p>AR3</p></td><td colspan="2"><p>HCC2429</p></td><td><p>R</p></td><td></td></tr><tr><td><p>LP</p></td><td><p>1330</p></td><td><p>3</p></td><td><p>3.2</p></td><td><p>6545</p></td><td><p>306</p></td><td><p>294 0</p></td><td><p>473</p></td><td><p>3.</p><p>9</p></td><td><p>hu28-</p><p>vc0101</p></td></tr><tr><td><p>LP</p></td><td><p>523</p></td><td><p>36</p></td><td><p>37</p></td><td><p>7001</p></td><td><p>515</p></td><td><p>329</p><p>5</p></td><td><p>611</p></td><td><p>3.</p><p>8</p></td><td><p>hu75-</p><p>vc0101</p></td></tr><tr><td><p>233</p><p>79</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>512</p><p>2</p></td><td><p>LP</p></td><td><p>3770</p></td><td><p>239</p><p>78</p></td><td><p>184</p><p>17</p></td><td><p>3.</p><p>7</p></td><td><p>huNeg8.8-</p><p>vc0101</p></td></tr><tr><td><p>LP</p></td><td><p>LP</p></td><td><p>3</p></td><td><p>1.3</p></td><td><p>LP</p></td><td><p>17</p></td><td><p>205 0</p></td><td><p>148</p></td><td><p>3.</p><p>9</p></td><td><p>hu28-</p><p>vc6780</p></td></tr><tr><td><p>LP</p></td><td><p>LP</p></td><td><p>25</p></td><td><p>26</p></td><td><p>LP</p></td><td><p>254</p></td><td><p>630</p></td><td><p>214</p></td><td><p>4.</p><p>2</p></td><td><p>hu75-</p><p>vc6780</p></td></tr><tr><td><p>LP</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>9238</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>4.</p><p>2</p></td><td><p>huNeg8.8-</p><p>vc6780</p></td></tr>
Table 10 shows the IC50 value (nanograms Ab/milliliter) of a non-Notch ADC processor.
The human hybrid - ger,. For experiments with 2-4 bad RTs, the IC50 value average is taken from a standard sampling line from the mean (SEM). Data showed that ADCs against human Notch hybrids - stem, link - are active and cause cell death and cancer cell lines to appear and appear in many ways OVCAR3, HCC2429, MDA-MB-468, MDA-MB- Notch U2OS/hNotch, 468/hNotch. Comparable ADCs that are not yet unheard of will often follow the LP and therefore IC50 values will inevitably be generated, or the activity of a lower country will be lost At the highest doses
٤٠٦٩
-٤٠٤-
The hidden one. Low-Notch ADCs are considered to be low-notch, IC50, or earlier or earlier than IC50. Comparable ADCs are not very high in standard. It is referred to as LP.
Table 10: IC50 value (N=Ab/ml) of ADCs against Human-derived Notch, (nd = undated).
<tr><td colspan="5"><p>SEM ± (milliliter/nanogar) IC50</p></td><td rowspan="2"><p>DA</p><p>R</p></td><td rowspan="2"><p>ADC</p></td></tr><tr><td><p>U2O S/</p><p>hNotc h</p></td><td><p>MDA-</p><p>MB-</p><p>468/</p><p>hNotch</p></td><td><p>MDA-</p><p>MB-468</p></td><td><p>OVCA</p><p>R3</p></td><td><p>HCC242</p><p>9</p></td></tr><tr><td><p>nd</p></td><td><p>nd</p></td><td><p>±12147</p><p>4806.4</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>3.7</p></td><td><p>ch28-mc8261</p></td></tr><tr><td><p>nd</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>4.1</p></td><td><p>ch2H6-mc8261</p></td></tr><tr><td><p>nd</p></td><td><p>nd</p></td><td><p>35.5±83</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>4.3</p></td><td><p>ch28-</p><p>MalPeg6C2-8261</p></td></tr><tr><td><p>nd</p></td><td><p>nd</p></td><td><p>±4255</p><p>2375</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>3.8</p></td><td><p>ch75-</p><p>MalPeg6C2-8261</p></td></tr><tr><td><p>nd</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>4.1</p></td><td><p>huNeg8.8-</p><p>MalPeg6C2-8261</p></td></tr><tr><td><p>±3</p><p>0.5</p></td><td><p>nd</p></td><td><p>18.5±35</p></td><td><p>1.0±6</p></td><td><p>±251</p><p>77.5</p></td><td><p>3.4</p></td><td><p>ch28-mc0131</p></td></tr><tr><td><p>19</p></td><td><p>nd</p></td><td><p>±8202</p></td><td><p>289</p></td><td><p>±671</p></td><td><p>3.3</p></td><td><p>ch75-mc0131</p></td></tr>
٤٠٦٩
-٤٠٥-
<tr><td></td><td></td><td><p>2773.0</p></td><td></td><td><p>406.5</p></td><td></td><td></td></tr><tr><td><p>LP</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>nd</p></td><td><p>3.9</p></td><td><p>huNeg8.8-</p><p>mc0131</p></td></tr><tr><td><p>±3</p><p>1.15</p></td><td><p>nd</p></td><td><p>14.0±24</p></td><td><p>2.0±8</p></td><td><p>30</p></td><td><p>3.9</p></td><td><p>ch28-me0131</p></td></tr><tr><td><p>nd</p></td><td><p>nd</p></td><td><p>259</p></td><td><p>nd</p></td><td><p>nd</p></td><td><p>3.5</p></td><td><p>ch75-me0131</p></td></tr><tr><td><p>LP</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>nd</p></td><td><p>3.7</p></td><td><p>huNeg8.8-</p><p>me0131</p></td></tr><tr><td><p>±3</p><p>0.5</p></td><td><p>nd</p></td><td><p>11.3±27</p></td><td><p>±14</p><p>5.5</p></td><td><p>LP</p></td><td><p>3.7</p></td><td><p>ch28-mc3377</p></td></tr><tr><td><p>nd</p></td><td><p>nd</p></td><td><p>560</p></td><td><p>nd</p></td><td><p>nd</p></td><td><p>3.7</p></td><td><p>ch75-mc3377</p></td></tr><tr><td><p>LP</p></td><td><p>nd</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>nd</p></td><td><p>3.6</p></td><td><p>huNeg8.8-</p><p>mc3377</p></td></tr><tr><td><p>±3</p><p>0.85</p></td><td><p>nd</p></td><td><p>1.0±10</p></td><td><p>±10</p><p>2.0</p></td><td><p>LP</p></td><td><p>4.1</p></td><td><p>ch28-</p><p>MalPeg6C2-0131</p></td></tr><tr><td><p>±95</p><p>18.2</p></td><td><p>0.5±4</p></td><td><p>±5443</p><p>2630.9</p></td><td><p>635</p></td><td><p>±3230</p><p>1116.5</p></td><td><p>3.8</p></td><td><p>ch28-vc0101</p></td></tr><tr><td><p>LP</p></td><td><p>4.0±24</p></td><td><p>±4064</p><p>1793.9</p></td><td><p>LP</p></td><td><p>±2112</p><p>826.0</p></td><td><p>2.7</p></td><td><p>ch75-vc0101</p></td></tr><tr><td><p>LP</p></td><td><p>8833</p></td><td><p>±4523</p><p>2789.5</p></td><td><p>LP</p></td><td><p>15341</p></td><td><p>3.7</p></td><td><p>huNeg8.8-</p><p>vc0101</p></td></tr>
٤٠٦٩
-٤٠٦-
<tr><td><p>LP</p></td><td><p>0.5±3</p></td><td><p>±4407</p><p>2128.2</p></td><td><p>±90</p><p>48.5</p></td><td><p>±324</p><p>78.9</p></td><td><p>4.1</p></td><td><p>ch28-vc6780</p></td></tr><tr><td><p>LP</p></td><td><p>3.5±21</p></td><td><p>±6873</p><p>4230.0</p></td><td><p>922</p></td><td><p>±1004</p><p>177.0</p></td><td><p>2.8</p></td><td><p>ch75-vc6780</p></td></tr><tr><td><p>LP</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>LP</p></td><td><p>4.1</p></td><td><p>huNeg8.8-</p><p>vc6780</p></td></tr>
Nama, c Intrusive patch for human body ADCs against Notch
Antibodies against Notch that are similar to the human trait, hu28 and hu75, and antibodies against the human hybrid Notch, ch28 and ch75, bind antigens to a different antigen and test for the growth of an foreign patch of the virus Non-small cell lung culture (NSCLC) (37622A1), 5 lung cancer HCC2429, mammary cancer 468-MDA-MB and stomach cancer N87. It is given to take the first dose of the day, as described below. The tumor is measured at least once a week, and its measurement is based on the formula: Size of the tumor (mm3) = 0.5 × (width of the tumor2)(length of the tumor). Mean tumor size (±SEM) for each treatment group including a maximum of 10 countries: 10 Yuan and 10 countries
The lowest is 6 yuan.
10 A. Intrusive paper 37622A1 NSCLC
The effect of ADCs against Notch on immunocompromised tissues is the growth of invasive skin tumors in the body. The tumors are excised from a portion of 37622A1 NSCLC tumors excised from the body (Asterand). Introduced skin mite derived from patient 37622A1 NSCLC passes from body to cell from 15 immunocompromised (Nu/Nu) females. When tumors reach a size of 150 to 300 mm3, they progress to increase the similarity of tumor size between different treatment groups. Growth, C 37622A1 NSCLC dose intravenous 4 ml per 4 days (Q4dx4) of transport media, anti-Notch ADCs, human-derived huNeg-8.8 ADCs platin at available doses in Table 11.
٤٠٦٩
-٤٠٧-
Cisplatin is an anti-cancer agent based on platinum. It is used in the treatment of cancer and is considered a treatment and measurement list. DNA cross-linked with cisplatin causes programmed cell death and replication of cell growth. The data showed that the Anti-Notch ADCs hu28-vc0101, hu28-vc6780, hu75-vc0101 and hu75-vc6780 inhibited the growth of the intrusive Notch 37622A1.
<p dir="rtl">5 NSCLC. In addition, the data show that anti-Notch ADCs inhibit tumor growth by increasing the density of excavated huNeg8.8-ADCs. Furthermore, the data show that anti-Notch ADCs inhibit tumor growth to a greater effect than cisplatin, which indicates a greater efficacy than the existing combination drug The measurement based on .platinum</p>
Table 11: High ADCs against Notch 37622A1 NSCLC intrusion
<tr><td></td><td colspan="7"><p dir="rtl">Dekheila Paper 37622A1 NSCLC, Waist Size (3 mm ± SEM)</p></td><td></td></tr><tr><td><p>Cispl</p><p>atin</p></td><td><p>huNeg</p><p>-8.8-</p><p>vc6780</p></td><td><p>huNeg</p><p>-8.8-</p><p>vc0101</p></td><td><p>hu75-</p><p>vc6780</p></td><td><p>hu75-</p><p>vc010</p><p>1</p></td><td><p>hu28-</p><p>vc678</p><p>0</p></td><td><p>hu28-</p><p>vc010</p><p>1</p></td><td><p>PBS</p></td><td></td></tr><tr><td><p>5</p></td><td><p>10</p></td><td><p>3</p></td><td><p>10</p></td><td><p>3</p></td><td><p>10</p></td><td><p>3</p></td><td><p dir="rtl">p t</p></td><td><p dir="rtl">Dosage</p><p dir="rtl">mjfjfjfjfjf/jjm</p></td></tr><tr><td><p>185</p></td><td><p>182</p></td><td><p>184</p></td><td><p>183</p></td><td><p>185</p></td><td><p>182</p></td><td><p>186</p></td><td><p>187</p></td><td><p dir="rtl">Day 1</p></td></tr><tr><td><p>11±</p></td><td><p>17±</p></td><td><p>18±</p></td><td><p>17±</p></td><td><p>17±</p></td><td><p>16±</p></td><td><p>13±</p></td><td><p>10±</p></td><td></td></tr><tr><td><p>226</p></td><td><p>226</p></td><td><p>225</p></td><td><p>205</p></td><td><p>200</p></td><td><p>176</p></td><td><p>202</p></td><td><p>227</p></td><td><p dir="rtl">Day 4</p></td></tr><tr><td><p>15±</p></td><td><p>26±</p></td><td><p>17±</p></td><td><p>23±</p></td><td><p>16±</p></td><td><p>13±</p></td><td><p>16±</p></td><td><p>19±</p></td><td></td></tr>
٤٠٦٩
-٤٠٨-
<tr><td><p>280</p><p>29±</p></td><td><p>265</p><p>28±</p></td><td><p>274</p><p>18±</p></td><td><p>195</p><p>22±</p></td><td><p>227</p><p>16±</p></td><td><p>176</p><p>19±</p></td><td><p>202</p><p>15±</p></td><td><p>279</p><p>24±</p></td><td><p dir="rtl">Day 7</p></td></tr><tr><td><p>301</p></td><td><p>246</p></td><td><p>309</p></td><td><p>147</p></td><td><p>175</p></td><td><p>122</p></td><td><p>130</p></td><td><p>371</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">11</p></td></tr><tr><td><p>34±</p></td><td><p>30±</p></td><td><p>26±</p></td><td><p>23±</p></td><td><p>20±</p></td><td><p>10±</p></td><td><p>11±</p></td><td><p>42±</p></td><td></td></tr><tr><td><p>345</p></td><td><p>277</p></td><td><p>303</p></td><td><p>118</p></td><td><p>156</p></td><td><p>95</p></td><td><p>119</p></td><td><p>419</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">14</p></td></tr><tr><td><p>47±</p></td><td><p>41±</p></td><td><p>26±</p></td><td><p>18±</p></td><td><p>19±</p></td><td><p>7±</p></td><td><p>11±</p></td><td><p>49±</p></td><td></td></tr><tr><td><p>309</p></td><td><p>219</p></td><td><p>298</p></td><td><p>93</p></td><td><p>112</p></td><td><p>65</p></td><td><p>71</p></td><td><p>516</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">18</p></td></tr><tr><td><p>37±</p></td><td><p>31±</p></td><td><p>28±</p></td><td><p>14±</p></td><td><p>16±</p></td><td><p>6±</p></td><td><p>6±</p></td><td><p>63±</p></td><td></td></tr><tr><td><p>373</p></td><td><p>218</p></td><td><p>320</p></td><td><p>98</p></td><td><p>122</p></td><td><p>56</p></td><td><p>55</p></td><td><p>562</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">21</p></td></tr><tr><td><p>50±</p></td><td><p>42±</p></td><td><p>41±</p></td><td><p>20±</p></td><td><p>27±</p></td><td><p>6±</p></td><td><p>6±</p></td><td><p>65±</p></td><td></td></tr><tr><td><p>401</p></td><td><p>264</p></td><td><p>315</p></td><td><p>93</p></td><td><p>137</p></td><td><p>51</p></td><td><p>49</p></td><td><p>610</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">25</p></td></tr><tr><td><p>58±</p></td><td><p>52±</p></td><td><p>52±</p></td><td><p>24±</p></td><td><p>33±</p></td><td><p>6±</p></td><td><p>6±</p></td><td><p>78±</p></td><td></td></tr><tr><td><p>446</p></td><td><p>246</p></td><td><p>358</p></td><td><p>99</p></td><td><p>161</p></td><td><p>51</p></td><td><p>41</p></td><td><p>624</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">28</p></td></tr><tr><td><p>64±</p></td><td><p>51±</p></td><td><p>61±</p></td><td><p>26±</p></td><td><p>53±</p></td><td><p>8±</p></td><td><p>7±</p></td><td><p>94±</p></td><td></td></tr><tr><td><p>482</p></td><td><p>332</p></td><td><p>398</p></td><td><p>165</p></td><td><p>175</p></td><td><p>72</p></td><td><p>42</p></td><td><p>817</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">32</p></td></tr><tr><td><p>62±</p></td><td><p>77±</p></td><td><p>64±</p></td><td><p>45±</p></td><td><p>52±</p></td><td><p>15±</p></td><td><p>13±</p></td><td><p>99±</p></td><td></td></tr><tr><td><p>587</p></td><td><p>384</p></td><td><p>487</p></td><td><p>229</p></td><td><p>271</p></td><td><p>92</p></td><td><p>42</p></td><td><p>900</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">35</p></td></tr><tr><td><p>80±</p></td><td><p>94±</p></td><td><p>79±</p></td><td><p>59±</p></td><td><p>79±</p></td><td><p>21±</p></td><td><p>11±</p></td><td><p>±</p><p>104</p></td><td></td></tr>
٤٠٦٩
-٤٠٩-
<tr><td><p>591</p></td><td><p>431</p></td><td><p>569</p></td><td><p>294</p></td><td><p>319</p></td><td><p>120</p></td><td><p>62</p></td><td><p>960</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>39</p></td></tr><tr><td><p>83±</p></td><td><p>114±</p></td><td><p>102±</p></td><td><p>78±</p></td><td><p>103±</p></td><td><p>31±</p></td><td><p>26±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>117</p></td><td></td></tr><tr><td><p>612</p></td><td><p>495</p></td><td><p>590</p></td><td><p>318</p></td><td><p>357</p></td><td><p>151</p></td><td><p>75</p></td><td><p>931</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>42</p></td></tr><tr><td><p>92±</p></td><td><p>128±</p></td><td><p>101±</p></td><td><p>71±</p></td><td><p>113±</p></td><td><p>37±</p></td><td><p>34±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>108</p></td><td></td></tr><tr><td><p>723</p></td><td><p>610</p></td><td><p>743</p></td><td><p>412</p></td><td><p>431</p></td><td><p>172</p></td><td><p>92</p></td><td><p>103</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>7</p></td><td><p>46</p></td></tr><tr><td><p>119±</p></td><td><p>165±</p></td><td><p>133±</p></td><td><p>106±</p></td><td><p>137±</p></td><td><p>47±</p></td><td><p>44±</p></td><td><p>102</p></td><td></td></tr><tr><td><p>853</p></td><td><p>718</p></td><td><p>810</p></td><td><p>521</p></td><td><p>519</p></td><td><p>248</p></td><td><p>120</p></td><td><p>111</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>9</p></td><td><p>49</p></td></tr><tr><td><p>139±</p></td><td><p>202±</p></td><td><p>121±</p></td><td><p>132±</p></td><td><p>135±</p></td><td><p>62±</p></td><td><p>63±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>120</p></td><td></td></tr><tr><td><p>970</p></td><td><p>848</p></td><td><p>989</p></td><td><p>629</p></td><td><p>678</p></td><td><p>339</p></td><td><p>144</p></td><td><p>134</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>5</p></td><td><p>53</p></td></tr><tr><td><p>193±</p></td><td><p>251±</p></td><td><p>146±</p></td><td><p>162±</p></td><td><p>195±</p></td><td><p>93±</p></td><td><p>67±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>158</p></td><td></td></tr><tr><td><p>1215</p></td><td><p>776</p></td><td><p>1149</p></td><td><p>808</p></td><td><p>818</p></td><td><p>376</p></td><td><p>126</p></td><td><p>148</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>5</p></td><td><p>56</p></td></tr><tr><td><p>231±</p></td><td><p>184±</p></td><td><p>191±</p></td><td><p>196±</p></td><td><p>251±</p></td><td><p>100±</p></td><td><p>51±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>185</p></td><td></td></tr>
٤٠٦٩
-٤١٠-
<tr><td><p>1428</p><p>273±</p></td><td><p>964</p><p>232±</p></td><td><p>1287</p><p>194±</p></td><td><p>917</p><p>209±</p></td><td><p>710</p><p>162±</p></td><td><p>503</p><p>138±</p></td><td><p>180</p><p>85±</p></td><td><p>169</p><p>1</p><p>±</p><p>220</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">60</p></td></tr><tr><td></td><td><p>1097</p><p>254±</p></td><td><p>1503</p><p>227±</p></td><td><p>917</p><p>147±</p></td><td><p>824</p><p>191±</p></td><td><p>604</p><p>160±</p></td><td><p>223</p><p>111±</p></td><td><p>173</p><p>6</p><p>±</p><p>193</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">63</p></td></tr><tr><td></td><td><p>1167</p><p>260±</p></td><td><p>1600</p><p>251±</p></td><td><p>1116</p><p>173±</p></td><td><p>938</p><p>202±</p></td><td><p>888</p><p>272±</p></td><td><p>296</p><p>152±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">67</p></td></tr><tr><td></td><td><p>1352</p><p>305±</p></td><td></td><td><p>1181</p><p>203±</p></td><td><p>953</p><p>209±</p></td><td><p>773</p><p>235±</p></td><td><p>312</p><p>162±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">70</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>881</p><p>264±</p></td><td><p>331</p><p>160±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">74</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>1029</p><p>325±</p></td><td><p>422</p><p>210±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">77</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>510</p><p>248±</p></td><td><p>-</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">81</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>622</p><p>322±</p></td><td><p>-</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">84</p></td></tr>
٤٠٦٩
-٤١١-
<p dir="rtl">B. Intrusive lung HCC2429</p>
In a similar way, experiments are being conducted with the lung cancer cell line HCC2429 described above. To generate exotic skins, add more skin to each number of immunocompromised females (610 × 3 .5 (Nu/Nu HCC2429 Cells 50M: BD Biosciences) Matrigel). When the tumor reaches a size of 200 to 400 mm3, the tumor will advance to the same extent as that of the tumor in your group. The dysfunctional family. HCC2429, the Urban 4 PBS, not a notation, and Huneg-8.8 ADCS Data showed that ADCs hu28-vc0101 against Notch, hu28-vc6780, hu28-vc0101, and hu75-10 vc6780 inhibited the growth of lung intestinal plaques HCC2429 in a manner dependent on In a dose. Addition to lf,lf,
Data show that anti-Notch ADCs inhibit tumor growth significantly at a dose of 1 or 3 mg/ml of dose-administered huNeg8.8 ADCs FD Notch Male and Wasla - Lam Mechokhet
vc0101 and at doses of 3 and 10 mg/mg ADCs against the Notch Male Connector - for the connection
vc6780. Furthermore, the data show that a dose of 3 mg/g of hu28-vc0101 has 15 higher effects than a dose of 10 mg/g of hu28-vc6780.
Table 12: High ADCs against Notch-vc0101, a lung pathogen HCC2429
<tr><td colspan="4"><p dir="rtl">Lung intrusion paper HCC2429, size (3 mm ± SEM)</p></td><td></td></tr><tr><td><p>huNeg-8.8-</p><p>vc0101</p></td><td><p>hu75-vc0101</p></td><td><p>hu28-vc0101</p></td><td><p>PBS</p></td><td></td></tr>
٤٠٦٩
-٤١٢-
<tr><td><p>0.3</p></td><td><p>1</p></td><td><p>3</p></td><td><p>0.3</p></td><td><p>1</p></td><td><p>3</p></td><td><p>0.3</p></td><td><p>1</p></td><td><p>3</p></td><td><p>0</p></td><td><p dir="rtl">Dosage</p><p dir="rtl">mjfjfjfjfjfjfj</p></td></tr><tr><td><p>24</p></td><td><p>245</p></td><td><p>244</p></td><td><p>247</p></td><td><p>246</p></td><td><p>245</p></td><td><p>246</p></td><td><p>246</p></td><td><p>245</p></td><td><p>245</p></td><td><p dir="rtl">Day 1</p></td></tr><tr><td><p>6</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td><p>33±</p></td><td><p>30±</p></td><td><p>29±</p></td><td><p>23±</p></td><td><p>28±</p></td><td><p>30±</p></td><td><p>26±</p></td><td><p>23±</p></td><td><p>24±</p></td><td></td></tr><tr><td><p>±</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>27</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>51</p></td><td><p>519</p></td><td><p>482</p></td><td><p>524</p></td><td><p>548</p></td><td><p>498</p></td><td><p>528</p></td><td><p>532</p></td><td><p>548</p></td><td><p>529</p></td><td><p dir="rtl">Day 1</p></td></tr><tr><td><p>4</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td><p>72±</p></td><td><p>59±</p></td><td><p>66±</p></td><td><p>37±</p></td><td><p>39±</p></td><td><p>50±</p></td><td><p>36±</p></td><td><p>52±</p></td><td><p>52±</p></td><td></td></tr><tr><td><p>±</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>50</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>72</p></td><td><p>756</p></td><td><p>695</p></td><td><p>713</p></td><td><p>753</p></td><td><p>498</p></td><td><p>733</p></td><td><p>757</p></td><td><p>606</p></td><td><p>742</p></td><td><p dir="rtl">Day 3</p></td></tr><tr><td><p>4</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td><p>97±</p></td><td><p>91±</p></td><td><p>74±</p></td><td><p>93±</p></td><td><p>44±</p></td><td><p>78±</p></td><td><p>68±</p></td><td><p>78±</p></td><td><p>73±</p></td><td></td></tr><tr><td><p>±</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>73</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>12</p></td><td><p>114</p></td><td><p>107</p></td><td><p>1078</p></td><td><p>109</p></td><td><p>469</p></td><td><p>1112</p></td><td><p>1095</p></td><td><p>723</p></td><td><p>120</p></td><td><p dir="rtl">Day 6</p></td></tr><tr><td><p>07</p></td><td><p>4</p></td><td><p>5</p></td><td></td><td><p>6</p></td><td></td><td></td><td></td><td></td><td><p>5</p></td><td></td></tr><tr><td></td><td></td><td></td><td><p>74±</p></td><td></td><td><p>70±</p></td><td><p>132±</p></td><td><p>119±</p></td><td><p>101±</p></td><td></td><td></td></tr><tr><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td></tr><tr><td><p>10</p><p>0</p></td><td><p>100</p></td><td><p>132</p></td><td></td><td><p>146</p></td><td></td><td></td><td></td><td></td><td><p>120</p></td><td></td></tr>
٤٠٦٩
-٤١٣-
<tr><td><p>16</p></td><td><p>159</p></td><td><p>140</p></td><td><p>1499</p></td><td><p>142</p></td><td><p>407</p></td><td><p>1617</p></td><td><p>1324</p></td><td><p>696</p></td><td><p>172</p></td><td><p dir="rtl">Day 8</p></td></tr><tr><td><p>83</p></td><td><p>8</p></td><td><p>4</p></td><td><p>115±</p></td><td><p>8</p></td><td><p>71±</p></td><td><p>172±</p></td><td><p>173±</p></td><td><p>100±</p></td><td><p>0</p></td><td></td></tr><tr><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td></tr><tr><td><p>16</p></td><td><p>133</p></td><td><p>183</p></td><td></td><td><p>200</p></td><td></td><td></td><td></td><td></td><td><p>181</p></td><td></td></tr><tr><td><p>5</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>21</p></td><td><p>197</p></td><td><p>173</p></td><td><p>1830</p></td><td><p>161</p></td><td><p>370</p></td><td><p>2027</p></td><td><p>1606</p></td><td><p>620</p></td><td><p>231</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>63</p></td><td><p>4</p></td><td><p>5</p></td><td><p>120±</p></td><td><p>1</p></td><td><p>81±</p></td><td><p>233±</p></td><td><p>250±</p></td><td><p>90±</p></td><td><p>2</p></td><td><p>10</p></td></tr><tr><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td></tr><tr><td><p>26</p><p>0</p></td><td><p>185</p></td><td><p>253</p></td><td></td><td><p>189</p></td><td></td><td></td><td></td><td></td><td><p>197</p></td><td></td></tr><tr><td><p>25</p></td><td><p>267</p></td><td><p>216</p></td><td><p>2408</p></td><td><p>180</p></td><td><p>273</p></td><td><p>2642</p></td><td><p>1717</p></td><td><p>543</p></td><td><p>323</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>89</p></td><td><p>6</p></td><td><p>2</p></td><td><p>226±</p></td><td><p>3</p></td><td><p>69±</p></td><td><p>297±</p></td><td><p>223±</p></td><td><p>92±</p></td><td><p>5</p></td><td><p>13</p></td></tr><tr><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td></tr><tr><td><p>28</p></td><td><p>346</p></td><td><p>376</p></td><td></td><td><p>208</p></td><td></td><td></td><td></td><td></td><td><p>120</p></td><td></td></tr><tr><td><p>7</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>187</p></td><td><p>298</p></td><td></td><td><p>1865</p></td><td><p>512</p></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>1</p></td><td><p>88±</p></td><td></td><td><p>263±</p></td><td><p>111±</p></td><td></td><td><p>15</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>232</p></td><td></td><td></td><td></td><td></td><td></td><td></td></tr>
٤٠٦٩
-٤١٤-
<tr><td></td><td></td><td></td><td></td><td><p>194</p><p>8</p><p>±</p><p>228</p></td><td><p>250</p><p>77±</p></td><td></td><td><p>2228</p><p>333±</p></td><td><p>442</p><p>114±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">17</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>177</p><p>44±</p></td><td></td><td></td><td><p>428</p><p>144±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">20</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>160</p><p>35±</p></td><td></td><td></td><td><p>405</p><p>149±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">23</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>174</p><p>51±</p></td><td></td><td></td><td><p>422</p><p>164±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">27</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>196</p><p>72±</p></td><td></td><td></td><td><p>394</p><p>182±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">30</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>295</p><p>±</p><p>121</p></td><td></td><td></td><td><p>505</p><p>236±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">34</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>433</p><p>±</p><p>179</p></td><td></td><td></td><td><p>606</p><p>283±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">37</p></td></tr>
٤٠٦٩
-٤١٥-
<tr><td></td><td></td><td></td><td></td><td></td><td><p>606</p><p>±</p><p>259</p></td><td></td><td></td><td><p>750</p><p>361±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">41</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>836</p><p>±</p><p>359</p></td><td></td><td></td><td><p>872</p><p>415±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">45</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>732</p><p>±</p><p>350</p></td><td></td><td></td><td><p>558</p><p>303±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">49</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>571</p><p>310±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">52</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>704</p><p>399±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">56</p></td></tr>
Table 13: High ADCs against Notch-vc6780, a lung invader HCC2429.
<tr><td colspan="4"><p dir="rtl">Lung intrusion paper HCC2429, size (3 mm ± SEM)</p></td><td></td></tr><tr><td><p>huNeg-8.8-</p><p>vc6780</p></td><td><p>hu75-vc6780</p></td><td><p>hu28-vc6780</p></td><td><p>PBS</p></td><td></td></tr>
٤٠٦٩
-٤١٦-
<tr><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p dir="rtl">p t</p></td><td><p dir="rtl">Dosage</p><p dir="rtl">mjfjfjfjfjfjfj</p></td></tr><tr><td><p>24</p><p>5</p><p>±</p><p>20</p></td><td><p>244</p><p>26±</p></td><td><p>244</p><p>22±</p></td><td><p>245</p><p>16±</p></td><td><p>246</p><p>30±</p></td><td><p>244</p><p>19±</p></td><td><p>245</p><p>27±</p></td><td><p>245</p><p>24±</p></td><td><p>244</p><p>22±</p></td><td><p>245</p><p>28±</p></td><td><p dir="rtl">Day 1</p></td></tr><tr><td><p>40</p><p>2</p><p>±</p><p>53</p></td><td><p>427</p><p>49±</p></td><td><p>429</p><p>56±</p></td><td><p>418</p><p>34±</p></td><td><p>403</p><p>51±</p></td><td><p>407</p><p>43±</p></td><td><p>400</p><p>66±</p></td><td><p>379</p><p>45±</p></td><td><p>369</p><p>31±</p></td><td><p>398</p><p>50±</p></td><td><p dir="rtl">Day 1</p></td></tr><tr><td><p>65</p><p>5</p><p>±</p><p>97</p></td><td><p>689</p><p>83±</p></td><td><p>619</p><p>62±</p></td><td><p>629</p><p>65±</p></td><td><p>526</p><p>74±</p></td><td><p>339</p><p>36±</p></td><td><p>579</p><p>113±</p></td><td><p>493</p><p>65±</p></td><td><p>318</p><p>31±</p></td><td><p>701</p><p>±</p><p>102</p></td><td><p dir="rtl">Day 3</p></td></tr><tr><td><p>83</p><p>7</p><p>±</p><p>11</p><p>7</p></td><td><p>965</p><p>±</p><p>114</p></td><td><p>808</p><p>±</p><p>101</p></td><td><p>916</p><p>97±</p></td><td><p>615</p><p>98±</p></td><td><p>251</p><p>33±</p></td><td><p>826</p><p>191±</p></td><td><p>609</p><p>82±</p></td><td><p>228</p><p>28±</p></td><td><p>949</p><p>±</p><p>140</p></td><td><p dir="rtl">Day 5</p></td></tr>
٤٠٦٩
-٤١٧-
<tr><td><p>10</p><p>99</p><p>±</p><p>17</p><p>2</p></td><td><p>138 0</p><p>±</p><p>136</p></td><td><p>107</p><p>2</p><p>±</p><p>154</p></td><td><p>1164</p><p>131±</p></td><td><p>615</p><p>±</p><p>115</p></td><td><p>225</p><p>24±</p></td><td><p>1023</p><p>259±</p></td><td><p>638</p><p>86±</p></td><td><p>172</p><p>22±</p></td><td><p>134</p><p>5</p><p>±</p><p>200</p></td><td><p dir="rtl">Day 7</p></td></tr><tr><td><p>17</p></td><td><p>208</p></td><td><p>145</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>204</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>22</p></td><td><p>2</p></td><td><p>2</p></td><td><p>1705</p></td><td><p>717</p></td><td><p>198</p></td><td><p>1439</p></td><td><p>784</p></td><td><p>143</p></td><td><p>5</p></td><td><p>10</p></td></tr><tr><td><p>±</p></td><td><p>±</p></td><td><p>±</p></td><td><p>184±</p></td><td><p>±</p></td><td><p>24±</p></td><td><p>398±</p></td><td><p>115±</p></td><td><p>22±</p></td><td><p>±</p></td><td></td></tr><tr><td><p>36</p></td><td><p>192</p></td><td><p>210</p></td><td></td><td><p>129</p></td><td></td><td></td><td></td><td></td><td><p>356</p></td><td></td></tr><tr><td><p>3</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>15</p></td><td><p>270</p></td><td><p>167</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>86</p></td><td><p>1</p></td><td><p>3</p></td><td><p>2029</p></td><td><p>807</p></td><td><p>166</p></td><td><p>1442</p></td><td><p>883</p></td><td><p>134</p></td><td></td><td><p>12</p></td></tr><tr><td><p>±</p><p>33</p></td><td><p>±</p></td><td><p>±</p></td><td><p>270±</p></td><td><p>±</p><p>130</p></td><td><p>22±</p></td><td><p>487±</p></td><td><p>132±</p></td><td><p>20±</p></td><td></td><td></td></tr><tr><td><p>7</p></td><td><p>228</p></td><td><p>290</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td><p>180</p></td><td></td><td><p>831</p></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td><p>9</p></td><td><p>2294</p></td><td></td><td><p>150</p></td><td></td><td><p>895</p></td><td><p>115</p></td><td></td><td><p>14</p></td></tr><tr><td></td><td></td><td><p>±</p></td><td><p>287±</p></td><td><p>±</p></td><td><p>22±</p></td><td></td><td><p>175±</p></td><td><p>16±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>145</p></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td><p>314</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr>
٤٠٦٩
-٤١٨-
<tr><td></td><td></td><td></td><td></td><td><p>101</p><p>7</p><p>±</p><p>178</p></td><td><p>158</p><p>32±</p></td><td></td><td><p>1105</p><p>253±</p></td><td><p>127</p><p>18±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">17</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>129</p></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>7</p></td><td><p>164</p></td><td></td><td><p>1219</p></td><td><p>149</p></td><td></td><td><p>20</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>±</p></td><td><p>48±</p></td><td></td><td><p>311±</p></td><td><p>27±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>231</p></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>181</p></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>3</p></td><td><p>261</p></td><td></td><td><p>1618</p></td><td><p>206</p></td><td></td><td><p>24</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>±</p></td><td><p>89±</p></td><td></td><td><p>468±</p></td><td><p>60±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>343</p></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>197 0</p></td><td><p>316</p></td><td></td><td></td><td><p>290</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">27</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>±</p><p>462</p></td><td><p>±</p><p>135</p></td><td></td><td></td><td><p>100±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>438</p><p>±</p><p>201</p></td><td></td><td></td><td><p>378</p><p>150±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">31</p></td></tr>
٤٠٦٩
-٤١٩-
<tr><td></td><td></td><td></td><td></td><td></td><td><p>423</p><p>±</p><p>177</p></td><td></td><td></td><td><p>551</p><p>244±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">34</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>504</p><p>±</p><p>203</p></td><td></td><td></td><td><p>718</p><p>332±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">38</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>655</p><p>±</p><p>266</p></td><td></td><td></td><td><p>1011</p><p>504±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">42</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>793</p><p>±</p><p>320</p></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">46</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>901</p><p>±</p><p>351</p></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">49</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>122</p><p>8</p><p>±</p><p>472</p></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">53</p></td></tr>
Also dose: HCC2429, intravenous 4 million every 4 days with PBS,
Anti-Notch ADCs Adam-Gr and HuNeg-8.8 adducts, at a dose of 5 mg/mg
٤٠٦٩
-٤٢٠-
The data showed that anti-Notch ADCs contain non-cleavable junctions (mc), cleavable junctions (vc) and different ligands that inhibit binding In addition to the neck, which is related to the neck, HCC2429, in addition to the neck, explain. Data show that ADCs against huNeg8.8-adcs inhibit tumor growth in a highly significant way
<p dir="rtl">5 Thus, the data demonstrated that the ADCs were affected by the Notch of the human being, the human being, the male and female Notch vc0101 has a higher effect than other ADCs against Notch tested.</p>
<p dir="rtl">C. Breast intrusion 468-MDA-MB</p>
In a similar way, experiments are performed with the breast cancer cell line MDA-MB 468 described above. 468-MDA-MB cells are classified as a basis for breast cancer.
<p dir="rtl">10 Triglyceride syndrome (TNBC) due to lack of expression of an estrogen receptor, a progesterone receptor</p>
(Lehmann, BD, et al, J Clin Invest. 2) and the future of human epidermal growth factor
(2750–2767:(7)121; 2011. To generate inbred foci, transplant bald aphids Outbred SCID females with 10 × 610 cells 468-MDA-MB, 50-stranded: BD Matrigel (Biosciences The mammary fat pad is stubborn when it gets wet Throw the number to 250 to 450.
<p dir="rtl">15 3 mm, the tumor progresses to ensure uniformity of tumor cost in different treatment groups. It takes a lot of time. CFGFCDY 468-MDA-MB CFCFGFCFDF 468-MDA-MB GFCFGFGFFD</p>
<p dir="rtl">4 Megaarts per day (Q4dx4) Transported by human safety notch ADCs, PBS The huNeg-8.8 ADCs are comparable at varying doses in Tables 14 and 15. The data showed that the ADCs hu28-vc0101 were superior to the Notch, hu28-vc6780, and hu75-vc0101.</p>
20 and hu75-vc6780 inhibited the growth of mammary inoculum 468-MDA-MB in a dose-dependent manner.
In addition to, the statement is clear, a notation For - Lamtch Vc0101 and from the 1st, 3 and 10 Majr Link - Lamkhuchet .vc6780
Furthermore, data showed that a 1 mg/mg dose of anti-Notch ADCs -
٤٠٦٩
-٤٢١-
Lamokht vcolo has the effect of high dose 3 mg/mg ADCs against Notch m link - Lamokht vc6780.
Table 14: High ADCs against Notch-vc0101 mammalian pathogen 468-MDA-MB
<tr><td colspan="10"><p dir="rtl">Breast intrusion paper 468-MDA-MB, waist size (3 mm ± SEM)</p></td><td></td></tr><tr><td><p>huNeg</p></td><td colspan="2"><p>-8.8-vc0101</p></td><td colspan="3"><p>hu75-vc0101</p></td><td colspan="3"><p>hu28-vc0101</p></td><td><p>PB</p><p>S</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Dosage</p></td></tr><tr><td><p>0.3</p></td><td><p>1</p></td><td><p>3</p></td><td><p>0.3</p></td><td><p>1</p></td><td><p>3</p></td><td><p>0.3</p></td><td><p>1</p></td><td><p>3</p></td><td><p dir="rtl">p t</p></td><td><p dir="rtl">MAGGAFF/</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Tj</p></td></tr><tr><td><p>344</p></td><td><p>346</p></td><td><p>334</p></td><td><p>348</p></td><td><p>347</p></td><td><p>347</p></td><td><p>336</p></td><td><p>348</p></td><td><p>347</p></td><td><p>343</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>19±</p></td><td><p>16±</p></td><td><p>23±</p></td><td><p>21±</p></td><td><p>22±</p></td><td><p>20±</p></td><td><p>19±</p></td><td><p>22±</p></td><td><p>15±</p></td><td><p>12±</p></td><td><p dir="rtl">p t</p></td></tr><tr><td><p>442</p></td><td><p>447</p></td><td><p>424</p></td><td><p>439</p></td><td><p>410</p></td><td><p>444</p></td><td><p>403</p></td><td><p>439</p></td><td><p>359</p></td><td><p>441</p></td><td><p dir="rtl">Day 4</p></td></tr><tr><td><p>19±</p></td><td><p>32±</p></td><td><p>29±</p></td><td><p>31±</p></td><td><p>32±</p></td><td><p>28±</p></td><td><p>28±</p></td><td><p>21±</p></td><td><p>24±</p></td><td><p>24±</p></td><td></td></tr><tr><td><p>438</p></td><td><p>449</p></td><td><p>411</p></td><td><p>435</p></td><td><p>383</p></td><td><p>338</p></td><td><p>395</p></td><td><p>415</p></td><td><p>326</p></td><td><p>469</p></td><td><p dir="rtl">Day 7</p></td></tr><tr><td><p>23±</p></td><td><p>20±</p></td><td><p>26±</p></td><td><p>27±</p></td><td><p>33±</p></td><td><p>20±</p></td><td><p>38±</p></td><td><p>25±</p></td><td><p>27±</p></td><td><p>32±</p></td><td></td></tr><tr><td><p>496</p></td><td><p>538</p></td><td><p>439</p></td><td><p>504</p></td><td><p>373</p></td><td><p>277</p></td><td><p>412</p></td><td><p>372</p></td><td><p>227</p></td><td><p>495</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>37±</p></td><td><p>23±</p></td><td><p>36±</p></td><td><p>38±</p></td><td><p>33±</p></td><td><p>22±</p></td><td><p>42±</p></td><td><p>34±</p></td><td><p>27±</p></td><td><p>28±</p></td><td><p>11</p></td></tr><tr><td><p>560</p></td><td><p>592</p></td><td><p>445</p></td><td><p>507</p></td><td><p>350</p></td><td><p>181</p></td><td><p>488</p></td><td><p>314</p></td><td><p>147</p></td><td><p>581</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>36±</p></td><td><p>47±</p></td><td><p>29±</p></td><td><p>30±</p></td><td><p>40±</p></td><td><p>19±</p></td><td><p>45±</p></td><td><p>27±</p></td><td><p>20±</p></td><td><p>35±</p></td><td><p>14</p></td></tr>
٤٠٦٩
-٤٢٢-
<tr><td><p>578</p></td><td><p>619</p></td><td><p>479</p></td><td><p>587</p></td><td><p>296</p></td><td><p>90</p></td><td><p>497</p></td><td><p>261</p></td><td><p>77</p></td><td><p>639</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>36±</p></td><td><p>42±</p></td><td><p>42±</p></td><td><p>44±</p></td><td><p>33±</p></td><td><p>12±</p></td><td><p>55±</p></td><td><p>33±</p></td><td><p>10±</p></td><td><p>43±</p></td><td><p>18</p></td></tr><tr><td><p>627</p></td><td><p>676</p></td><td><p>481</p></td><td><p>590</p></td><td><p>260</p></td><td><p>60</p></td><td><p>509</p></td><td><p>219</p></td><td><p>16</p></td><td><p>638</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>30±</p></td><td><p>46±</p></td><td><p>34±</p></td><td><p>55±</p></td><td><p>49±</p></td><td><p>9±</p></td><td><p>60±</p></td><td><p>41±</p></td><td><p>8±</p></td><td><p>46±</p></td><td><p>21</p></td></tr><tr><td><p>671</p></td><td><p>793</p></td><td><p>548</p></td><td><p>652</p></td><td><p>267</p></td><td><p>16</p></td><td><p>590</p></td><td><p>253</p></td><td><p dir="rtl">p t</p></td><td><p>707</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td><p>26</p></td></tr><tr><td><p>56±</p></td><td><p>54±</p></td><td><p>41±</p></td><td><p>64±</p></td><td><p>59±</p></td><td><p>10±</p></td><td><p>66±</p></td><td><p>61±</p></td><td><p dir="rtl">p t</p></td><td><p>41±</p></td><td></td></tr><tr><td><p>669</p></td><td><p>819</p></td><td></td><td><p>675</p></td><td><p>261</p></td><td><p>8</p></td><td></td><td><p>238</p></td><td><p dir="rtl">p t</p></td><td><p>749</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td><p>29</p></td></tr><tr><td><p>37±</p></td><td><p>73±</p></td><td></td><td><p>63±</p></td><td><p>62±</p></td><td><p>8±</p></td><td></td><td><p>64±</p></td><td><p dir="rtl">p t</p></td><td><p>59±</p></td><td></td></tr><tr><td><p>758</p></td><td><p>913</p></td><td></td><td><p>738</p></td><td><p>264</p></td><td><p>7</p></td><td></td><td><p>266</p></td><td><p dir="rtl">p t</p></td><td><p>812</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td><p>32</p></td></tr><tr><td><p>44±</p></td><td><p>72±</p></td><td></td><td><p>70±</p></td><td><p>67±</p></td><td><p>7±</p></td><td></td><td><p>67±</p></td><td><p dir="rtl">p t</p></td><td><p>80±</p></td><td></td></tr><tr><td><p>848</p></td><td><p>1023</p></td><td></td><td><p>821</p></td><td><p>326</p></td><td><p dir="rtl">p t</p></td><td></td><td><p>271</p></td><td><p dir="rtl">p t</p></td><td><p>891</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td></td><td><p>±</p></td><td></td><td><p>35</p></td></tr><tr><td><p>58±</p></td><td><p>96±</p></td><td></td><td><p>69±</p></td><td><p>86±</p></td><td><p dir="rtl">p t</p></td><td></td><td><p>73±</p></td><td><p dir="rtl">p t</p></td><td><p>79±</p></td><td></td></tr><tr><td><p>884</p></td><td></td><td></td><td><p>864</p></td><td><p>324</p></td><td><p dir="rtl">p t</p></td><td></td><td><p>310</p></td><td><p dir="rtl">p t</p></td><td><p>892</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td></td><td><p>±</p></td><td></td><td><p>39</p></td></tr><tr><td><p>64±</p></td><td></td><td></td><td><p>74±</p></td><td><p>81±</p></td><td><p dir="rtl">p t</p></td><td></td><td><p>88±</p></td><td><p dir="rtl">p t</p></td><td><p>84±</p></td><td></td></tr>
٤٠٦٩
-٤٢٣-
<tr><td><p>1002</p><p>55±</p></td><td></td><td></td><td><p>997</p><p>84±</p></td><td><p>381</p><p>94±</p></td><td><p dir="rtl">p t</p><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td><p>349</p><p>95±</p></td><td><p dir="rtl">p t</p><p dir="rtl">±</p><p dir="rtl">p t</p></td><td><p>103</p><p>7</p><p>±</p><p>104</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">42</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>394</p></td><td><p dir="rtl">p t</p></td><td><p>117</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>1145</p></td><td></td><td></td><td></td><td><p>442</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td><p>±</p></td><td rowspan="2"><p>3</p><p>±</p></td><td><p>47</p></td></tr><tr><td><p>78±</p></td><td></td><td></td><td></td><td><p>69±</p></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>123</p></td><td><p dir="rtl">p t</p></td><td><p>134</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>377</p></td><td><p dir="rtl">p t</p></td><td></td><td rowspan="2"><p dir="rtl">Lyrics</p></td></tr><tr><td><p>1120</p></td><td></td><td></td><td></td><td><p>484</p></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>50</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td><p>±</p></td><td><p>±</p></td><td></td><td></td></tr><tr><td><p>67±</p></td><td></td><td></td><td></td><td><p>89±</p></td><td><p dir="rtl">p t</p></td><td></td><td><p>118</p></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>414</p></td><td><p dir="rtl">p t</p></td><td></td><td rowspan="2"><p dir="rtl">Lyrics</p></td></tr><tr><td><p>1229</p></td><td></td><td></td><td></td><td><p>452</p></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>53</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>±</p></td><td></td><td><p>±</p></td><td><p>±</p></td><td></td><td></td></tr><tr><td><p>100±</p></td><td></td><td></td><td></td><td><p>78±</p></td><td><p dir="rtl">p t</p></td><td></td><td><p>127</p></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>470</p></td><td><p dir="rtl">p t</p></td><td></td><td rowspan="2"><p dir="rtl">Lyrics</p></td></tr><tr><td><p>1314</p></td><td></td><td></td><td></td><td><p>535</p></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td rowspan="2"><p>±</p></td><td></td><td rowspan="2"><p>±</p></td><td rowspan="2"><p>±</p></td><td></td><td><p>56</p></td></tr><tr><td><p>120±</p></td><td></td><td></td><td></td><td><p>93±</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>128</p></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>532</p></td><td><p dir="rtl">p t</p></td><td></td><td rowspan="2"><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>603</p></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>60</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>98±</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td><p>±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>140</p></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr>
٤٠٦٩
-٤٢٤-
<tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">p t</p><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td><p>509</p><p>±</p><p>117</p></td><td><p dir="rtl">p t</p><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">63</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>611</p></td><td><p dir="rtl">p t</p></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td><p>±</p></td><td></td><td><p>67</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>148</p></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p>-</p></td><td><p>-</p></td><td><p>±</p></td><td></td><td><p>70</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>0±</p></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr>
Table 15: High ADCs against Notch-vc6780 mammalian pathogen 468-MDA-MB
<tr><td colspan="2"><p>)SEM±</p></td><td><p dir="rtl">)mm3</p></td><td colspan="3"><p dir="rtl">MDA-MB, waist size</p></td><td colspan="3"><p dir="rtl">Intrusive breastfeeding 468-</p></td><td></td><td></td></tr><tr><td colspan="3"><p>huNeg-8.8-</p><p>vc6780</p></td><td colspan="3"><p>hu75-vc6780</p></td><td colspan="3"><p>hu28-vc6780</p></td><td><p>PB</p><p>S</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Dosage</p></td></tr><tr><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p dir="rtl">p t</p></td><td><p dir="rtl">mjfjfjfjfjfjfjfjf/</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Tj</p></td></tr><tr><td><p>346</p></td><td><p>341</p></td><td><p>339</p></td><td><p>340</p></td><td><p>344</p></td><td><p>34</p></td><td><p>342</p></td><td><p>34</p></td><td><p>335</p></td><td><p>342</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>3</p></td><td></td><td><p>2</p></td><td></td><td></td><td><p dir="rtl">p t</p></td></tr><tr><td><p>16±</p></td><td><p>12±</p></td><td><p>18±</p></td><td><p>14±</p></td><td><p>11±</p></td><td><p>±</p></td><td><p>16±</p></td><td><p>±</p></td><td><p>9±</p></td><td><p>9±</p></td><td></td></tr>
٤٠٦٩
-٤٢٥-
<tr><td></td><td></td><td></td><td></td><td></td><td><p>10</p></td><td></td><td><p>18</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>41</p></td><td></td><td><p>39</p></td><td></td><td></td><td><p dir="rtl">Day 4</p></td></tr><tr><td><p>466</p></td><td><p>457</p></td><td><p>432</p></td><td><p>423</p></td><td><p>406</p></td><td><p>8</p></td><td><p>462</p></td><td><p>4</p></td><td><p>395</p></td><td><p>466</p></td><td></td></tr><tr><td><p>29±</p></td><td><p>23±</p></td><td><p>45±</p></td><td><p>27±</p></td><td><p>22±</p></td><td><p>±</p></td><td><p>22±</p></td><td><p>±</p></td><td><p>19±</p></td><td><p>20±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>15</p></td><td></td><td><p>33</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>37</p></td><td></td><td><p>39</p></td><td></td><td></td><td><p dir="rtl">Day 7</p></td></tr><tr><td><p>528</p></td><td><p>529</p></td><td><p>449</p></td><td><p>434</p></td><td><p>378</p></td><td><p>0</p></td><td><p>452</p></td><td><p>9</p></td><td><p>350</p></td><td><p>481</p></td><td></td></tr><tr><td><p>25±</p></td><td><p>24±</p></td><td><p>45±</p></td><td><p>29±</p></td><td><p>21±</p></td><td><p>±</p></td><td><p>30±</p></td><td><p>±</p></td><td><p>19±</p></td><td><p>17±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>18</p></td><td></td><td><p>24</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>30</p></td><td></td><td><p>38</p></td><td></td><td></td><td><p dir="rtl">Day 11</p></td></tr><tr><td><p>621</p></td><td><p>599</p></td><td><p>504</p></td><td><p>471</p></td><td><p>403</p></td><td><p>2</p></td><td><p>512</p></td><td><p>0</p></td><td><p>248</p></td><td><p>611</p></td><td></td></tr><tr><td><p>43±</p></td><td><p>23±</p></td><td><p>38±</p></td><td><p>39±</p></td><td><p>21±</p></td><td><p>±</p></td><td><p>35±</p></td><td><p>±</p></td><td><p>26±</p></td><td><p>44±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>21</p></td><td></td><td><p>25</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>22</p></td><td></td><td><p>40</p></td><td></td><td></td><td><p dir="rtl">Day 14</p></td></tr><tr><td><p>639</p></td><td><p>622</p></td><td><p>503</p></td><td><p>470</p></td><td><p>370</p></td><td><p>8</p></td><td><p>507</p></td><td><p>1</p></td><td><p>154</p></td><td><p>610</p></td><td></td></tr><tr><td><p>48±</p></td><td><p>31±</p></td><td><p>64±</p></td><td><p>44±</p></td><td><p>28±</p></td><td><p>±</p></td><td><p>38±</p></td><td><p>±</p></td><td><p>23±</p></td><td><p>19±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>19</p></td><td></td><td><p>30</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>11</p></td><td></td><td><p>43</p></td><td></td><td></td><td><p dir="rtl">Day 19</p></td></tr><tr><td><p>713</p></td><td><p>697</p></td><td><p>437</p></td><td><p>536</p></td><td><p>339</p></td><td><p>2</p></td><td><p>538</p></td><td><p>8</p></td><td><p>65</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>707</p></td><td></td></tr><tr><td><p>48±</p></td><td><p>36±</p></td><td><p>54±</p></td><td><p>49±</p></td><td><p>19±</p></td><td><p>±</p></td><td><p>47±</p></td><td><p>±</p></td><td><p>17±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>23</p></td><td></td><td><p>39</p></td><td></td><td></td><td></td></tr>
٤٠٦٩
-٤٢٦-
<tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>34±</p></td><td><p dir="rtl">Day 22</p></td></tr><tr><td></td><td></td><td><p>415</p><p>54±</p></td><td><p>552</p><p>44±</p></td><td><p>360</p><p>17±</p></td><td><p>52</p><p>±</p><p>21</p></td><td><p>551</p><p>48±</p></td><td><p>41</p><p>4</p><p>±</p><p>41</p></td><td><p>25</p><p>16±</p></td><td></td><td><p dir="rtl">Day 25</p></td></tr><tr><td></td><td></td><td><p>421</p><p>76±</p></td><td><p>597</p><p>48±</p></td><td><p>381</p><p>23±</p></td><td><p>63</p><p>±</p><p>25</p></td><td><p>575</p><p>55±</p></td><td><p>49</p><p>1</p><p>±</p><p>37</p></td><td><p>26</p><p>19±</p></td><td></td><td><p dir="rtl">Day 28</p></td></tr><tr><td></td><td></td><td><p>451</p><p>84±</p></td><td><p>660</p><p>53±</p></td><td><p>443</p><p>33±</p></td><td><p>64</p><p>±</p><p>26</p></td><td><p>654</p><p>74±</p></td><td><p>49</p><p>7</p><p>±</p><p>68</p></td><td><p>15</p><p>15±</p></td><td></td><td><p dir="rtl">Day 32</p></td></tr><tr><td></td><td></td><td><p>456</p><p>94،±</p></td><td><p>634</p><p>74±</p></td><td><p>437</p><p>28±</p></td><td><p>71</p><p>±</p><p>31</p></td><td><p>653</p><p>82±</p></td><td><p>52</p><p>4</p><p>±</p><p>69</p></td><td><p dir="rtl">p t</p><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td><p dir="rtl">Day 35</p></td></tr><tr><td></td><td></td><td><p>541</p><p>108±</p></td><td><p>742</p><p>80±</p></td><td><p>495</p><p>33±</p></td><td><p>85</p><p>±</p><p>38</p></td><td><p>734</p><p>89±</p></td><td></td><td><p dir="rtl">p t</p><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td><p dir="rtl">Day 40</p></td></tr><tr><td></td><td></td><td><p>563</p></td><td><p>794</p></td><td><p>535</p></td><td><p>12</p></td><td><p>761</p></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p dir="rtl">Day 43</p></td></tr>
٤٠٦٩
-٤٢٧-
<tr><td></td><td></td><td><p>109±</p></td><td><p>87±</p></td><td><p>41±</p></td><td><p>5</p><p>±</p><p>44</p></td><td><p>99±</p></td><td></td><td><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td colspan="2"></td></tr><tr><td></td><td></td><td><p>581</p></td><td><p>878</p></td><td><p>619</p></td><td><p>13</p><p>4</p></td><td><p>816</p></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>46</p></td><td><p dir="rtl">Today</p></td></tr><tr><td></td><td></td><td><p>120±</p></td><td><p>78±</p></td><td><p>47±</p></td><td><p>±</p><p>42</p></td><td><p>±</p><p>122</p></td><td></td><td><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td><p>617</p></td><td><p>868</p></td><td><p>636</p></td><td><p>14</p><p>3</p></td><td><p>859</p></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>49</p></td><td><p dir="rtl">Today</p></td></tr><tr><td></td><td></td><td><p>116±</p></td><td><p>99±</p></td><td><p>38±</p></td><td><p>±</p><p>42</p></td><td><p>±</p><p>126</p></td><td></td><td><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td><p>733</p></td><td><p>996</p></td><td><p>723</p></td><td><p>15</p><p>9</p></td><td><p>948</p></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>53</p></td><td><p dir="rtl">Today</p></td></tr><tr><td></td><td></td><td><p>129±</p></td><td><p>±</p><p>109</p></td><td><p>71±</p></td><td><p>±</p><p>44</p></td><td><p>±</p><p>178</p></td><td></td><td><p dir="rtl">±</p><p dir="rtl">p t</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td><p>758</p></td><td></td><td><p>795</p></td><td><p>20</p><p>1</p></td><td><p>100</p><p>8</p></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>56</p></td><td><p dir="rtl">Today</p></td></tr><tr><td></td><td></td><td><p>163±</p></td><td></td><td><p>67±</p></td><td><p>±</p></td><td><p>±</p></td><td></td><td><p>±</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>63</p></td><td><p>192</p></td><td></td><td><p dir="rtl">p t</p></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>819</p></td><td><p>21</p></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p>60</p></td><td><p dir="rtl">Today</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>77±</p></td><td><p>1</p></td><td></td><td></td><td><p>±</p></td><td></td><td></td><td></td></tr>
٤٠٦٩
-٤٢٨-
<tr><td></td><td></td><td></td><td></td><td></td><td><p>±</p><p>63</p></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>976</p></td><td><p>24 0</p></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td><p dir="rtl">Day 63</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>±</p></td><td><p>±</p></td><td></td><td></td><td><p>±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td><p>115</p></td><td><p>63</p></td><td></td><td></td><td><p dir="rtl">p t</p></td><td></td><td></td></tr>
Also dose breast growth, 468-MDA-MB intravenously 4 ml every 4 days with a PBS carrier medium, human-human hybrid anti-Notch ADCs, and concomitant huNeg-8.8 ADCs, at a dose of 5 ml -/ The word “tmma” is the word “tmah” 8(b) and 8(j). The data shows that the anti-Notch ADCs contain two non-cleavable junctions (mc) and mc-junctions. گ (vc) and translations
<p dir="rtl">5 468-MDA-MB. In addition, the data show that anti-Notch ADCs inhibit tumor growth by inhibiting tumor growth High quality ADF huNeg8.8-ADCs in the United States. Moreover, the data showed that ADCs against hybrid Notch have a higher effect than ADCs against hybrid Notch Adam- ger, the tester is another.</p>
10 D. Stomach intrusion N871
In a similar way, experiments are performed using the N87 gastric cancer cell line as described above. To create an exotic skin, you can use more skin care for all immunocompromised females (6 10 × 7.5 (Nu/Nu 50M N87 cells: BD Biosciences) Matrigel). When the tumor reaches a size of 250 to 450 mm3, the tumor advances to a similar level.
<p dir="rtl">15 Mixed treatment groups. Growth, stomach, N87 dose intravenously 4 m over 4 days (Q4dx4) m as carrier medium, anti-Notch ADCs, huNeg-8.8 adducts, and cisplatin at the doses provided in Tables 16 and 17. The data showed that ADCs hu28 vc0101 against Notch, hu28-vc6780, hu75-vc0101 and hu75-vc6780 inhibited growth.</p>
٤٠٦٩
-٤٢٩-
Intestinal tenderness N78 in a dose-dependent manner. In addition, the data show that ADCs
Anti-Notch inhibits tumor growth to a greater extent than conjugate huNeg8.8-ADCs at doses of 1, 3, and 5 mg/gl ADCs linked to Notch vc0101 and at doses of 3 and 10 mg/gl ADCs linked to Notch vc6780. Moreover, the data showed that the ADCs were m
5 Link - LC0101 has a high overall effect on treatment with cisplatin and ADCs. Link - LC6780.
Table 16: High ADCs against Notch-vc0101 M. Stomach invader N87
<tr><td colspan="11"><p dir="rtl">Gastric intrusion paper N87, waist size (3 mm ± SEM)</p></td><td></td></tr><tr><td><p>Cispl</p><p>atin</p></td><td colspan="3"><p>huNeg-8.8-</p><p>vc0101</p></td><td colspan="3"><p>hu75-vc0101</p></td><td colspan="3"><p>hu28-vc0101</p></td><td><p>PB</p><p>S</p></td><td></td></tr><tr><td><p>5</p></td><td><p>5</p></td><td><p>3</p></td><td><p>1</p></td><td><p>5</p></td><td><p>3</p></td><td><p>1</p></td><td><p>5</p></td><td><p>3</p></td><td><p>1</p></td><td><p dir="rtl">Description</p><p dir="rtl">R</p></td><td><p dir="rtl">Dosage</p><p dir="rtl">mjfjfjfjfjf/jm</p></td></tr><tr><td><p>328</p><p>20±</p></td><td><p>32</p><p>1</p><p>±</p><p>16</p></td><td><p>324</p><p>11±</p></td><td><p>327</p><p>18±</p></td><td><p>320</p><p>11±</p></td><td><p>324</p><p>19±</p></td><td><p>321</p><p>9±</p></td><td><p>321</p><p>8±</p></td><td><p>32</p><p>6</p><p>±</p><p>13</p></td><td><p>321</p><p>21±</p></td><td><p>32</p><p>7</p><p>±</p><p>11</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">p t</p></td></tr>
٤٠٦٩
-٤٣٠-
<tr><td><p>414</p></td><td><p>42</p><p>3</p></td><td><p>478</p></td><td><p>437</p></td><td><p>315</p></td><td><p>362</p></td><td><p>392</p></td><td><p>344</p></td><td><p>33</p><p>9</p></td><td><p>369</p></td><td><p>52</p><p>6</p></td><td><p dir="rtl">Day 4</p></td></tr><tr><td><p>27±</p></td><td><p>±</p></td><td><p>19±</p></td><td><p>34±</p></td><td><p>15±</p></td><td><p>35±</p></td><td><p>15±</p></td><td><p>14±</p></td><td><p>±</p></td><td><p>18±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td><p>32</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>11</p></td><td></td><td><p>19</p></td><td></td></tr><tr><td></td><td><p>51</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>30</p></td><td></td><td><p>70</p></td><td><p dir="rtl">Day 7</p></td></tr><tr><td><p>520</p></td><td><p>2</p></td><td><p>625</p></td><td><p>584</p></td><td><p>246</p></td><td><p>303</p></td><td><p>417</p></td><td><p>272</p></td><td><p>2</p></td><td><p>429</p></td><td><p>6</p></td><td></td></tr><tr><td><p>26±</p></td><td><p>±</p></td><td><p>34±</p></td><td><p>54±</p></td><td><p>12±</p></td><td><p>21±</p></td><td><p>25±</p></td><td><p>7±</p></td><td><p>±</p></td><td><p>43±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td><p>34</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>10</p></td><td></td><td><p>27</p></td><td></td></tr><tr><td></td><td><p>50</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>18</p></td><td></td><td><p>85</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>501</p></td><td><p>1</p></td><td><p>716</p></td><td><p>702</p></td><td><p>156</p></td><td><p>174</p></td><td><p>331</p></td><td><p>152</p></td><td><p>2</p></td><td><p>304</p></td><td><p>4</p></td><td><p>11</p></td></tr><tr><td><p>29±</p></td><td><p>±</p></td><td><p>53±</p></td><td><p>60±</p></td><td><p>10±</p></td><td><p>14±</p></td><td><p>21±</p></td><td><p>13±</p></td><td><p>±</p></td><td><p>30±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td><p>38</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>14</p></td><td></td><td><p>36</p></td><td></td></tr><tr><td></td><td><p>54</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>88</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>19</p></td><td></td><td></td><td></td></tr><tr><td><p>637</p></td><td><p>9</p></td><td><p>823</p></td><td><p>822</p></td><td><p>151</p></td><td><p>172</p></td><td><p>305</p></td><td><p>155</p></td><td></td><td><p>282</p></td><td><p>7</p></td><td><p>14</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>1</p></td><td></td><td></td><td></td></tr><tr><td><p>31±</p></td><td><p>±</p></td><td><p>42±</p></td><td><p>65±</p></td><td><p>7±</p></td><td><p>10±</p></td><td><p>17±</p></td><td><p>13±</p></td><td></td><td><p>25±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>5±</p></td><td></td><td></td><td></td></tr><tr><td></td><td><p>37</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>45</p></td><td></td></tr><tr><td></td><td><p>49</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>10</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>16</p></td><td></td><td></td><td></td></tr><tr><td></td><td><p>1</p></td><td><p>789</p></td><td><p>823</p></td><td><p>128</p></td><td><p>151</p></td><td><p>267</p></td><td><p>138</p></td><td></td><td><p>263</p></td><td><p>45</p></td><td><p>18</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>1</p></td><td></td><td></td><td></td></tr><tr><td></td><td><p>±</p></td><td><p>33±</p></td><td><p>73±</p></td><td><p>6±</p></td><td><p>10±</p></td><td><p>17±</p></td><td><p>11±</p></td><td></td><td><p>24±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>7±</p></td><td></td><td></td><td></td></tr><tr><td></td><td><p>51</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>68</p></td><td></td></tr>
٤٠٦٩
-٤٣١-
<tr><td></td><td><p>41</p><p>3</p></td><td><p>785</p></td><td><p>857</p></td><td><p>115</p></td><td><p>130</p></td><td><p>218</p></td><td><p>110</p></td><td><p>12</p><p>3</p></td><td><p>227</p></td><td><p>10</p><p>72</p></td><td><p dir="rtl">Lyrics</p><p dir="rtl">21</p></td></tr><tr><td></td><td><p>±</p></td><td><p>35±</p></td><td><p>78±</p></td><td><p>7±</p></td><td><p>5±</p></td><td><p>23±</p></td><td><p>9±</p></td><td><p>±</p></td><td><p>23±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td><p>50</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>15</p></td><td></td><td><p>76</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>13</p></td><td rowspan="2"><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>34</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>10</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td><p>895</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>03</p></td><td><p>26</p></td></tr><tr><td></td><td><p>3</p></td><td><p>825</p></td><td></td><td><p>82</p></td><td><p>92</p></td><td><p>185</p></td><td><p>69</p></td><td><p>8</p></td><td><p>205</p></td><td></td><td></td></tr><tr><td></td><td><p>±</p></td><td><p>62±</p></td><td><p>±</p></td><td><p>10±</p></td><td><p>14±</p></td><td><p>24±</p></td><td><p>16±</p></td><td><p>±</p></td><td><p>32±</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td></td><td></td><td><p>126</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>14</p></td><td></td></tr><tr><td></td><td><p>63</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>16</p></td><td></td><td><p>0</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>12</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>41</p></td><td></td><td><p>957</p></td><td></td><td></td><td></td><td></td><td><p>99</p></td><td></td><td><p>76</p></td><td><p>29</p></td></tr><tr><td></td><td><p>1</p></td><td><p>879</p></td><td><p>±</p></td><td><p>75</p></td><td><p>104</p></td><td><p>211</p></td><td><p>50</p></td><td><p>±</p></td><td><p>180</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td><p>±</p></td><td><p>72±</p></td><td><p>126</p></td><td><p>12±</p></td><td><p>16±</p></td><td><p>37±</p></td><td><p>13±</p></td><td><p>14</p></td><td><p>30±</p></td><td><p>13</p></td><td></td></tr><tr><td></td><td><p>89</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>9</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>33</p></td></tr><tr><td></td><td><p>41</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>10</p></td><td></td><td><p>14</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td><p>988</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>80</p></td><td><p>36</p></td></tr><tr><td></td><td><p>1</p></td><td><p>966</p></td><td><p>±</p></td><td><p>73</p></td><td><p>91</p></td><td><p>251</p></td><td><p>43</p></td><td><p>6</p></td><td><p>211</p></td><td><p>±</p></td><td></td></tr><tr><td></td><td><p>±</p></td><td><p>98±</p></td><td><p>180</p></td><td><p>12±</p></td><td><p>18±</p></td><td><p>53±</p></td><td><p>14±</p></td><td><p>±</p></td><td><p>43±</p></td><td><p>18</p></td><td></td></tr><tr><td></td><td><p>89</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>17</p></td><td></td><td><p>3</p></td><td></td></tr>
٤٠٦٩
-٤٣٢-
<tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">39</p></td></tr><tr><td></td><td><p>48</p></td><td></td><td><p>884</p></td><td></td><td></td><td></td><td></td><td><p>12</p></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>1</p></td><td><p>1023</p></td><td></td><td><p>85</p></td><td><p>86</p></td><td><p>272</p></td><td><p>52</p></td><td><p>2</p></td><td><p>215</p></td><td></td><td><p>42</p></td></tr><tr><td></td><td><p>±</p></td><td><p>106±</p></td><td><p>±</p></td><td><p>9±</p></td><td><p>18±</p></td><td><p>59±</p></td><td><p>16±</p></td><td><p>±</p></td><td><p>42±</p></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td><p>143</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td><p>86</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>22</p></td><td></td><td></td><td></td></tr><tr><td></td><td><p>53</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>12</p></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>5</p></td><td><p>1142</p></td><td><p>937</p></td><td><p>72</p></td><td><p>59</p></td><td><p>304</p></td><td><p>45</p></td><td><p>8</p></td><td><p>261</p></td><td></td><td><p>47</p></td></tr><tr><td></td><td><p>±</p></td><td><p>121±</p></td><td><p>±</p></td><td><p>13±</p></td><td><p>16±</p></td><td><p>72±</p></td><td><p>14±</p></td><td><p>±</p></td><td><p>54±</p></td><td></td><td></td></tr><tr><td></td><td><p>12</p></td><td></td><td><p>167</p></td><td></td><td></td><td></td><td></td><td><p>23</p></td><td></td><td></td><td></td></tr><tr><td></td><td><p>8</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>53</p></td></tr><tr><td></td><td><p>59</p></td><td></td><td><p>100</p></td><td></td><td></td><td></td><td></td><td><p>14</p></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>6</p></td><td><p>1240</p></td><td><p>8</p></td><td><p>74</p></td><td><p>81</p></td><td><p>314</p></td><td><p>34</p></td><td><p>9</p></td><td><p>283</p></td><td></td><td><p>62</p></td></tr><tr><td></td><td><p>±</p></td><td><p>143±</p></td><td><p>±</p></td><td><p>13±</p></td><td><p>22±</p></td><td><p>73±</p></td><td><p>15±</p></td><td><p>±</p></td><td><p>52±</p></td><td></td><td></td></tr><tr><td></td><td><p>11</p></td><td></td><td><p>179</p></td><td></td><td></td><td></td><td></td><td><p>25</p></td><td></td><td></td><td></td></tr><tr><td></td><td><p>9</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>70</p></td></tr>
Table 17: High ADCs against Notch-vc6780, a gastric pathogen, N87.
٤٠٦٩
-٤٣٣-
<tr><td colspan="2"></td><td colspan="2"><p>)SEM±</p></td><td colspan="5"><p dir="rtl">Intrusive parchment in the stomach, N87, size (3 mm).</p></td><td></td></tr><tr><td colspan="2"><p>huNeg8.8-</p><p>vc6780</p></td><td colspan="3"><p>hu75-vc6780</p></td><td colspan="3"><p>hu28-vc6780</p></td><td><p>PBS</p></td><td></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Dosage</p></td></tr><tr><td><p>3</p></td><td><p>10</p></td><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p>1</p></td><td><p>3</p></td><td><p>10</p></td><td><p dir="rtl">p t</p></td><td><p dir="rtl">MAGGAFF/</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Tj</p></td></tr><tr><td><p>344</p></td><td><p>356</p></td><td><p>359</p></td><td><p>351</p></td><td><p>349</p></td><td><p>348</p></td><td><p>349</p></td><td><p>350</p></td><td><p>345</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>14±</p></td><td><p>20±</p></td><td><p>16±</p></td><td><p>20±</p></td><td><p>8±</p></td><td><p>13±</p></td><td><p>10±</p></td><td><p>14±</p></td><td><p>14±</p></td><td><p dir="rtl">p t</p></td></tr><tr><td><p>537</p></td><td><p>581</p></td><td><p>552</p></td><td><p>545</p></td><td><p>468</p></td><td><p>560</p></td><td><p>552</p></td><td><p>434</p></td><td><p>600</p></td><td><p dir="rtl">Day 4</p></td></tr><tr><td><p>36±</p></td><td><p>60±</p></td><td><p>40±</p></td><td><p>37±</p></td><td><p>18±</p></td><td><p>26±</p></td><td><p>24±</p></td><td><p>24±</p></td><td><p>16±</p></td><td></td></tr><tr><td><p>670</p></td><td><p>605</p></td><td><p>568</p></td><td><p>511</p></td><td><p>351</p></td><td><p>592</p></td><td><p>545</p></td><td><p>379</p></td><td><p>675</p></td><td><p dir="rtl">Day 8</p></td></tr><tr><td><p>45±</p></td><td><p>67±</p></td><td><p>62±</p></td><td><p>31±</p></td><td><p>24±</p></td><td><p>44±</p></td><td><p>37±</p></td><td><p>12±</p></td><td><p>20±</p></td><td></td></tr><tr><td><p>706</p></td><td><p>636</p></td><td><p>591</p></td><td><p>544</p></td><td><p>316</p></td><td><p>617</p></td><td><p>511</p></td><td><p>315</p></td><td><p>763</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>38±</p></td><td><p>79±</p></td><td><p>63±</p></td><td><p>43±</p></td><td><p>25±</p></td><td><p>48±</p></td><td><p>25±</p></td><td><p>18±</p></td><td><p>54±</p></td><td><p>11</p></td></tr><tr><td><p>917</p></td><td><p>775</p></td><td><p>666</p></td><td><p>558</p></td><td><p>269</p></td><td><p>782</p></td><td><p>564</p></td><td><p>292</p></td><td><p>886</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>36±</p></td><td><p>117±</p></td><td><p>77±</p></td><td><p>36±</p></td><td><p>27±</p></td><td><p>60±</p></td><td><p>29±</p></td><td><p>24±</p></td><td><p>72±</p></td><td><p>14</p></td></tr><tr><td><p>958</p></td><td><p>665</p></td><td><p>642</p></td><td><p>494</p></td><td><p>224</p></td><td><p>797</p></td><td><p>479</p></td><td><p>199</p></td><td><p>997</p></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>57±</p></td><td><p>112±</p></td><td><p>90±</p></td><td><p>41±</p></td><td><p>26±</p></td><td><p>88±</p></td><td><p>29±</p></td><td><p>18±</p></td><td><p>93±</p></td><td><p>18</p></td></tr>
٤٠٦٩
-٤٣٤-
<tr><td><p>100</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>637</p></td><td><p>710</p></td><td><p>534</p></td><td><p>192</p></td><td><p>839</p></td><td><p>499</p></td><td><p>194</p></td><td><p>1041</p></td><td></td></tr><tr><td><p>2</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>21</p></td></tr><tr><td></td><td><p>119±</p></td><td><p>117±</p></td><td><p>41±</p></td><td><p>19±</p></td><td><p>93±</p></td><td><p>34±</p></td><td><p>20±</p></td><td><p>107±</p></td><td></td></tr><tr><td><p>59±</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>107</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>647</p></td><td><p>748</p></td><td><p>628</p></td><td><p>227</p></td><td><p>878</p></td><td><p>588</p></td><td><p>181</p></td><td><p>1151</p></td><td></td></tr><tr><td><p>5</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>25</p></td></tr><tr><td></td><td><p>134±</p></td><td><p>138±</p></td><td><p>58±</p></td><td><p>32±</p></td><td><p>105±</p></td><td><p>40±</p></td><td><p>21±</p></td><td><p>144±</p></td><td></td></tr><tr><td><p>82±</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>114</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td></td><td><p>674</p></td><td><p>763</p></td><td><p>645</p></td><td><p>244</p></td><td><p>904</p></td><td><p>672</p></td><td><p>204</p></td><td><p>1200</p></td><td></td></tr><tr><td><p>8</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>28</p></td></tr><tr><td></td><td><p>146±</p></td><td><p>145±</p></td><td><p>57±</p></td><td><p>35±</p></td><td><p>123±</p></td><td><p>48±</p></td><td><p>16±</p></td><td><p>155±</p></td><td></td></tr><tr><td><p>77±</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>129</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>0</p></td><td><p>733</p></td><td><p>991</p></td><td><p>730</p></td><td><p>267</p></td><td><p>1043</p></td><td><p>786</p></td><td><p>196</p></td><td><p>1481</p></td><td><p>33</p></td></tr><tr><td><p>±</p></td><td><p>195±</p></td><td><p>239±</p></td><td><p>66±</p></td><td><p>52±</p></td><td><p>152±</p></td><td><p>65±</p></td><td><p>27±</p></td><td><p>206±</p></td><td></td></tr><tr><td><p>128</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>126</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>5</p></td><td><p>817</p></td><td></td><td><p>850</p></td><td><p>300</p></td><td><p>1108</p></td><td><p>827</p></td><td><p>189</p></td><td></td><td><p>36</p></td></tr><tr><td><p>±</p></td><td><p>222±</p></td><td></td><td><p>74±</p></td><td><p>64±</p></td><td><p>185±</p></td><td><p>69±</p></td><td><p>37±</p></td><td></td><td></td></tr><tr><td><p>111</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr><tr><td><p>142</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Lyrics</p></td></tr><tr><td><p>9</p></td><td><p>880</p></td><td></td><td><p>881</p></td><td><p>323</p></td><td><p>1204</p></td><td><p>847</p></td><td><p>228</p></td><td></td><td><p>39</p></td></tr><tr><td><p>±</p></td><td><p>247±</p></td><td></td><td><p>88±</p></td><td><p>69±</p></td><td><p>209±</p></td><td><p>77±</p></td><td><p>44±</p></td><td></td><td></td></tr><tr><td><p>121</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td></tr>
٤٠٦٩
-٤٣٥-
<tr><td></td><td><p>797</p><p>244±</p></td><td></td><td><p>1020</p><p>99±</p></td><td><p>350</p><p>78±</p></td><td></td><td><p>959</p><p>81±</p></td><td><p>257</p><p>60±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">42</p></td></tr><tr><td></td><td><p>874</p><p>267±</p></td><td></td><td><p>1097</p><p>129±</p></td><td><p>380</p><p>78±</p></td><td></td><td><p>1018</p><p>94±</p></td><td><p>253</p><p>59±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">46</p></td></tr><tr><td></td><td></td><td></td><td><p>1162</p><p>134±</p></td><td><p>415</p><p>77±</p></td><td></td><td><p>1111</p><p>95±</p></td><td><p>253</p><p>67±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">50</p></td></tr><tr><td></td><td></td><td></td><td><p>1331</p><p>187±</p></td><td><p>504</p><p>111±</p></td><td></td><td><p>1279</p><p>108±</p></td><td><p>298</p><p>85±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">56</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>581</p><p>121±</p></td><td></td><td><p>1368</p><p>133±</p></td><td><p>345</p><p>93±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">63</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>726</p><p>163±</p></td><td></td><td><p>1483</p><p>154±</p></td><td><p>376</p><p>117±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">70</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>797</p><p>184±</p></td><td></td><td></td><td><p>388</p><p>123±</p></td><td></td><td><p dir="rtl">Lyrics</p><p dir="rtl">77</p></td></tr>
Also dose 87 mg intravenously every 4 days with anti-Notch ADCs, Adam-Ger hybrid, and huNeg-8.8 DCs are scooped out, at a dose of 5 mg/mg, which is the mixture of Roma Shell 8 (d) The data demonstrated that ADCs contain non-cleavable linkers (mc), cleavable linkers (vc), and various ligands that inhibit inhibition.
5 Intrusive growth of stomach N87. In addition, the data show that anti-Notch ADCs in human-derived hybrids inhibit tumor growth to a greater extent than those of adjuvanted huNeg8.8-ADCs. On top of that
٤٠٦٩
-٤٣٦-
Thus, the data showed that anti-Notch ADCs against the human species - Jaghr, Mfalfa - Malkhucht vc0101 are highly affected by it Other tested ADCs against Notch.
It is also dosed in the stomach, stomach, N87, intravenously, 4 million per day, with PBS and ADCs ch28-mc0131 against Not ch Hajjain Adam-Jar,, ch28-, ch75-mc0131
5 0131-m(H2O)c and 0131-m(H2O)c at a dose of 5 mg/g are available in a total of 8
HCFC GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK GFKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than (It showed.) Data show that ADCs against Notch, Adam-Jar, and Wassila-Mc0131-Mc0131 and 0131-m(H2o)c inhibit the growth of gastric intestinal flora additionally For, for, the data showed that
ADCs against the human hybrid Notch, 0131-m(H2O)c, have an effect.
10 High-performance ADCs against the Notch attack, and the connection point. mc0131
Table 18(A): Selected matrices (cytotoxic peptides and connectors) from AKP
<tr><td><p dir="rtl">Purification method</p></td><td><p dir="rtl">Your way of illumination</p></td><td><p dir="rtl">Raqqa Wasla - Lamula</p></td></tr><tr><td><p dir="rtl">Method D</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#34</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>MalPeg3C2-#41</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>MalPeg6C2-#42</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>mc-#44</p></td></tr>
٤٠٦٩
-٤٣٧-
<tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>MalPeg3C2-#44</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>MalPeg6C2-#44</p></td></tr><tr><td><p dir="rtl">Method F</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>MalValCitPABC-#44</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>mc-#45</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>MalPeg3C2-#45</p></td></tr><tr><td><p dir="rtl">Method *E1</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>MalPeg6C2-#45</p></td></tr><tr><td><p dir="rtl">Method C and Method E1</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#45</p></td></tr><tr><td><p dir="rtl">Method D</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#54</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>mc-#69</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>MalPeg6C2-#69</p></td></tr>
٤٠٦٩
-٤٣٨-
<tr><td><p dir="rtl">Method I</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#69</p></td></tr><tr><td><p dir="rtl">Method D</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#70</p></td></tr><tr><td><p dir="rtl">Method H</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#75</p></td></tr><tr><td><p dir="rtl">Method E</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>mc-#79</p></td></tr><tr><td><p dir="rtl">Method D</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#79</p></td></tr><tr><td><p dir="rtl">Method E</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#92</p></td></tr><tr><td><p dir="rtl">Method C</p></td><td><p dir="rtl">I'm sorry about the year E</p></td><td><p>mcValCitPABC-#112</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>mv-#115</p></td></tr><tr><td><p dir="rtl">L method</p></td><td></td><td><p>mc-#115</p></td></tr><tr><td></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>mb-#115</p></td></tr>
٤٠٦٩
-٤٣٩-
<tr><td></td><td><p dir="rtl">I really appreciate the general opinion D</p></td><td><p>me-#115</p></td></tr>
<tr><td><p dir="rtl">Method K</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#115</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#51</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#47</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#54</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#47</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#26</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#26</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#42</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#36</p></td></tr><tr><td><p dir="rtl">Method E1</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#42</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#54</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg3C2-#54</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg6C2-#54</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg3C2-#54</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg3C2-#47</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#47</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg3C2-#47</p></td></tr>
٤٠٦٩
-٤٤٠-
<tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg6C2-#47</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg3C2-#42</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#42</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg6C2-#42</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg3C2-#42</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg3C2-#26</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#41</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#26</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg3C2-#26</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">Public rent P</p></td><td><p>MalPeg3C2ValCitPABC-#26</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg6C2-#26</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#36</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#54</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">Public rent P</p></td><td><p>MalPeg3C2ValCitPABC-#47</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg3C2-#36</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#47</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#26</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#36</p></td></tr>
٤٠٦٩
-٤٤١-
<tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg3C2-#36</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#36</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#60</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg6C2-#36</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg3C2-#41</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#60</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#60</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg3C2-#60</p></td></tr><tr><td><p dir="rtl">Method J M</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#41</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#66</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent O</p></td><td><p>mcValCitPABCAmPeg6C2-#60</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#70</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">General rent Q</p></td><td><p>2AcAmPeg6C2-#66</p></td></tr><tr><td><p dir="rtl">Method J M</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#66</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#88</p></td></tr><tr><td><p dir="rtl">Method J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#88</p></td></tr><tr><td><p dir="rtl">Method F</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#92</p></td></tr><tr><td><p dir="rtl">Method F</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#44</p></td></tr>
٤٠٦٩
-٤٤٢-
<tr><td><p dir="rtl">Method H</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#108</p></td></tr><tr><td><p dir="rtl">Method F</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#108</p></td></tr><tr><td><p dir="rtl">Method *F</p></td><td><p dir="rtl">General rent x2</p></td><td><p>NHSCOPeg2C2ValCitPABC-#66</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#98</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#95</p></td></tr><tr><td><p dir="rtl">Method K</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg3C2-#69</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#69</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#84</p></td></tr><tr><td><p dir="rtl">Method *K</p></td><td><p dir="rtl">General rent R</p></td><td><p>AmCapValCitPABC-#54</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent E</p></td><td><p>mcValCitPABC-#226</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#117</p></td></tr><tr><td><p dir="rtl">Method *I</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#98</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#118</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#80</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#118</p></td></tr><tr><td><p dir="rtl">Method H</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#230</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#232</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#117</p></td></tr>
٤٠٦٩
-٤٤٣-
<tr><td><p dir="rtl">Method *K</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#117</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mv-#69</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mb-#69</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#234</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#235</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#118</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#123</p></td></tr><tr><td><p dir="rtl">Tallil trum</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#226</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>me-#118</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#131</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mb-#118</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#134</p></td></tr><tr><td><p dir="rtl">Method K</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#145</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#126</p></td></tr><tr><td><p dir="rtl">Method *K</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#126</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mv-#118</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#172</p></td></tr><tr><td><p dir="rtl">Method *K</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#226</p></td></tr>
٤٠٦٩
-٤٤٤-
<tr><td><p dir="rtl">Method K</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#145</p></td></tr><tr><td><p dir="rtl">Method *H</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#162</p></td></tr><tr><td><p dir="rtl">Method *K</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#163</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#231</p></td></tr><tr><td><p dir="rtl">Tallil trum</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#238</p></td></tr><tr><td><p dir="rtl">Tallil trum</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalPeg6C2-#239</p></td></tr><tr><td><p dir="rtl">Tallil trum</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#123</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent S</p></td><td><p>MalC6-#54</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#231</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent S</p></td><td><p>MalC6-#118</p></td></tr><tr><td><p dir="rtl">Tallil trum</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#123</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#237</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>mc-#158</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalC6Am-#151</p></td></tr><tr><td><p dir="rtl">Method H</p></td><td><p dir="rtl">General rent X3</p></td><td><p>PFPCOPeg2C2 ValCitPABC-#54</p></td></tr><tr><td><p dir="rtl">Tallil trum</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#154</p></td></tr><tr><td><p dir="rtl">Method *K</p></td><td><p dir="rtl">General rent D</p></td><td><p>MalC6Am-#153</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">General rent X4</p></td><td><p>PFPCOPeg2C2AmPeg2C2-#69</p></td></tr>
٤٠٦٩
-٤٤٥-
<tr><td><p dir="rtl">Tallil trum</p></td><td><p dir="rtl">E</p></td><td><p>mcValCitPABC-#246</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">I want to see the X1</p></td><td><p>PFPCOPeg2C2AlaAlaAsnPABC-#54</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">General rent V</p></td><td><p>PFPCOPeg2C2-#54</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">General rent W</p></td><td><p>PFPCOPeg2C2AmPeg2C2PABC-#54</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent N</p></td><td><p>AmPeg6C2-#115</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent V</p></td><td><p>PFPCOPeg5C2-#115</p></td></tr><tr><td><p dir="rtl">Tallil trum</p></td><td></td><td><p>mcGly-#201</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">Aaj Ara Al Aa T</p></td><td><p>AzCOC2Ph4AmCOPeg2C2-#54</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">U rent</p></td><td><p>AzCOC2Ph4AmPeg1C1ValCitPABC-#54</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">U rent</p></td><td><p>AzCOC2Ph4AmPeg1C1ValCitPABC-#30</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">Aaj Ara Al Aa T</p></td><td><p>AzCOC2Ph4AmCOPeg2C2-#69</p></td></tr><tr><td><p dir="rtl">Method *R</p></td><td><p dir="rtl">Aaj Ara Al Aa T</p></td><td><p>AzCOC2Ph4AmCOPeg2C2-#115</p></td></tr><tr><td><p dir="rtl">Method *J</p></td><td><p dir="rtl">General rent X5</p></td><td><p>AcLysValCitPABC-#54</p></td></tr>
Table 18(b): Selected matrices (peptides toxic to the cell and junctions) from AKP
<tr><td><p>IUPAC AS</p></td><td><p dir="rtl">Hill spectrometry: LC-MS or</p><p>HPLC</p><p dir="rtl">m/z The Malays and their colleagues lost their time in minutes ESI-MS</p></td><td><p dir="rtl">The recipe sheet is full of the money</p></td></tr>
٤٠٦٩
-٤٤٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-</p><p>methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-</p><p>thioxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7, 10-triazatetradec-1-yl]phenyl}-N5-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol: 1380.6(M+12.899),[M+Na min)</p></td><td><p>mcValCitPA</p><p>BC-#34</p></td></tr>
٤٠٦٩
-٤٤٧-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-N-methyl-L-valyl-N-[(3R,4S,5S)-1-{(2S)- 2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-</p><p>3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>[M+H+] 1031.7: LC-MS</p><p>0.88([M+Na+] 1054.8</p><p dir="rtl">Flour(Proteofoil D): 10.559 min</p></td><td><p>MalPeg3C2</p><p>-#41</p></td></tr>
٤٠٦٩
-٤٤٨-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- N-methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S) -1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N- methyl-L-valinamide</p></td><td><p>[M+H+]1178.2: LC-MS</p><p>3.50([M+Na+] 1197.4</p><p dir="rtl">Flour, HPLC (Protofood Q): 25.235 minutes</p></td><td><p>MalPeg6C2</p><p>-#42</p></td></tr>
٤٠٦٩
-٤٤٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy- 2-methyl-3-thioxopropyl]pyrrolidiN-1-yl}-3-methoxy-5-methyl-1-oxoheptaN-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p>[M+H+] 913.7: LC-MS</p><p dir="rtl">0.85 minutes (; HRMS: 913.5103 [+M+H], notes: 913.5103.</p></td><td><p>mc-#44</p></td></tr><tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-2-methylalanyl-N-</p><p>[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-</p><p>phenylethyl]amino}-1-methoxy-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>[M+H+] LC-MS: 1003.8</p><p dir="rtl">(0.82 min); HPLC (Protocol</p><p>,[M+H+] 1003.5:)A</p><p>9.095([M+Na+]1026.4</p><p dir="rtl">minute(</p></td><td><p>MalPeg3C2</p><p>-#44</p></td></tr>
٤٠٦٩
-٤٥٠-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methylalanyl-N-[(3R,4S,5S)-</p><p>1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-thioxopropyl]pyrrolidin-1 -yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p>[M+H+] LC-MS: 1135.8</p><p dir="rtl">(0.83 minutes)</p></td><td><p>MalPeg6C2</p><p>-#44</p></td></tr>
٤٠٦٩
-٤٥١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-)</p><p>dihydro-1H-pyrrol-1-</p></td><td></td><td></td></tr><tr><td><p>yl)hexanoyl]-L-valyl-N-{4-</p></td><td></td><td></td></tr><tr><td><p>[(8S,11S,12R)-11-[(2S)-</p></td><td></td><td></td></tr><tr><td><p>butaN-2-yl]-12-(2-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2 -methyl-3-</p><p>thioxopropyl]pyrrolidiN-1-yl}-2-oxoethyl)-5,5,10-trimethyl-</p></td><td><p>[M+H+] LC-MS: 1318.9</p><p dir="rtl">(0.89 min); HPLC (Protocol</p><p>,[M+H+] 1319.6 :)A</p><p>9.132([M+Na+]1342.6</p><p dir="rtl">minute(</p></td><td><p>MalValCitPA</p><p>BC-#44</p></td></tr><tr><td><p>3,6,9-trioxo-8-(propaN-2-</p></td><td></td><td></td></tr><tr><td><p>yl)-2,13-dioxa-4,7,10-</p></td><td></td><td></td></tr><tr><td><p>triazatetradec-1-yl]phenyl}-</p></td><td></td><td></td></tr><tr><td><p>N5-carbamoyl-L-</p></td><td></td><td></td></tr><tr><td><p>ornithinamide</p></td><td></td><td></td></tr>
٤٠٦٩
-٤٥٢-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1- {(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropaN-2-yl]amino}-2-methyl-3 -thioxopropyl]pyrrolidiN-1-yl}-5-methyl-1-oxoheptaN-4-yl]-N-methyl-L-valinamide</p></td><td><p>[M+H+] 927.7: LC-MS</p><p dir="rtl">0.92 minutes (HRMS: Malaysian language) GFV: 927.5260 [+M+H], 927.5259</p></td><td><p>mc-#45</p></td></tr><tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-2-methylalanyl-N -</p><p>[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3 -</p><p>phenylpropan-2-yl]amino}-2-methyl-3-</p><p>thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>[M+H+]1017.8: LC-MS</p><p dir="rtl">(0.90 min);</p></td><td><p>MalPeg3C2</p><p>-#45</p></td></tr>
٤٠٦٩
-٤٥٣-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methylalanyl-N-[(3R,4S,5S)-</p><p>3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino} -2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>[M+H+]1149.9: LC-MS</p><p dir="rtl">(0.9 minutes); HPLC (Violet Protein A) Tomorrow 45°C(:</p><p>,[M+H+]1150.5</p><p>9.788([M+Na+]1171.5</p><p dir="rtl">minute(</p></td><td><p>MalPeg6C2</p><p>-#45</p></td></tr>
٤٠٦٩
-٤٥٤-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-3-</p><p>{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-5,5,10 -trimethyl-</p><p>3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-</p><p>triazatetradec-1-yl]phenyl}-N5-carbamoyl-L-ornithinamide</p></td><td><p>[M+H+]1332.8: LC-MS</p><p dir="rtl">(1.86 min); HPLC (Protocol A at 45°C): 1333.6 [+9.737] [M+H min]</p></td><td><p>mcValCitPA</p><p>BC-#45</p></td></tr>
٤٠٦٩
-٤٥٥-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-</p><p>[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-</p><p>phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin -1-yl}-2-oxoethyl)-5,5,10-</p><p>trimethyl-3,6,9-trioxo-8-</p><p>(propan-2-yl)-2,13-dioxa-</p><p>4,7,10-triazatetradec-1-</p><p>yl]phenyl}-N5-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protooxyl A at 45°C): [+1342.6[M+H (9.114 min)</p></td><td><p>mcValCitPA</p><p>BC-#54</p></td></tr>
٤٠٦٩
-٤٥٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy- 2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p>LC-MS: [M+H+] 897.7</p><p dir="rtl">919.7 (0.81 min) (: 897.5 [+9.058) [M+H minutes]</p></td><td><p>mc-#69</p></td></tr><tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methylalanyl-N-[(3R,4S,5S)-</p><p>1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1 -yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol A) at 45°C (Wifi) 1120.6 [+,[M+H 1142.5 (9.076 minutes)</p></td><td><p>MalPeg6C2</p><p>-#69</p></td></tr>
٤٠٦٩
-٤٥٧-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-N-methyl-L-valyl-N-[(3R,4S,5S)-1-{(2S)- 2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidiN-1-yl}-3-methoxy-5-methyl-1-oxoheptaN-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol 1326.6: (M [+11.962) [M+Na min)</p></td><td><p>mcValCitPA</p><p>BC-#69</p></td></tr>
٤٠٦٩
-٤٥٨-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butaN-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-3-</p><p>{[(2S)-1-methoxy-1-oxo-3-phenylpropaN-2-yl]amino}-2-methyl-3-</p><p>oxopropyl]pyrrolidiN-1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propaN-2-yl)-2,13-dioxa-4,7, 10-triazatetradec-1-yl]phenyl}-N5-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol A) at 45°C 1317.6 [+[M+H (9.282 minutes)</p></td><td><p>mcValCitPA</p><p>BC-#70</p></td></tr>
٤٠٦٩
-٤٥٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N5-carbamoyl-N-{4-[({[3-({ (2S)-1-[{(3R,4S,5S)-3-methoxy-</p><p>1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-oxo-3-[(2-phenylethyl)amino]propyl}pyrro lidin-1-yl]-5- methyl-1-oxoheptan-4-yl}(methyl)amino]-3-methyl-1-oxobutan-2-yl}carbamoyl)oxetan-3-yl]carbamoyl}oxy)methyl]pheny l}-L-ornithinamide</p></td><td><p>[M+H+] LC-MS: 1273.9</p><p dir="rtl">(0.82 min); HPLC (Protocol A 45°C, [M+H] min)</p></td><td><p>mcValCitPA</p><p>BC-#75</p></td></tr>
٤٠٦٩
-٤٦٠-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy- 1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropaN-2-yl]amino}-2-methyl -3-thioxopropyl]pyrrolidiN-1-yl}-</p><p>5-methyl-1-oxoheptaN-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol A) at 45°C 941.5 [+,[M+H]</p><p>10.444([M+Na+] 963.4</p><p dir="rtl">minute(</p></td><td><p>mc-#79</p></td></tr>
٤٠٦٩
-٤٦١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-</p><p>[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1- yl}-2-oxoethyl)-4,5,5,10-tetramethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec- 1-yl]phenyl}-N5-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol 1346.6: A [+9.807), [M+H min]</p></td><td><p>mcValCitPA</p><p>BC-#79</p></td></tr>
٤٠٦٩
-٤٦٢-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-</p><p>[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-(quinolin-6-)</p></td><td><p>[M+H+] LC-MS: 1282.6</p><p dir="rtl">(0.79 min); HPLC (Protocol</p></td><td><p>mcValCitPA</p></td></tr><tr><td><p>ylamino)propyl]pyrrolidin-1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-</p><p>(propan-2-yl)-2,13-dioxa-</p><p>4,7,10-triazatetradec-1-</p><p>yl]phenyl}-N5-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">A temperature: 45°C: 1282.6</p><p dir="rtl">[+7.953([M+H min)</p></td><td><p>BC-#92</p></td></tr>
٤٠٦٩
-٤٦٣-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2 -methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7, 10-triazatetradec-1-yl]phenyl}-N5-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol 1288.6): M</p><p>[M+Na+] 1310.6, [M+H+]</p><p dir="rtl">(11.757 minutes)</p></td><td><p>mcValCitPA</p><p>BC-#112</p></td></tr>
٤٠٦٩
-٤٦٤-
<tr><td><p>N-[5-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)pentanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-</p><p>4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol A) at 45°C Wave: 897.5 m/z</p><p dir="rtl">[+9.149 minutes, [M+H]</p></td><td><p>mv-#115</p></td></tr><tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-</p><p>dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy- 2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol A) at 45°C 911.5 m/z</p><p dir="rtl">[+9.676 minutes, [M+H]</p></td><td><p>mc-#115</p></td></tr>
٤٠٦٩
-٤٦٥-
<tr><td><p>N-[4-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)butanoyl]-N,2-dimethylalanyl-N-{(1S,2R)-</p><p>4-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-2-methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-methyl-L-valinamide</p></td><td></td><td><p>mb-#115</p></td></tr><tr><td><p>N-[7-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)heptanoyl]-N,2-</p><p>dimethylalanyl-N-{(1S,2R)-4-{(2S)-2-[(1R,2R)-3-</p><p>{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-</p><p>methoxy-1-[(1S)-1-methylpropyl]-4-oxobutyl}-N-</p><p>methyl-L-valinamide</p></td><td></td><td><p>me-#115</p></td></tr>
٤٠٦٩
-٤٦٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrro</p><p>lidin-1-yl}-2-oxoethyl)-4,5,5,10-tetramethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7, 10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.261(1317.7 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#115</p></td></tr>
٤٠٦٩
-٤٦٧-
<tr><td><p>N~2~-[(1-{[6-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]amino}cyclopropyl) carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl] amino}propyl]pyrrolidin-1-yl}-</p><p>5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z: (M [+11.94) 934.5 [M+H min)</p></td><td><p>mc-#51</p></td></tr><tr><td><p>N~2~-[(1-{[6-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]amino}cyclopentyl)carbonyl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl] amino}propyl]pyrrolidin-1-yl}-</p><p>5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>13.014(962.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mc-#47</p></td></tr>
٤٠٦٩
-٤٦٨-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-3-methoxy-</p><p>1-{(2S)-2-[(1R,2R)-1-</p><p>methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-</p><p>yl)ethyl]amino}propyl]pyrroli din-1-yl}-5-methyl-1-</p><p>oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z: (M [+9.22) 936.5 [M+H min)</p></td><td><p>mc-#54</p></td></tr>
٤٠٦٩
-٤٦٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-[4-({[(1) -{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo -3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl )ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl ](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}cyclopentyl)carba moyl]oxy}methyl)phenyl]-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>13.157(1368.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#47</p></td></tr>
٤٠٦٩
-٤٧٠-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(5S,8S,11S,12R)-11 -[(2S)-butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-</p><p>methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-t hioxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-4 10-dimethyl-3,6,9-trioxo-5,8-di(propan-)</p><p>2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>16.21(1386.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#26</p></td></tr>
٤٠٦٩
-٤٧١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N-methyl-L-valyl-N-[(3R,4S,5S)-3- methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl) )ethyl]amino}-3-thioxopropyl]py rrolidin-1-yl}-5-methyl-1-</p><p>oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (protocol *m/z):A</p><p>10.628(980.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mc-#26</p></td></tr>
٤٠٦٩
-٤٧٢-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(5S,8S,11S,12R)-11-[(2S)-butan-2-yl]-12-(2-{(2S)-2 -[(1R,2R)-1-methoxy-3-</p><p>{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-thioxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-4,10-dimethyl -3,6,9-trioxo-5,8-di(propan-</p><p>2-yl)-2,13-dioxa-4,7,10-</p><p>triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (protocol *m/z):A</p><p>9.831(1361.7 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#42</p></td></tr>
٤٠٦٩
-٤٧٣-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(5S,8S,11S,12R)-11 -[(2S)-butan-2-yl]-12-{2-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-[(2-phenylethyl)amino] -3-thioxopropyl}pyrrolidin-1-yl]-2-oxoethyl}-4,10-dimethyl-3,6,9-trioxo-5,8-di(propan-2-yl)-2,13-dioxa- 4,7,10-triazatetradec-1-yl]phenyl}-</p><p>N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (protocol *m/z):A</p><p>9.987(1324.6 [M+Na+23]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#36</p></td></tr>
٤٠٦٩
-٤٧٤-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-N-methyl-L-</p><p>valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-</p><p>methyl-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (protocol *m/z):A</p><p>10.679(955.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mc-#42</p></td></tr><tr><td><p>N-(21-amino-</p><p>4,7,10,13,16,19-hexaoxahenicosan-1-oyl)-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R) ,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolid in-1-yl}-5-methyl-1 -oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>2.56(1078.7 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AmPeg6C2-</p><p>#54</p></td></tr>
٤٠٦٩
-٤٧٥-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)- 2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-</p><p>{[(1S)-2-phenyl-1-(1,3-thiazol-</p><p>2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>3.54(1026.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg3C2</p><p>-#54</p></td></tr>
٤٠٦٩
-٤٧٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(30S,33S,34R)-33-[ (2S)-butan-2-yl]-34-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-2-</p><p>oxoethyl)-27,27,32-trimethyl-3,25,28,31-tetraoxo-30-(propan-2-yl)-2,7,10,13,16,19,22,35-octaoxa-4 ,26,29,32-</p><p>tetraazahexatriacont-1-</p><p>yl]phenyl}-N~5~-carbamoyl-</p><p>L-ornithinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>3.48(1677.9 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BCAmPeg6</p><p>C2-#54</p></td></tr>
٤٠٦٩
-٤٧٧-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(21S,24S,25R)-24-[ (2S)-butan-2-yl]-25-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-2-</p><p>oxoethyl)-18,18,23-trimethyl-3,16,19,22-tetraoxo-21-(propan-2-yl)-2,7,10,13,26-pentaoxa-4,17,20,23 -tetraazaheptacos-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.48) 1545.8[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg3</p><p>C2-#54</p></td></tr>
٤٠٦٩
-٤٧٨-
<tr><td><p>N~2~-[(1-{[3-(2-{2-[2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]amino}cyclopentyl)carbon yl]-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-ph enyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl [pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol m/z: Q1).</p><p>0.88(1052.7 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg3C2</p><p>-#47</p></td></tr>
٤٠٦٩
-٤٧٩-
<tr><td><p>1-amino-N-(1-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy -2-methyl-3-oxo-3-</p><p>{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl](methyl )ami no}-3-methyl-1-oxobutan-2-yl]carbamoyl}cyclopentyl)-3,6,9,12,15,18-hexaoxahenicosan-21-amide</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>2.65(1104.88 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AmPeg6C2-</p><p>#47</p></td></tr>
٤٠٦٩
-٤٨٠-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-(4-{16-[( 1-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3- oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p></td><td><p>mcValCitPA</p></td></tr><tr><td><p>yl)ethyl]amino}propyl]pyrrolidin</p></td><td><p>3.56(1571.8 [M+H+]</p></td><td><p>BCAmPeg3</p></td></tr><tr><td><p>-1-yl}-5-methyl-1-oxoheptan-4-</p><p>yl](methyl)amino}-3-methyl-1-oxobutan-2-</p><p>yl]carbamoyl}cyclopentyl)amin o]-3,16-dioxo-2,7,10,13-tetraoxa-4-azahexadec-1-yl}phenyl)-L-ornithin amide</p></td><td><p dir="rtl">minute(</p></td><td><p>C2-#47</p></td></tr>
٤٠٦٩
-٤٨١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-)</p><p>dihydro-1H-pyrrol-1-</p></td><td></td><td></td></tr><tr><td><p>yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-(4-{25-[(1-{[(2S)-1-{[(3R,4S,5S)-3-methoxy- 1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-</p></td><td></td><td><p>mcValCitPA</p></td></tr><tr><td><p>yl)ethyl]amino}propyl]pyrrolidin</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p></td><td rowspan="2"><p>BCAmPeg6</p><p>C2-#47</p></td></tr><tr><td><p>-1-yl}-5-methyl-1-oxoheptan-4-</p><p>yl](methyl)amino}-3-methyl-</p><p>1-oxobutan-2-</p><p>yl]carbamoyl}cyclopentyl)amin o]-3,25-dioxo-</p><p>2,7,10,13,16,19,22-</p><p>heptaoxa-4-azapentacos-1-yl}phenyl)-L-ornithinamide</p></td><td><p dir="rtl">[+3.57(1703.8 [M+H min)</p></td></tr>
٤٠٦٩
-٤٨٢-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-N-methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{ (2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]a mino}-2-methyl-3 -</p><p>thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.92) 1045.7[M+H min)</p></td><td><p>MalPeg3C2</p><p>-#42</p></td></tr>
٤٠٦٩
-٤٨٣-
<tr><td><p>N-(21-amino-</p><p>4,7,10,13,16,19-</p><p>hexaoxahenicosan-1-oyl)-N-methyl-L-valyl-N-</p><p>[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3 -</p><p>phenylpropan-2-yl]amino}-2-</p><p>methyl-3-thioxopropyl]py rrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+2.80) 1097.7[M+H min)</p></td><td><p>AmPeg6C2-</p><p>#42</p></td></tr>
٤٠٦٩
-٤٨٤-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(27S,30S,33S,34R)-33 -</p><p>[(2S)-butan-2-yl]-34-(2-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo -3-</p><p>phenylpropan-2-yl]amino}-2-methyl-</p><p>3-thioxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-26,32-dimethyl-3,25,28,31-tetraoxo-27,30-di(propan-2-yl)-2,7,10 ,13,16,19,22,35-octaoxa-4,26,29,32-</p><p>tetraazahexatriacont-1-</p><p>yl]phenyl}-N~5~-carbamoyl-</p><p>L-ornithi</p><p>name</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.73) 1696.8[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg6</p><p>C2-#42</p></td></tr>
٤٠٦٩
-٤٨٥-
<tr><td><p>N-[6-(2,5-dioxo-2,5-)</p></td><td></td><td></td></tr><tr><td><p>dihydro-1H-pyrrol-1-</p></td><td></td><td></td></tr><tr><td><p>yl)hexanoyl]-L-valyl-N-{4-</p></td><td></td><td></td></tr><tr><td><p>[(18S,21S,24S,25R)-24-</p><p>[(2S)-butan-2-yl]-25-(2-</p></td><td></td><td></td></tr><tr><td><p>{(2S)-2-[(1R,2R)-1-</p><p>methoxy-3-{[(2S)-1-</p></td><td></td><td></td></tr><tr><td><p>methoxy-1-oxo-3-</p><p>phenylpropan-2-yl]amino}-2-</p><p>methyl-</p><p>3-thioxopropyl]pyrrolidin-1-</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.70) 1564.8[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg3</p><p>C2-#42</p></td></tr><tr><td><p>yl}-2-oxoethyl)-17,23-</p></td><td></td><td></td></tr><tr><td><p>dimethyl-3,16,19,22-</p></td><td></td><td></td></tr><tr><td><p>tetraoxo-18,21-di(propan-2-</p></td><td></td><td></td></tr><tr><td><p>yl)-2,7,10,13,26-pentaoxa-</p></td><td></td><td></td></tr><tr><td><p>4,17,20,23-tetraazaheptacos-</p></td><td></td><td></td></tr><tr><td><p>1-yl]phenyl}-N~5~-</p></td><td></td><td></td></tr><tr><td><p>carbamoyl-L-ornithinamide</p></td><td></td><td></td></tr>
٤٠٦٩
-٤٨٦-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-N-methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{ (2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl )ethyl]amino} -3-thioxopropyl]pyrrolidin-1-yl}-</p><p>5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.94) 1070.6[M+H min)</p></td><td><p>MalPeg3C2</p><p>-#26</p></td></tr><tr><td><p>N-[6-(2,5-dioxo-2,5-)</p><p>dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-N-methyl-L-</p><p>valyl-N-[(3R,4S,5S)-1-</p><p>{(2S)-2-[(1R,2R)-3-{[(1S)-</p><p>1-carboxy-2-</p><p>phenylethyl]amino}-1-</p><p>methoxy-2-methyl-3-</p><p>thioxopropyl]pyrrolidin-1-yl}-</p><p>3-meth</p><p>oxy-5-methyl-1-oxoheptan-</p><p>4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z: (A [+9.883) 941.5 [M+H min)</p></td><td><p>mc-#41</p></td></tr>
٤٠٦٩
-٤٨٧-
<tr><td><p>N-(21-amino-4,7,10,13,16,19-</p><p>hexaoxahenicosan-1-oyl)-N-methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy- 2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyr rolidin-1-yl}-5-methyl- 1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+2.76) 1122.6[M+H min)</p></td><td><p>AmPeg6C2-</p><p>#26</p></td></tr>
٤٠٦٩
-٤٨٨-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(18S,21S,24S,25R)-24-</p><p>[(2S)-butan-2-yl]-25-(2-</p><p>{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino }-3-thioxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-17,23-dimethyl-3,16,19,22-tetraoxo-18,21-di(propan-2-yl)-2,7 ,10,13,26-pentaoxa-</p><p>4,17,20,23-tetraazaheptacos-</p><p>1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.74) 1588.0[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg3</p><p>C2-#26</p></td></tr>
٤٠٦٩
-٤٨٩-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-L-valyl-N-{4-[(5S,8S,11S,12R)-11-[(2S) -butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2-phenyl-1-(1, 3-thiazol-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin -1-</p><p>yl}-2-oxoethyl)-4,10-dimethyl-3,6,9-trioxo-5,8-</p><p>di(propan-2-yl)-2,13-dioxa-</p><p>4,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.81) 1476.8[M+H min)</p></td><td><p>MalPeg3C2</p><p>ValCitPABC</p><p>-#26</p></td></tr>
٤٠٦٩
-٤٩٠-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(27S,30S,33S,34R)-33 -[(2S)-butan-2-yl]-34-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2- phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}-3</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p></td><td><p>mcValCitPA</p></td></tr><tr><td><p>-thioxopropyl]pyrrolidin-1-yl}-</p></td><td rowspan="2"><p dir="rtl">[+3.75(1721.9 [M+H min)</p></td><td><p>BCAmPeg6</p></td></tr><tr><td><p>2-oxoethyl)-26,32-dimethyl-</p><p>3,25,28,31-tetraoxo-27,30-di(propan-2-yl)-</p><p>2,7,10,13,16,19,22,35-</p><p>octaoxa-4,26,29,32-</p><p>tetraazahexatriacont-1-</p><p>yl]phenyl}-N~5~-carbamoyl-L-ornithin</p><p>amide</p></td><td><p>C2-#26</p></td></tr>
٤٠٦٩
-٤٩١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-N-methyl-L-</p><p>valyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-</p><p>{(1R,2R)-1-methoxy-2-methyl-3-[(2-phenylethyl)amino]-3-thioxopropyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}- N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z(Q1): 897.7[M+H min)</p></td><td><p>mc-#36</p></td></tr>
٤٠٦٩
-٤٩٢-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methylalanyl-N-[(3R,4S,5S)-</p><p>3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3) -th iazol-2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.55) 1158.7[M+H min)</p></td><td><p>MalPeg6C2</p><p>-#54</p></td></tr>
٤٠٦٩
-٤٩٣-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-L-valyl-N~5~-carbamoyl-N-[4-({[(1-{[(2S) )-1-{[(3R,4S,5S)-3-methoxy-</p><p>1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1</p><p>S)-2-phenyl-1-(1,3-thiazol-</p><p>2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-</p><p>yl](methyl)amino}-3-methyl-1-oxobutan-2-</p><p>yl]carbamoyl}cyclopentyl)carba moyl]oxy}methyl)phenyl]-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.56) 1458.7[M+H min)</p></td><td><p>MalPeg3C2</p><p>ValCitPABC</p><p>-#47</p></td></tr>
٤٠٦٩
-٤٩٤-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-N-methyl-L-valyl-N-{(3R,4S,5S)-3-methoxy-1-[ (2S)-2-{(1R,2R)-1-</p><p>methoxy-2-methyl-3-[(2-phenylethyl)amino]-3-thioxoprop</p><p>yl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.97) 987.7[M+H min)</p></td><td><p>MalPeg3C2</p><p>-#36</p></td></tr>
٤٠٦٩
-٤٩٥-
<tr><td><p>1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-N-(1-{[(2S)-1-{[(3R,4S,5S)-3-methoxy -</p><p>1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-</p><p>{[(1S)-2-phenyl-1-(1,3-</p><p>thiazol-2-</p><p>yl)ethyl]amino}propyl]pyrrolidin</p><p>-1-yl}-5-me</p><p>thyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-</p><p>yl]carbamoyl}cyclopentyl)-3,6,9,12,15,18-</p><p>hexaoxahenicosan-21-amide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.67) 1184.7[M+H min)</p></td><td><p>MalPeg6C2</p><p>-#47</p></td></tr>
٤٠٦٩
-٤٩٦-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- N-methyl-L-valyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{ [(1S)-2-phenyl-1-(1,3-thiazo l-2-yl)ethyl]amino}-3-thioxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl ]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.93) 1202.7[M+H min)</p></td><td><p>MalPeg6C2</p><p>-#26</p></td></tr><tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- N-methyl-L-valyl-N-{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-[ (2-phenylethyl)amino]-3-thio xopropyl}pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl}-</p><p>N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol: m/z (H [3.96) 1118.8 [MH min)</p></td><td><p>MalPeg6C2</p><p>-#36</p></td></tr>
٤٠٦٩
-٤٩٧-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(18S,21S,24S,25R)-24-[(2S)-butan-2-yl]-25-{2-[(2S)-2 -{(1R,2R)-1-</p><p>methoxy-2-methyl-3-[(2-phenylethyl)amino]-3-thioxopropyl}pyrrolidin-1 -yl]-2-oxoethyl}-17,23-</p><p>dimethyl-3,16,19,22-</p><p>tetraoxo-18,21-di(propan-2-yl)-2,7,10,13,26-pentaoxa-</p><p>4,17,20,23-tetraazaheptacos-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.76) 1506.8[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg3</p><p>C2-#36</p></td></tr>
٤٠٦٩
-٤٩٨-
<tr><td><p>N-(21-amino-</p><p>4,7,10,13,16,19-hexaoxahenicosan-1-oyl)-N-methyl-L-valyl-N-</p><p>{(3R,4S,5S)-3-methoxy-1-[(2S)-2-{(1R,2R)-1-methoxy-2-methyl-3-[(2-phenylethyl)amino]-3- thioxopropyl}pyrrolidin-1-yl]-5-methyl-1-o</p><p>xoheptan-4-yl}-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+2.68) 1039.7[M+H min)</p></td><td><p>AmPeg6C2-</p><p>#36</p></td></tr>
٤٠٦٩
-٤٩٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[ (2S)-butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1-phenylcyclopropyl) )methyl]amin o}propyl]pyrrol idin-1-yl}-2-oxoethyl)-</p><p>5,5,10-trimethyl-3,6,9-trioxo-</p><p>8-(propan-2-yl)-2,13-dioxa-</p><p>4,7,10-triazatetradec-1-</p><p>yl]phenyl}-N~5~-carbamoyl-</p><p>L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.696(1307.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#60</p></td></tr>
٤٠٦٩
-٥٠٠-
<tr><td><p>N-[6-(2,5-dioxo-2,5-)</p><p>dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(27S,30S,33S,34R)-33-</p><p>[(2S)-butan-2-yl]-34-{2-</p><p>[(2S)-2-{(1R,2R)-1-</p><p>methoxy-2-methyl-3-[(2-</p><p>phenylethyl)amino]-3-thioxopropyl}pyrrolidin-1 -yl]-2-oxoethyl}-26,32-</p><p>dimethyl-3,25,28,31-</p><p>tetraoxo-27,30-di(propan-2-yl)-2,7,10,13,16,19,22,35-octaoxa-4,26,29,32-</p><p>tetraazahexatriacont-1-</p><p>yl]phenyl}-N~5~-carbamoyl-</p><p>L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.77) 1638.0[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg6</p><p>C2-#36</p></td></tr>
٤٠٦٩
-٥٠١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(18S,21S,24S,25R)-24-[(2S)-butan-2-yl]-25-(2-</p><p>{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-thioxoprop yl]pyrrolidin-1- yl}-2-oxoethyl)-17,23-dimethyl-</p><p>3,16,19,22-tetraoxo-18,21-di(propan-2-yl)-</p><p>2,7,10,13,26-pentaoxa-4,17,20,23-tetraazaheptacos-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.53) 1550.9[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg3</p><p>C2-#41</p></td></tr>
٤٠٦٩
-٥٠٢-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1-phenylcyclopropyl)me thyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan- 4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.66) 1101.8[M+H min)</p></td><td><p>MalPeg6C2</p><p>-#60</p></td></tr><tr><td><p>N-(21-amino-4,7,10,13,16,19-</p><p>hexaoxahenicosan-1-oyl)-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1-phenylcyclopropyl)methyl]amin o}propyl]pyrrolidin-1-yl}-5-m ethyl-1-oxoheptan -4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+2.57) 1021.7[M+H min)</p></td><td><p>AmPeg6C2-</p><p>#60</p></td></tr>
٤٠٦٩
-٥٠٣-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)- 2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1-phenylcyclopropyl)methyl]a mino}propyl]pyrrolidin-1-yl}-</p><p>5-methyl-1-oxoheptan-4-</p><p>yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.65) 969.7[M+H min)</p></td><td><p>MalPeg3C2</p><p>-#60</p></td></tr>
٤٠٦٩
-٥٠٤-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- N-methyl-L-valyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl ]amino}-1-methoxy-2-methyl-3 -thioxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol: m/z (H [3.70) 1163.0 [MH min)</p></td><td><p>MalPeg6C2</p><p>-#41</p></td></tr>
٤٠٦٩
-٥٠٥-
<tr><td><p>N-(21-amino-</p><p>4,7,10,13,16,19-hexaoxahenicosan-1-oyl)-2-methylalanyl-N-[(3R,4S,5S)-</p><p>1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl- 3-oxopropyl]pyrrolidin-1-yl}-3-</p><p>me</p><p>thoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1009.8 [M+H min)</p></td><td><p>AmPeg6C2-</p><p>#66</p></td></tr>
٤٠٦٩
-٥٠٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-)</p><p>dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(30S,33S,34R)-33-[(2S)-butan-2-yl]-34-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1-phenylcyclopropyl)methyl]amin o}propyl]pyrro</p><p>lidin-1-yl}-2-oxoethyl)-27,27,32-trimethyl-</p><p>3,25,28,31-tetraoxo-30-</p><p>(propan-2-yl)-</p><p>2,7,10,13,16,19,22,35-octaoxa-4,26,29,32-</p><p>tetraazahexatriacont-1-</p><p>yl]phenyl}-N~5~-carbamoyl-</p><p>L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+3.55) 1621.0[M+H min)</p></td><td><p>mcValCitPA</p><p>BCAmPeg6</p><p>C2-#60</p></td></tr>
٤٠٦٩
-٥٠٧-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo -3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrol idin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>11.847(911.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mc-#70</p></td></tr><tr><td><p>N-(24-bromo-23-oxo-4,7,10,13,16,19-hexaoxa-</p><p>22-azatetracosan-1-oyl)-2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2) ,4,6-trien-1-</p><p>yl)ethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrol idin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L- valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1129.8 [M+H min)</p></td><td><p>2AcAmPeg6</p><p>C2-#66</p></td></tr>
٤٠٦٩
-٥٠٨-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl] amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-</p><p>m</p><p>ethoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z (Q1: 867.7 [+0.90) [M+H min])</p></td><td><p>mc-#66</p></td></tr>
٤٠٦٩
-٥٠٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}p ropyl]pyrrolidin-1-yl}-2-</p><p>oxoethyl)-4,5,5,10-tetramethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-yl]phenyl }-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1355.9 [M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#88</p></td></tr>
٤٠٦٩
-٥١٠-
<tr><td><p>N-{6-[(bromoacetyl)amino]hexanoyl} -L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-butan-2-yl]-12-(2 -{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6-trien-1-yl)ethyl]amino}-1-methoxy-2-methyl-3 -oxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7 ,10-triazatetradec-1-</p><p>yl]phenyl}-N~5~-carbamoyl-</p><p>L-ornithinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1314.9 [M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#88</p></td></tr>
٤٠٦٩
-٥١١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1- {(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-(quinolin-6-ylamino)propyl]pyrrolidin-1-yl}-5-methyl-1- oxohept an-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol m/z (Q1: 876.7 [+0.75) [M+H min])</p></td><td><p>mc-#92</p></td></tr>
٤٠٦٩
-٥١٢-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-3-{[(1S)-1-carboxy-2-</p><p>phenylethyl]amino}-1-methoxy-2-methyl-3-thioxopropyl]py</p><p>rrolidin-1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-</p><p>4,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:A).</p><p>9.174(1318.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#44</p></td></tr>
٤٠٦٩
-٥١٣-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(R)-(7S)-bicyclo[4.2.0]octa-1,3 ,5-trien-7-</p><p>yl(carboxy)methyl]amino}-1-methoxy-2-methyl-3-oxoprop yl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl- L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z: (A [+9.063) 909.5 [M+H min)</p></td><td><p>mc-#108</p></td></tr>
٤٠٦٩
-٥١٤-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-12-( 2-{(2S)-2-[(1R,2R)-3-{[(R)-(7S)-bicyclo[4.2.0]octa-1,3,5-trien-7-yl(carboxy) methyl]amino}-1-methoxy-2-methyl-3-oxopr opyl]pyrrolidin-1-yl}-2-oxoethyl)-11-[(2S)-butan-2-yl]-5,5,10- trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L- ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>11.89(1315.7 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#108</p></td></tr>
٤٠٦٩
-٥١٥-
<tr><td><p>N-[3-(2-{3-[(2,5-dioxopyrrolidin-1-yl)oxy]-3-oxopropoxy}ethoxy)propanoyl] -L-valyl-N-{4-[(8S,11S, 12R)-11-[(2S)-butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-3-{[2-(cyclohepta-2,4,6) -trien-1-yl)ethyl]amino}-1-metho xy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-2-</p><p>oxoethyl)-5,5,10-trimethyl-</p><p>3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-yl]phenyl}-</p><p>N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>10.03(683.3 [M+H+2]</p><p dir="rtl">minute(</p></td><td><p>NHSCOPeg</p><p>2C2ValCitP</p><p>ABC-#66</p></td></tr>
٤٠٦٩
-٥١٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-{4-[({[( 2S)-2-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol -2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-</p><p>2-methylpyrrolidin-1-yl]carbonyl}oxy)methyl]phenyl}-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.504(1368.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#98</p></td></tr>
٤٠٦٩
-٥١٧-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(9S,12S,13R)-12-[ (2S)-butan-2-yl]-13-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}p ropyl]pyrrolidin-1-yl}-2-</p><p>oxoethyl)-6,6,11-trimethyl-</p><p>3,7,10-trioxo-9-(propan-2-yl)-2,14-dioxa-4,8,11-triazapentadec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.79) 1356.5[M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#95</p></td></tr>
٤٠٦٩
-٥١٨-
<tr><td><p>N-[3-(2-{2-[2-(2,5-dioxo-)</p><p>2,5-dihydro-1H-pyrrol-1-yl)ethoxy]ethoxy}ethoxy)propa noyl]-2-methylalanyl-N-</p><p>[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-</p><p>methoxy-2-methyl-3-oxoprop yl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>10.702(987.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg3C2</p><p>-#69</p></td></tr><tr><td><p>N-(21-amino-4,7,10,13,16,19-</p><p>hexaoxahenicosan-1-oyl)-2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy- 2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>2.12(1040.1 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AmPeg6C2-</p><p>#69</p></td></tr>
٤٠٦٩
-٥١٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[ (2S)-butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-{[(1S)-2-phenyl- 1-(1,3-thiazol-2-yl)ethyl]amino}-3-thio xopropyl]pyrrolidin-1-yl}-2-oxoethyl)-4,5,5,10-tetramethyl-3,6,9 -trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-</p><p>yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.89) 1371.4[M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#84</p></td></tr>
٤٠٦٩
-٥٢٠-
<tr><td><p>N-(6-aminohexanoyl)-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-butan-2-yl]-12-(2-{(2S)- 2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino} propyl]pyrrolidin -1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7, 10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+2.35) 1262.3[M+H min)</p></td><td><p>AmCapValCi tPABC-#54</p></td></tr>
٤٠٦٩
-٥٢١-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-</p><p>[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxo propyl]pyrrolidin-1 -yl}-2-oxoethyl)-4,5,5,10-tetramethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec -1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(H[+1.77) 1330.9[M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#226</p></td></tr>
٤٠٦٩
-٥٢٢-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-{4-[({[( 2S)-2-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{ [(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]am ino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4- yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-2-methylpyrrolidin-1-yl]carbonyl}oxy)methyl]phenyl} -L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.80) 1342.6[M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#117</p></td></tr>
٤٠٦٩
-٥٢٣-
<tr><td><p>1-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo -3-</p><p>{[(1S)-2-phenyl-1-(1,3</p><p>-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>11.985(1185.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg6C2</p><p>-#98</p></td></tr>
٤٠٦٩
-٥٢٤-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-{4-[({[(2S)-2-{[(2S)-1-{[(3R,4S,5S)-1 -{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-</p><p>methoxy-2-methyl-3-oxopro pyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2- yl]carbamoyl}-2-methylpyrrolidin-1-yl]carbonyl}oxy)methyl]phenyl}-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.68(1328.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#118</p></td></tr>
٤٠٦٩
-٥٢٥-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-</p><p>butan-2-yl]-12-(2-{(2S)-2-</p><p>[(1R,2R)-3-{[(1S)-1-carboxy-2-</p><p>phenylethyl]amino}-1-methoxy-2-methyl-3-thioxopropyl]py rrolidin-1-yl}-2-oxoethyl)-4,5,5,10-tetramethyl-3,6,9-trioxo-8- (propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-</p><p>1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.751(1353.6 [M+Na+]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#80</p></td></tr>
٤٠٦٩
-٥٢٦-
<tr><td><p>1-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methyl-L-prolyl-N-</p><p>[(3R,4S,5S)-1-{(2S)-2-</p><p>[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5 -methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.66(1145.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg6C2</p><p>-#118</p></td></tr>
٤٠٦٩
-٥٢٧-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(R)-carboxy(1-phenylcyclopropyl)methyl]amin o} -1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.071(1146.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg6C2</p><p>-#230</p></td></tr>
٤٠٦٩
-٥٢٨-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-{4-[({[( 2R)-2-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl -3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol -2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-</p><p>2-methylpyrrolidin-1-yl]carbonyl}oxy)methyl]phenyl}-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.81) 1367.3[M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#232</p></td></tr>
٤٠٦٩
-٥٢٩-
<tr><td><p>1-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-2-methyl-L-</p><p>prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyr rolidin-1 -yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.91) 937.4[M+H min)</p></td><td><p>mc-#117</p></td></tr>
٤٠٦٩
-٥٣٠-
<tr><td><p>1-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S) -1-methoxy-1-oxo-3-phenylpropan -2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N- methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.115(1161.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg6C2</p><p>-#117</p></td></tr>
٤٠٦٩
-٥٣١-
<tr><td><p>N-[5-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)pentanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy- 2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.57) 883.3[M+H min)</p></td><td><p>mv-#69</p></td></tr><tr><td><p>N-[4-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)butanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy- 2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5 -methyl-1-oxoheptan-4-yl]-</p><p>N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>10.874(869.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mb-#69</p></td></tr>
٤٠٦٩
-٥٣٢-
<tr><td><p>N-(21-amino-4,7,10,13,16,19-</p><p>hexaoxahenicosan-1-oyl)-2-methylalanyl-N-{(3R,4S,5S)-1-[(2S)-2-{(3R,4R,7S,12S)-7-benzyl-14-[3 -chloro-4-(propan-2-yloxy)phenyl]-4-methyl-12-[4-(8-methylimidazo[1,2-a]pyridin -2-yl)benzyl]-5,8,14- trioxo-2,9-dioxa-6,13-diazatetradecan-3-yl}pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl}-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol m/z (Q1: 1514.3 [+0.76)] M+H min)</p></td><td><p>AmPeg6C2-</p><p>#234</p></td></tr>
٤٠٦٩
-٥٣٣-
<tr><td><p>N-(21-amino-</p><p>4,7,10,13,16,19-hexaoxahenicosan-1-oyl)-2-methylalanyl-N-[(3R,4S,5S)-</p><p>1-{(2S)-2-[(1R,2R)-3-</p><p>{[(2S)-1-{[4-(5-fluoro-1,3-benzothiazol-2-yl)-2-methylphenyl]amino}-1-oxo-</p><p>3-phenylpropan-2-yl]amin o}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N- methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1280.2 [M+H min)</p></td><td><p>AmPeg6C2-</p><p>#235</p></td></tr>
٤٠٦٩
-٥٣٤-
<tr><td><p>1-[6-(2,5-dioxo-2,5-</p><p>dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1- carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methox</p><p>y-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol: m/z(Q[+1.73) 923.3[M+H min)</p></td><td><p>mc-#118</p></td></tr>
٤٠٦٩
-٥٣٥-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methylalanyl-N-[(3R,4S,5S)-</p><p>1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo-3-phenylpropan-2-yl]amino}-1-meth oxy- 2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol m/z: (Q1) 1175.3 [M+H min)</p></td><td><p>MalPeg6C2</p><p>-#123</p></td></tr>
٤٠٦٩
-٥٣٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-dimethylalanyl-N-</p><p>[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3 -phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]py rrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol: m/z(Q[+1.85) 925.7[M+H min)</p></td><td><p>mc-#226</p></td></tr><tr><td><p>1-[7-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)heptanoyl]-2-methyl-L-prolyl-N-[(3R,4S,5S)-1-</p><p>{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-3-metho</p><p>xy-5-methyl-1-oxoheptan-</p><p>4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.80) 937.7[M+H min)</p></td><td><p>me-#118</p></td></tr>
٤٠٦٩
-٥٣٧-
<tr><td><p>1-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-2-methyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-</p><p>[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyr rolidin-1 -yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.88) 937.3[M+H min)</p></td><td><p>mc-#131</p></td></tr><tr><td><p>1-[4-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)butanoyl]-2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1- carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methox</p><p>y-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol m/z(Q:[+1.63) 895.3[M+H min)</p></td><td><p>mb-#118</p></td></tr>
٤٠٦٩
-٥٣٨-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N~5~-carbamoyl-N-{4-[({[( 2S)-2-{[(2S)-1-{[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S,2R)-1 -hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl -3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]( methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}-2-methylpyrrolidin-1-yl]carbonyl}oxy)methyl]phenyl}-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.67) 1314.3[M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#134</p></td></tr>
٤٠٦٩
-٥٣٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{( 2S)-2-[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin -1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol m/z (Q1: 897.34 [+0.90) [M+H min)]</p></td><td><p>mc-#145</p></td></tr>
٤٠٦٩
-٥٤٠-
<tr><td><p>methyl N-{(2R,3R)-3-[(2S)-1-{(3R,4S,5S)-4-[{N-[1-</p><p>(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-24,24-dimethyl-21,25-dioxo-3,6,9,12,15,18-hexaoxa-22- azapentacosan-25-yl]-L-valyl}(methyl)amino]-3-methoxy-5-met hylheptanoyl}pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.583(1169.6 [M+Na+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg6C2</p><p>-#126</p></td></tr><tr><td><p>methyl N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-(3-{[6-(2,5-dioxo-2, 5-dihydro-1H-pyrrol-1-yl)hexanoyl]amino}-</p><p>2,2-dimethylpropanoyl)-L-valyl](methyl)amino}-3-methoxy-5-</p><p>methylheptanoyl]pyrrolidin-2-yl}-3-</p><p>methoxy-2-methylpropanoyl]-L-phenylalaninate</p></td><td><p dir="rtl">HPLC (Protocol m/z:M).</p><p>12.994(925.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mc-#126</p></td></tr>
٤٠٦٩
-٥٤١-
<tr><td><p>1-[5-(2,5-dioxo-2,5-</p><p>dihydro-1H-pyrrol-1-</p><p>yl)pentanoyl]-2-methyl-L-prolyl-N-[(3R,4S,5S)-1-</p><p>{(2S)-2-[(1R,2R)-3-{[(1S)-</p><p>1-carboxy-2-</p><p>phenylethyl]amino}-1-</p><p>methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-3-metho</p><p>xy-5-methyl-1-oxoheptan-</p><p>4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.68) 909.2[M+H min)</p></td><td><p>mv-#118</p></td></tr><tr><td><p>methyl N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-({(3S)-1-[6-(2,5-) dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-3-fluoropyrrolidin-3-yl}carbonyl)-L-</p><p>valyl](methyl)amino}-3-methoxy-5-methylheptanoyl]pyrrolidi n-2-yl}-3-methoxy-2-methylpropanoyl]-L-phenylalaninate</p></td><td><p dir="rtl">LC-MS (Protocol m/z: (Q1: 941.3 [+0.96)] M+H min)</p></td><td><p>mc-#172</p></td></tr>
٤٠٦٩
-٥٤٢-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-</p><p>hexaoxahenicosan-21-yl]-</p><p>N,2-dimethylalanyl-N-</p><p>[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1-methoxy-1-oxo-3 -phenylpropa</p><p>n-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.76) 1147.3[M+H min)</p></td><td><p>MalPeg6C2</p><p>-#226</p></td></tr>
٤٠٦٩
-٥٤٣-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-</p><p>[(1R,2R)-3-{[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino}-1-methoxy -2-methyl-3-oxopropyl]pyrrolidin-1-yl} -3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol m/z: Q1).</p><p>0.87(1141.3 [M+Na+]</p><p dir="rtl">minute(</p></td><td><p>MalPeg6C2</p><p>-#145</p></td></tr>
٤٠٦٩
-٥٤٤-
<tr><td><p>N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-({(2S)-1-[6-(2,5-dioxo) -2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylpiperidin-2-yl}carbonyl)-L-valyl](methyl)amino}-3-methoxy-5-methylheptanoyl]pyrrolidin-2 -yl}-3-methoxy-2-methylpropanoyl]-L-phenylalanine</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.50) 937.3[M+H min)</p></td><td><p>mc-#162</p></td></tr>
٤٠٦٩
-٥٤٥-
<tr><td><p>N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-({(2R)-1-[6-(2,5-dioxo) -2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylpiperidin-2-yl}carbonyl)-L-valyl](methyl)amino}-3-methoxy-5-methylheptanoyl]pyrrolidin-2 -yl}-3-methoxy-2-methylpropanoyl]-L-phenylalanine</p></td><td><p dir="rtl">LC-MS (Protocol m/z: (A [+7.855) 937.5 [M+H min)</p></td><td><p>mc-#163</p></td></tr>
٤٠٦٩
-٥٤٦-
<tr><td><p>(N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-)</p><p>yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-12-(2-{(2S)-2-[(3R,4R,7S)-7-benzyl-15- {2-[(3,5-dimethyl-1H-pyrrol-</p><p>2-yl-kappaN)methylidene]-2H-pyrrol-5-yl-kappaN}-4-met</p><p>hyl-5,8,13-trioxo-2-oxa-</p><p>6,9,12-triazapentadecan-3-</p><p>yl]pyrrolidin-1-yl}-2-</p><p>oxoethyl)-11-[(2S)-butan-2-yl]-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4 ,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamidato)(difluoro)boron</p></td><td><p dir="rtl">LC-MS (Protocol m/z: Q1).</p><p>0.94(1640.4 [M+Na+23]</p><p dir="rtl">minute(</p></td><td><p>mcValCitPA</p><p>BC-#231</p></td></tr>
٤٠٦٩
-٥٤٧-
<tr><td><p>N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-</p><p>N,2-dimethylalanyl-N-</p><p>[(3R,4S,5S)-3-methoxy-1-</p><p>{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-</p><p>{[(2S)-1-oxo-3-phenyl</p><p>-1-(prop-2-en-1-yloxy)propan-2-yl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-</p><p>4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1173.3 [M+H min)</p></td><td><p>MalPeg6C2</p><p>-#238</p></td></tr>
٤٠٦٩
-٥٤٨-
<tr><td><p>1-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]- 2-methyl-L-prolyl-N-</p><p>[(3R,4S,5S)-1-{(2S)-2-</p><p>[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo-3-phenylpropan-2-yl]amino}-1-</p><p>m</p><p>ethoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1201.3 [M+H min)</p></td><td><p>MalPeg6C2</p><p>-#239</p></td></tr>
٤٠٦٩
-٥٤٩-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-</p><p>N-[(3R,4S,5S)-1-{(2S)-2-</p><p>[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo-3-</p><p>phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1</p><p>-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 953.3 [M+H min)</p></td><td><p>mc-#123</p></td></tr><tr><td><p>N-[6-(2,5-dioxo-2,5-)</p><p>dihydro-1H-pyrrol-1-yl)hexyl]-2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1- methoxy-2-methyl-3-oxo-3-</p><p>{[(1S)-2-phenyl-1-(1,3-thiazol-2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-</p><p>oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.50) 922.3[M+H min)</p></td><td><p>MalC6-#54</p></td></tr>
٤٠٦٩
-٥٥٠-
<tr><td><p>{N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylalanyl-N-[(3R,4S,5S)-1-{(2S) )-2-[(3R,4R,7S)-7-benzyl-15-{2-[(3,5-dimethyl-1H-pyrrol-2-yl-kappaN)methylidene]-2H-pyrrol-5-yl -kappaN}-4-methy l-5,8,13-trioxo-2-oxa-6,9,12-triazapentadecan-3-yl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1- oxoheptan-4-yl]-N-methyl-L-valinamidato}(difluoro)boron</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1213.3 [M+H min)</p></td><td><p>mc-#231</p></td></tr>
٤٠٦٩
-٥٥١-
<tr><td><p>1-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexyl]-2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1- carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-3-methoxy-5</p><p>-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 909.3 [M+H min)</p></td><td><p>MalC6-#118</p></td></tr>
٤٠٦٩
-٥٥٢-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-{4-[(8S,11S,12R)-11-[ (2S)-butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1-oxo-3- phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3 -oxopropyl]pyrrolidin-1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8 -(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1358.3 [M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#123</p></td></tr>
٤٠٦٩
-٥٥٣-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{( 2S)-2-[(1R,2R)-3-{[(2S)-3-(1H-indol-3-yl)-1-methoxy-1-oxopropan-2-yl]amino}-1-methoxy -2-methyl-3-oxopropyl]pyr rolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-</p><p>N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 964.4 [M+H min)</p></td><td><p>mc-#237</p></td></tr>
٤٠٦٩
-٥٥٤-
<tr><td><p>methyl N-[(2R,3R)-3-{(2S)-1-[(3R,4S,5S)-4-{[N-({(2S)-1-[6-(2,5-) dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-2-methylpiperidin-2-yl}carbonyl)-L-</p><p>valyl](methyl)amino}-3-methoxy-5-methylheptanoyl]pyrrolidin -2-yl}-3-methoxy-2-methylpropanoyl]-L-phenylalaninate</p></td><td><p dir="rtl">LC-MS (Protocol m/z:M</p><p>12.839(951.4 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>mc-#158</p></td></tr><tr><td><p>1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-</p><p>[(1R,2R)-3-{[(2S)-1-{[6-</p><p>(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexyl]amino}-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3 -oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.43) 922.3[M+H min)</p></td><td><p>MalC6Am-</p><p>#151</p></td></tr>
٤٠٦٩
-٥٥٥-
<tr><td><p>N-(3-{2-[3-oxo-3-(pentafluorophenoxy)propoxy] ethoxy}propanoyl)-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)- butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl- 1-(1,3-thiazol-2-yl)eth yl]amino}propyl]pyrrolidin-1-</p><p>yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1- yl]phenyl}-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.98) 1502.8[M+H min)</p></td><td><p>PFPCOPeg2</p><p>C2ValCitPA</p><p>BC-#54</p></td></tr>
٤٠٦٩
-٥٥٦-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]-L-valyl-N-{4-[(9S,12S,13R)-12-[(2S)-</p><p>butan-2-yl]-13-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-</p><p>methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}p ropyl]pyrrolidin-1-yl}-2-</p><p>oxoethyl)-4,6,6,11-tetramethyl-3,7,10-trioxo-9-(propan-2-yl)-2,14-dioxa-4,8,11-triazapentadec-1-yl]phenyl }-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (protocol m/z: (Q1) 1370.2 [M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#154</p></td></tr>
٤٠٦٩
-٥٥٧-
<tr><td><p>1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-</p><p>[(1R,2R)-3-{[(2S)-1-{[6-</p><p>(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexyl]amino}-1-oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3 -oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:A).</p><p>7.352(922.5 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>MalC6Am-</p><p>#153</p></td></tr><tr><td><p>N-[11,20-dioxo-20-(pentafluorophenoxy)-4,7,14,17-tetraoxa-10-azaicosan-1-oyl]-2-methylalanyl-N-[(3R,4S,5S)-1 -{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyr rolidin-1 -yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-</p><p>N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z:BB).</p><p>12.936(1217.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>PFPCOPeg2</p><p>C2AmPeg2</p><p>C2-#69</p></td></tr>
٤٠٦٩
-٥٥٨-
<tr><td><p>N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanoyl]-L-valyl-N-(4-{(6S,9R,10R)-6-benzyl -10-[(2S)-1-{(3R,4S,5S)-4-[(1,2-dimethyl-L-prolyl-L-valyl)(methyl)amino]-3-methoxy-5-methylheptanoyl }pyrrolidin-2 -yl]-9-methyl-3,8-dioxo-2,11-dioxa-4,7-diazadodec-1-yl}phenyl)-N~5~-carbamoyl-L-ornithinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.36) 1327.9[M+H min)</p></td><td><p>mcValCitPA</p><p>BC-#246</p></td></tr>
٤٠٦٩
-٥٥٩-
<tr><td><p>N-(3-{2-[3-oxo-3-(pentafluorophenoxy)propoxy] ethoxy}propanoyl)-L-alanyl-L-alanyl-N~1~-{4-[(8S,11S,12R)- 11-[(2S)-butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[( 1S)-2-phenyl-1-(1,3-thi azol-2-yl)ethyl]amino}propyl]pyrrolidin -1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6 ,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-yl]phenyl}-L-aspartamide</p></td><td><p dir="rtl">HPLC (Protocol m/z: (AB [+8.06) 1503.6 [M+H min)</p></td><td><p>PFPCOPeg2</p><p>C2AlaAlaAs</p><p>nPABC-#54</p></td></tr>
٤٠٦٩
-٥٦٠-
<tr><td><p>2-methyl-N-(3-{2-[3-oxo-3-(pentafluorophenoxy)propoxy] ethoxy}propanoyl)alanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S) )-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-</p><p>{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}prop yl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]- N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z: (AB [+8.44) 1098.4 [M+H min)</p></td><td><p>PFPCOPeg2</p><p>C2-#54</p></td></tr>
٤٠٦٩
-٥٦١-
<tr><td><p>N-{[(4-{[11,20-dioxo-20-(pentafluorophenoxy)-4,7,14,17-tetraoxa-10-azaicosan-1-oyl]amino}benzyl)oxy]carbonyl} -2- methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[( 1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z:AB).</p><p>10.32(1428.2 [M+Na+]</p><p dir="rtl">minute(</p></td><td><p>PFPCOPeg2</p><p>C2AmPeg2</p><p>C2PABC-</p><p>#54</p></td></tr>
٤٠٦٩
-٥٦٢-
<tr><td><p>N-(21-amino-4,7,10,13,16,19-</p><p>hexaoxahenicosan-1-oyl)-N,2-dimethylalanyl-N-</p><p>[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2- methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methox</p><p>y-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z: (A [+7.35) 1053.5 [M+H min)</p></td><td><p>AmPeg6C2-</p><p>#115</p></td></tr>
٤٠٦٩
-٥٦٣-
<tr><td><p>N,2-dimethyl-N-[19-oxo-19-(pentafluorophenoxy)-4,7,10,13,16-pentaoxanonadecan-1-oyl]alanyl-N-[(3R,4S,5S)-1- {(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrro lidin-1- yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">LC-MS (Protocol: m/z(Q[+1.99) 1205.1[M+H min)</p></td><td><p>PFPCOPeg5</p><p>C2-#115</p></td></tr>
٤٠٦٩
-٥٦٤-
<tr><td><p>1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(2S)-3-[4- ({N-[6-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-</p><p>yl)hexanoyl]glycyl}amino)phen yl]-1-methoxy-1-oxopropan-2-yl}amino)-1-methoxy-2-methyl-3-o xopropyl]pyrrolidin-1-yl}-3-</p><p>methoxy-5-methyl-1-</p><p>oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol 4) (EB minutes): ESI-MS m/z</p><p>1023.59 [M+H+]</p></td><td><p>mcGly-#201</p></td></tr>
٤٠٦٩
-٥٦٥-
<tr><td><p>2-methyl-N-(3-{2-[3-oxo-3-({4-[3-oxo-3-(2-oxoazetidin-1-)</p><p>yl)propyl]phenyl}amino)propox y]ethoxy}propanoyl)alanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-</p><p>methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z: FB).</p><p>10.18(1132.4 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AzCOC2Ph4</p><p>AmCOPeg2</p><p>C2-#54</p></td></tr>
٤٠٦٩
-٥٦٦-
<tr><td><p>N-{[2-oxo-2-({4-[3-oxo-3-(2-oxoazetidin-1-yl)propyl]phenyl}amino)ethoxy] acetyl}-L-valyl-N-{4- [(8S,11S,12R)-11-[(2S)-butan-2-yl]-12-(2-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl- 3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin -1-yl}-2-oxoethyl)-5,5 ,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13-dioxa-4,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl -L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z: FB).</p><p>10.97(1465.8 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AzCOC2Ph4</p><p>AmPeg1C1</p><p>ValCitPABC</p><p>-#54</p></td></tr>
٤٠٦٩
-٥٦٧-
<tr><td><p>N-{[2-oxo-2-({4-[3-oxo-3-(2-oxoazetidin-1-yl)propyl]phenyl}amino)ethoxy] acetyl}-L-valyl-N~5~- carbamoyl-N-[4-({[(1-{[(2S)-1-{[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R) -1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin -1-yl} -5-methyl-1-oxoheptan-4-yl](methyl)amino}-3-methyl-1-oxobutan-2-yl]carbamoyl}cyclopentyl)carba moyl]oxy}methyl)phenyl]-L-ornithinamide</p></td><td><p dir="rtl">HPLC (Protocol m/z: FB).</p><p>10.56(1491.8 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AzCOC2Ph4</p><p>AmPeg1C1</p><p>ValCitPABC</p><p>-#30</p></td></tr>
٤٠٦٩
-٥٦٨-
<tr><td><p>2-methyl-N-(3-{2-[3-oxo-3-({4-[3-oxo-3-(2-oxoazetidin-1-)</p><p>yl)propyl]phenyl}amino)propox y]ethoxy}propanoyl)alanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S) )-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-</p><p>L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z:AB).</p><p>12.02(1065.3 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AzCOC2Ph4</p><p>AmCOPeg2</p><p>C2-#69</p></td></tr>
٤٠٦٩
-٥٦٩-
<tr><td><p>N,2-dimethyl-N-(3-{2-[3-oxo-3-({4-[3-oxo-3-(2-oxoazetidin-1-)</p><p>yl)propyl]phenyl}amino)propox y]ethoxy}propanoyl)alanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S) )-1-carboxy-2-phenylethyl]amino}-1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p dir="rtl">HPLC (protocol m/z:AA).</p><p>12.02(1078.6 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>AzCOC2Ph4</p><p>AmCOPeg2</p><p>C2-#115</p></td></tr>
٤٠٦٩
-٥٧٠-
<tr><td><p>N~2~-acetyl-L-lysyl-L-valyl-N-{4-[(8S,11S,12R)-11-[(2S)-butan-2-yl]-12-(2-{( 2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1S)-2-phenyl-1-(1,3-thiazol-2-</p><p>yl)ethyl]amino}propyl]pyrrolidin -1-yl}-2-oxoethyl)-5,5,10-trimethyl-3,6,9-trioxo-8-(propan-2-yl)-2,13- dioxa-4,7,10-triazatetradec-1-yl]phenyl}-N~5~-carbamoyl-L-ornithinamide, trifluoroacetic acid salt</p></td><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.34(1319.3 [M+H+2]</p><p dir="rtl">minute(</p></td><td><p>AcLysValCit</p><p>PABC-#54</p></td></tr>
Table 19 (A): Materials that have been selected from the list
<tr><td><p dir="rtl">Theoretical Δ hill or molecular Δ GKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK than the MOLLONG GFV/link</p></td><td><p dir="rtl">tmifgfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfk GF-2,'2,2</p><p>phosphanetriyltriprop - recipe /anoic acid</p><p dir="rtl">LM or PL /TCEP</p><p>(x/y)</p></td><td><p dir="rtl">Your way of highlighting</p></td><td><p dir="rtl">Connection number - for ADC connector</p></td></tr><tr><td><p>1031</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#41</p></td></tr>
٤٠٦٩
-٥٧١-
<tr><td><p>1177</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#42</p></td></tr><tr><td><p>913</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#44</p></td></tr><tr><td><p>1003</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#44</p></td></tr><tr><td><p>1135</p></td><td><p>7/2.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#44</p></td></tr><tr><td><p>1319</p></td><td><p>7.5/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#44</p></td></tr><tr><td><p>1017</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_Mal-PEG3C2-#45</p></td></tr><tr><td><p>1149</p></td><td><p>10/2.05</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_Mal-PEG6C2-#45</p></td></tr><tr><td><p>1342</p></td><td><p>10/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#45</p></td></tr><tr><td><p>897</p></td><td><p>7.5/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#54</p></td></tr><tr><td><p>1119</p></td><td><p>7.5/2.1</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_Mal-PEG6C2-#69</p></td></tr>
٤٠٦٩
-٥٧٢-
<tr><td><p>1303</p></td><td><p>7.5/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>1317</p></td><td><p>7/2.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#70</p></td></tr><tr><td><p>941</p></td><td><p>7/2.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#79</p></td></tr><tr><td><p>1345</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#79</p></td></tr><tr><td><p>911</p></td><td><p>6.5/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#115</p></td></tr><tr><td><p>934.21</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with the general opinion G</p></td><td><p>H-A114C-(C114)_mc-</p><p>#51</p></td></tr><tr><td><p>962.27</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with the general opinion G</p></td><td><p>H-A114C-(C114)_mc-</p><p>#47</p></td></tr><tr><td><p>936.2</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with the general opinion G</p></td><td><p>H-A114C-(C114)_mc-</p><p>#54</p></td></tr><tr><td><p>1367.72</p></td><td><p>10/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#47</p></td></tr><tr><td><p>1341.68</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#54</p></td></tr>
٤٠٦٩
-٥٧٣-
<tr><td><p>1385.8</p></td><td><p>10/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#26</p></td></tr><tr><td><p>980.35</p></td><td><p>10/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#26</p></td></tr><tr><td><p>1302.69</p></td><td><p>10/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#36</p></td></tr><tr><td><p>1360.73</p></td><td><p>7/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#42</p></td></tr><tr><td><p>955.27</p></td><td><p>10/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#42</p></td></tr><tr><td><p>1342</p></td><td><p>10/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>1544</p></td><td><p>9/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 3C2-#54</p></td></tr><tr><td><p>1677</p></td><td><p>10/2.6</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg</p><p>6C2-#54</p></td></tr>
٤٠٦٩
-٥٧٤-
<tr><td><p>962.27</p></td><td><p>10/1.9</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#47</p></td></tr><tr><td><p>1026</p></td><td><p>10/1.9</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#54</p></td></tr><tr><td><p>936.2</p></td><td><p>10/2.07</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#54</p></td></tr><tr><td><p>1569.96</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg</p><p>3C2-#47</p></td></tr><tr><td><p>1052</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#47</p></td></tr><tr><td><p>1562.87</p></td><td><p>7.5/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 3C2-#42</p></td></tr><tr><td><p>941.24</p></td><td><p>10/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#41</p></td></tr><tr><td><p>1589.04</p></td><td><p>10/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg</p><p>3C2-#26</p></td></tr><tr><td><p>1701.9</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 6C2-#47</p></td></tr>
٤٠٦٩
-٥٧٥-
<tr><td><p>1044.58</p></td><td><p>7/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#42</p></td></tr><tr><td><p>1719.9</p></td><td><p>7.5/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 6C2-#26</p></td></tr><tr><td><p>1696.1</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 6C2-#42</p></td></tr><tr><td><p>1158.5</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#54</p></td></tr><tr><td><p>1184.5</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#47</p></td></tr><tr><td><p>1202.6</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#26</p></td></tr><tr><td><p>1177</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-MalPeg6C2-#42</p></td></tr><tr><td><p>896</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#36</p></td></tr><tr><td><p>1284.61</p></td><td><p>7/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#60</p></td></tr><tr><td><p>1070.42</p></td><td><p>10/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#26</p></td></tr>
٤٠٦٩
-٥٧٦-
<tr><td><p>1505.93</p></td><td><p>10/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 3C2-#36</p></td></tr><tr><td><p>1505.93</p></td><td><p>10/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABCAm</p><p>Peg3C2-#36</p></td></tr><tr><td><p>1158.5</p></td><td><p>10/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#54</p></td></tr><tr><td><p>969.23</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#60</p></td></tr><tr><td><p>1101.4</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#60</p></td></tr><tr><td><p>1163.5</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#41</p></td></tr><tr><td><p>897</p></td><td><p>7.5/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mc-#69</p></td></tr><tr><td><p>987.31</p></td><td><p>10/2.15</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg3C2-#36</p></td></tr><tr><td><p>1636</p></td><td><p>10/2.25</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 6C2-#36</p></td></tr>
٤٠٦٩
-٥٧٧-
<tr><td><p>1119.5</p></td><td><p>10/2.15</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#36</p></td></tr><tr><td><p>1549.94</p></td><td><p>10/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 3C2-#41</p></td></tr><tr><td><p>1031</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-MalPeg3C2-#41</p></td></tr><tr><td><p>1620</p></td><td><p>10/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_mcValCitPABCAmPeg 6C2-#60</p></td></tr><tr><td><p>866.5</p></td><td><p>7/50</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#66</p></td></tr><tr><td><p>1341.68</p></td><td><p>7/50</p></td><td><p dir="rtl">H</p></td><td><p>H-L398C+L443C-</p><p>(C398+C443)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L443C-</p><p>(C443)_mcValCitPABC-</p><p>#54</p></td></tr>
٤٠٦٩
-٥٧٨-
<tr><td><p>1341.68</p></td><td><p>7/50</p></td><td><p dir="rtl">H</p></td><td><p>H-L398C+V422C-</p><p>(C398+C422)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td><p>913</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mc-#44</p></td></tr><tr><td><p>1017</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-Mal-PEG3C2-#45</p></td></tr><tr><td><p>1049.6</p></td><td><p>10/2.4</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_2AcAmPeg6C2-</p><p>#66</p></td></tr><tr><td><p>1149</p></td><td><p>10/2.05</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-Mal-PEG6C2-#45</p></td></tr><tr><td><p>941</p></td><td><p>7/2.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mc-#79</p></td></tr><tr><td><p>1003</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-MalPeg3C2-#44</p></td></tr><tr><td><p>1317</p></td><td><p>7/2.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mcValCitPABC-</p><p>#70</p></td></tr><tr><td><p>1135</p></td><td><p>7/2.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-MalPeg6C2-#44</p></td></tr><tr><td><p>1302</p></td><td><p>8.25/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#69</p></td></tr>
٤٠٦٩
-٥٧٩-
<tr><td><p>1345</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mcValCitPABC-</p><p>#79</p></td></tr><tr><td><p>1346</p></td><td><p>7.5/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#79</p></td></tr><tr><td><p>1319</p></td><td><p>7.5/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mcValCitPABC-</p><p>#44</p></td></tr><tr><td><p>1355</p></td><td><p>7.5/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#88</p></td></tr><tr><td><p>1303</p></td><td><p>7.5/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>1313.49</p></td><td><p>10/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-</p><p>(C)_2AcAmCapValCitPAB</p><p>C-#66</p></td></tr><tr><td><p>1331.7</p></td><td><p>7.5/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#45</p></td></tr><tr><td><p>1357</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#34</p></td></tr>
٤٠٦٩
-٥٨٠-
<tr><td><p>926</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#45</p></td></tr><tr><td><p>911.15</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#70</p></td></tr><tr><td><p>1288</p></td><td><p>7.5/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#112</p></td></tr><tr><td><p>1119</p></td><td><p>7.5/2.1</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)-Mal-PEG6C2-#69</p></td></tr><tr><td><p>1302</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C-</p><p>(C347)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>1302</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Y373C-</p><p>(C373)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>1302</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-E388C-</p><p>(C388)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>1302</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-N421C-</p><p>(C421)_mcValCitPABC-</p><p>#69</p></td></tr>
٤٠٦٩
-٥٨١-
<tr><td><p>1302</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L443C-</p><p>(C443)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>1346</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L443C-</p><p>(C443)_mcValCitPABC-</p><p>#79</p></td></tr><tr><td><p>1354</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#95</p></td></tr><tr><td><p>1367</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#98</p></td></tr><tr><td><p>987.2</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg3C2-#69</p></td></tr><tr><td><p>1080</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with you about the year K</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-#42</p></td></tr><tr><td><p>1061</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with you about the year K</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-#54</p></td></tr><tr><td><p>1087</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with you about the year K</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-#47</p></td></tr><tr><td><p>1022</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with you about the year K</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-#36</p></td></tr>
٤٠٦٩
-٥٨٢-
<tr><td><p>1105</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with you about the year K</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-#26</p></td></tr><tr><td><p>992</p></td><td><p>NA</p></td><td><p dir="rtl">I agree with you about the year K</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-#66</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L443C-</p><p>(C443)_MalPeg6C2-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C-</p><p>(C347)_MalPeg6C2-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-E388C-</p><p>(C388)_MalPeg6C2-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-N421C-</p><p>(C421)_MalPeg6C2-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-E380C-</p><p>(C380)_MalPeg6C2-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L398C+L443C-</p><p>(C398+C443)_MalPeg6C2</p><p>-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_MalPeg6C2</p><p>-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-kA111C-</p><p>(kC111)_MalPeg6C2-#69</p></td></tr>
٤٠٦٩
-٥٨٣-
<tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-kK183C-</p><p>(kC183)_MalPeg6C2-#69</p></td></tr><tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-kK207C-</p><p>(kC207)_MalPeg6C2-#69</p></td></tr><tr><td><p>1314.59</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#108</p></td></tr><tr><td><p>1371</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#84</p></td></tr><tr><td><p>1330</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#226</p></td></tr><tr><td><p>909.12</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#108</p></td></tr><tr><td><p>1342</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#117</p></td></tr><tr><td><p>1316</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#115</p></td></tr>
٤٠٦٩
-٥٨٤-
<tr><td><p>1184</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#98</p></td></tr><tr><td><p>1341.68</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>897.12</p></td><td><p>7/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_mc-#69</p></td></tr><tr><td><p>1119</p></td><td><p>8/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_MalPeg6C2-#69</p></td></tr><tr><td><p>1302</p></td><td><p>8/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>1145</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-</p><p>0#118</p></td></tr><tr><td><p>1328</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>0#118</p></td></tr><tr><td><p>1332</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#80</p></td></tr>
٤٠٦٩
-٥٨٥-
<tr><td><p>937</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#117</p></td></tr><tr><td><p>1366</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#232</p></td></tr><tr><td><p>1145</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#230</p></td></tr><tr><td><p>1159</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#117</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#115</p></td></tr><tr><td><p>897</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mv-</p><p>#115</p></td></tr><tr><td><p>869</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mb-</p><p>#69</p></td></tr><tr><td><p>883</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mv-</p><p>#69</p></td></tr><tr><td><p>923</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>0#118</p></td></tr><tr><td><p>937</p></td><td><p>6.5/2.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#117</p></td></tr>
٤٠٦٩
-٥٨٦-
<tr><td><p>1159</p></td><td><p>6.5/2.05</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#117</p></td></tr><tr><td><p>923</p></td><td><p>7/2.1</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-0#118</p></td></tr><tr><td><p>1145</p></td><td><p>7.5/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>923</p></td><td><p>7/2.35</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_mc-0#118</p></td></tr><tr><td><p>925</p></td><td><p>10/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_mc-#226</p></td></tr><tr><td><p>937</p></td><td><p>10/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_mc-#117</p></td></tr><tr><td><p>1159</p></td><td><p>10/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_MalPeg6C2-</p><p>#117</p></td></tr><tr><td><p>1145</p></td><td><p>10/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_MalPeg6C2-</p><p>0#118</p></td></tr><tr><td><p>1147</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#226</p></td></tr><tr><td><p>940.53</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#172</p></td></tr>
٤٠٦٩
-٥٨٧-
<tr><td><p>895</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mb-</p><p>0#118</p></td></tr><tr><td><p>937</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_me-</p><p>0#118</p></td></tr><tr><td><p>1314</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#134</p></td></tr><tr><td><p>937</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#131</p></td></tr><tr><td><p>1147</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#126</p></td></tr><tr><td><p>1174</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#123</p></td></tr><tr><td><p>925</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#126</p></td></tr><tr><td><p>909</p></td><td><p>15/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mv-</p><p>0#118</p></td></tr><tr><td><p>1147</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_MalPeg6C2-#226</p></td></tr><tr><td><p>925</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mc-#226</p></td></tr>
٤٠٦٩
-٥٨٨-
<tr><td><p>1147</p></td><td><p>10/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_MalPeg6C2-</p><p>#226</p></td></tr><tr><td><p>923</p></td><td><p>7/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-28-cG1-(C)_mc-</p><p>0#118</p></td></tr><tr><td><p>911</p></td><td><p>7/2.35</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-28-cG1-(C)_mc-</p><p>#115</p></td></tr><tr><td><p>1145</p></td><td><p>7/2.35</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-28-cG1-</p><p>(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>937</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-28-cG1-(C)_me-</p><p>0#118</p></td></tr><tr><td><p>923</p></td><td><p>7/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-75-cG1-(C)_mc-</p><p>0#118</p></td></tr><tr><td><p>1341.68</p></td><td><p>8/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-19F9-cG1-</p><p>(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>1288</p></td><td><p>7/2.5</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-19F9-cG1-</p><p>(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>1288</p></td><td><p>7/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-28-cG1-</p><p>(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>1119</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-28-cG1-</p><p>(C)_MalPeg6C2-#69</p></td></tr>
٤٠٦٩
-٥٨٩-
<tr><td><p>1119</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-75-cG1-</p><p>(C)_MalPeg6C2-#69</p></td></tr><tr><td><p>941</p></td><td><p>7/2.35</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>H-(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>1163</p></td><td><p>7/2.35</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-</p><p>0#118</p></td></tr><tr><td><p>1137</p></td><td><p>7/2.1</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-</p><p>#69</p></td></tr><tr><td><p>915</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>H-(C)_m(H2O)c-#69</p></td></tr><tr><td><p>937</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_me-0#118</p></td></tr><tr><td><p>909</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mv-0#118</p></td></tr><tr><td><p>895</p></td><td><p>7/2.1</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mb-0#118</p></td></tr><tr><td><p>922.22</p></td><td><p>5/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_MalC6-#54</p></td></tr><tr><td><p>1213</p></td><td><p>5/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#231</p></td></tr>
٤٠٦٩
-٥٩٠-
<tr><td><p>909.18</p></td><td><p>5/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalC6-0#118</p></td></tr><tr><td><p>1151</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-</p><p>#115</p></td></tr><tr><td><p>951</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#158</p></td></tr><tr><td><p>1617</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#231</p></td></tr><tr><td><p>929</p></td><td><p>7/2.4</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>H-(C)_m(H2O)c-#115</p></td></tr><tr><td><p>911.15</p></td><td><p>7.0/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-75-cG1-(C)_mc-</p><p>#115</p></td></tr><tr><td><p>937</p></td><td><p>7.0/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-75-cG1-(C)_me-</p><p>0#118</p></td></tr><tr><td><p>1144</p></td><td><p>7.0/3.0</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>Notch-75-cG1-</p><p>(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>963</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#237</p></td></tr><tr><td><p>897</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#145</p></td></tr>
٤٠٦٩
-٥٩١-
<tr><td><p>1119</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2-#145</p></td></tr><tr><td><p>937</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-(C114)_mc-</p><p>#162</p></td></tr><tr><td><p>905</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalC6Am-#151</p></td></tr><tr><td><p>941</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>Notch-28-cG1-</p><p>(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>941</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year</p></td><td><p>Notch-75-cG1-</p><p>(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>1318</p></td><td></td><td><p dir="rtl">I agree with you about the year J</p></td><td><p>H-</p><p>(kK188)_COPeg2C2ValCit</p><p>PABC-#54</p></td></tr><tr><td><p>1163</p></td><td><p>7/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-</p><p>(C)_Mal(H2O)Peg6C2-</p><p>0#118</p></td></tr><tr><td><p>1151</p></td><td><p>7/2.3</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-</p><p>(C)_Mal(H2O)Peg6C2-</p><p>#115</p></td></tr>
٤٠٦٩
-٥٩٢-
<tr><td><p>911</p></td><td><p>7/2.35</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_mc-#115</p></td></tr><tr><td><p>941</p></td><td><p>7/2.8</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>1328</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>0#118</p></td></tr><tr><td><p>929</p></td><td><p>7/2.35</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-(C)_m(H2O)c-#115</p></td></tr><tr><td><p>1369</p></td><td><p>5/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#154</p></td></tr><tr><td><p>921</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_MalC6Am-#153</p></td></tr><tr><td><p>1341.68</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>Q347C+kK183C-hG1-(C347+kC183)_mcValCitP ABC-#54</p></td></tr><tr><td><p>1341.68</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>Q347C-hG1-</p><p>(C347)_mcValCitPABC-</p><p>#54</p></td></tr>
٤٠٦٩
-٥٩٣-
<tr><td><p>1032</p></td><td></td><td><p dir="rtl">I agree with you about the year J</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-</p><p>(kK188)_COPeg2C2AmPe g2C2-#69</p></td></tr><tr><td><p>1318</p></td><td></td><td><p dir="rtl">I agree with you about the year J</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>hG1-</p><p>(kK188)_COPeg2C2ValCit</p><p>PABC-#54</p></td></tr><tr><td><p>1341.68</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>L443C-hG1-</p><p>(C443)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>1341.68</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>K392C+L443C-hG1-(C392+C443)_mcValCitPA BC-#54</p></td></tr><tr><td><p>1341.68</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>IL13Ra2-AB08-v1010-</p><p>L443C+kK183C-hG1-</p><p>(C443+kC183)_mcValCitP</p><p>ABC-#54</p></td></tr><tr><td><p>1367</p></td><td><p>7/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-(C)_mcValCitPABC-</p><p>#98</p></td></tr>
٤٠٦٩
-٥٩٤-
<tr><td><p>1327</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABC-</p><p>#246</p></td></tr><tr><td><p>1341.7</p></td><td><p>8/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-H435A-</p><p>(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>1316</p></td><td><p>8/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-M428L+N434S-</p><p>(C)_mcValCitPABC-#70</p></td></tr><tr><td><p>1341.7</p></td><td><p>8/2.2</p></td><td><p dir="rtl">I agree with you about the year F</p></td><td><p>H-M428L+N434S-</p><p>(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-E388C+N421C-</p><p>(C388+C421)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C+K392C-</p><p>(C347+C392)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L443C+kK183C-</p><p>(C443+kC183)_mcValCitP</p><p>ABC-#54</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C+kK183C-</p><p>(C347+kC183)_mcValCitP</p><p>ABC-#54</p></td></tr>
٤٠٦٩
-٥٩٥-
<tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C-</p><p>(C347)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_mc-#115</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-E388C+N421C-</p><p>(C388+C421)_mc-#115</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C+K392C-</p><p>(C347+C392)_mc-#115</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L443C+kK183C-</p><p>(C443+kC183)_mc-#115</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C+kK183C-</p><p>(C347+kC183)_mc-#115</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-Q347C-(C347)_mc-</p><p>#115</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-kK183C-</p><p>(kC183)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-E388C-</p><p>(C388)_mcValCitPABC-</p><p>#54</p></td></tr>
٤٠٦٩
-٥٩٦-
<tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-kK183C-(kC183)_mc-</p><p>#115</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-E388C-(C388)_mc-</p><p>#115</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-L443C-(C443)_mc-</p><p>#115</p></td></tr><tr><td><p>1341</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-N421C-</p><p>(C421)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>911</p></td><td><p>10/100</p></td><td><p dir="rtl">H</p></td><td><p>H-N421C-(C421)_mc-</p><p>#115</p></td></tr><tr><td><p>1023</p></td><td><p>10/100</p></td><td><p dir="rtl">I agree with the general opinion G</p></td><td><p>H-A114C-(C114)_mcGly-</p><p>#201</p></td></tr>
Table 19 (B): Materials that have been selected from the list
<tr><td><p dir="rtl">Multiplicative multiplicative multiplicative multiplicative multiplicative GFGAFD</p><p>(DAR)</p></td><td><p dir="rtl">Spectrum: HPLC-SEC and TTL HPLC Δ section for the heavy chain (HC) section (different than 6 Da in the Δ chain theory)</p></td><td><p dir="rtl">Connection number - for ADC connector</p></td></tr>
٤٠٦٩
-٥٩٧-
<tr><td><p>4.3</p></td><td><p dir="rtl">SEC (Protochemical O): 7.317 μF; HPLC (Protochemical P): گافه</p><p>1032 =HCΔ</p></td><td><p>H-(C)_MalPeg3C2-#41</p></td></tr><tr><td><p>3.9</p></td><td><p dir="rtl">SEC (Protochemical O): 7.177 μF; HPLC (Protochemical P): گافه</p><p>1180 =HCΔ</p></td><td><p>H-(C)_MalPeg6C2-#42</p></td></tr><tr><td><p>4.4</p></td><td><p dir="rtl">SEC (Protochemical O): 7.195 μF; HPLC (Protochemical P): گافه</p><p>915 =HCΔ</p></td><td><p>H-(C)_mc-#44</p></td></tr><tr><td><p>3.4</p></td><td><p dir="rtl">SEC (Protein O): 7.247 ml; HPLC (Protein P): 7.247 گافه</p><p>1005 =HCΔ</p></td><td><p>H-(C)_MalPeg3C2-#44</p></td></tr><tr><td><p>3.4</p></td><td><p dir="rtl">SEC (Protein O): 7.237 ml; HPLC (Protein O): 7.237 گافه</p><p>1135 =HCΔ</p></td><td><p>H-(C)_MalPeg6C2-#44</p></td></tr>
٤٠٦٩
-٥٩٨-
<tr><td><p>4.2</p></td><td><p dir="rtl">SEC (Protein O): 7.351 ml; HPLC (Protein P): 7.351 گافه</p><p>1321 =HCΔ</p></td><td><p>H-(C)_mcValCitPABC-#44</p></td></tr><tr><td><p>4.3</p></td><td><p dir="rtl">SEC (Protochemical O): 7.364 μF; HPLC (Protochemical P): گافه</p><p>1017 =HCΔ</p></td><td><p>H-(C)_Mal-PEG3C2-#45</p></td></tr><tr><td><p>3.9</p></td><td><p dir="rtl">SEC (Protochemical O): 7.417 μF; HPLC (Protochemical P): گافه</p><p>1154 =HCΔ</p></td><td><p>H-(C)_Mal-PEG6C2-#45</p></td></tr><tr><td><p>4.1</p></td><td><p dir="rtl">SEC (Protein O): 7.159 ml; HPLC (Protein P): گافه</p><p>1343 =HCΔ</p></td><td><p>H-(C)_mcValCitPABC-#45</p></td></tr><tr><td><p>4.5</p></td><td><p dir="rtl">SEC (Protochemical O): 7.192 μF; HPLC (Protochemical P): گافه</p><p>899 =HCΔ</p></td><td><p>H-(C)_mc-#54</p></td></tr>
٤٠٦٩
-٥٩٩-
<tr><td><p>3.4</p></td><td><p dir="rtl">SEC (Protochemical O): 7,350 μM; HPLC (Protochemical P): گافه</p><p>1122 =HCΔ</p></td><td><p>H-(C)_Mal-PEG6C2-#69</p></td></tr><tr><td><p>4.5</p></td><td><p dir="rtl">SEC (Protochemical O): 7.254 μF; HPLC (Protochemical P): گافه</p><p>1305 =HCΔ</p></td><td><p>H-(C)_mcValCitPABC-#69</p></td></tr><tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Protein O): 7.466 micrometres; HPLC (Protein P): گافه</p><p>1318 =HCΔ</p></td><td><p>H-(C)_mcValCitPABC-#70</p></td></tr><tr><td><p>4</p></td><td><p dir="rtl">SEC (Protein O): 7.478 ml; HPLC (Protein P): گافه</p><p>946 =HCΔ</p></td><td><p>H-(C)_mc-#79</p></td></tr><tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Protochemical O): 7.635 μF; HPLC (Protochemical P): گافه</p><p>1349 =HCΔ</p></td><td><p>H-(C)_mcValCitPABC-#79</p></td></tr>
٤٠٦٩
-٦٠٠-
<tr><td><p>3.54</p></td><td><p dir="rtl">SEC (Protochemical O): 7.510 μM; HPLC (Protochemical P): گافه</p><p>912 =HCΔ</p></td><td><p>H-(C)_mc-#115</p></td></tr><tr><td><p>2.4</p></td><td></td><td><p>H-A114C-(C114)_mc-#51</p></td></tr><tr><td><p>2.3</p></td><td></td><td><p>H-A114C-(C114)_mc-#47</p></td></tr><tr><td><p>2.3</p></td><td></td><td><p>H-A114C-(C114)_mc-#54</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#47</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#54</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#26</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mc-#26</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#36</p></td></tr><tr><td><p>1.95</p></td><td><p dir="rtl">SEC (Prototype O): 7.681 μF; HPLC (Prototype O): گافه</p><p>1378 =HCΔ</p></td><td><p>H-A114C-(C114)_mcValCitPABC-#42</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#42</p></td></tr><tr><td><p>4.1</p></td><td><p dir="rtl">SEC (Prototype O): 7.159 μF; HPLC (Prototype O): گاف</p><p>1343 =HCΔ</p></td><td><p>H-(C)-mcValCitPABC-#54</p></td></tr>
٤٠٦٩
-٦٠١-
<tr><td><p>4.6</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-#54</p></td></tr><tr><td><p>4.5</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-#54</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>H-(C)_mc-#47</p></td></tr><tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Prototype O): 7.179 μF; HPLC (Prototype O): گافه</p><p>1028 =HCΔ</p></td><td><p>H-(C)_MalPeg3C2-#54</p></td></tr><tr><td><p>4</p></td><td></td><td><p>H-(C)_mc-#54</p></td></tr><tr><td><p>3.7</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-#47</p></td></tr><tr><td><p>4.3</p></td><td></td><td><p>H-(C)_MalPeg3C2-#47</p></td></tr><tr><td><p>4.3</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-#42</p></td></tr><tr><td><p>3.1</p></td><td></td><td><p>H-(C)_mc-#41</p></td></tr><tr><td><p>3</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-#26</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-#47</p></td></tr><tr><td><p>4.3</p></td><td><p dir="rtl">SEC (Prototype O): 7.142 μF; HPLC (Prototype O): گافه</p><p>1050 =HCΔ</p></td><td><p>H-(C)_MalPeg3C2-#42</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-#26</p></td></tr><tr><td><p>4.1</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-#42</p></td></tr>
٤٠٦٩
-٦٠٢-
<tr><td><p>4.4</p></td><td><p dir="rtl">SEC (Prototype O): 7.254 μF; HPLC (Prototype O): گافه</p><p>1161 =HCΔ</p></td><td><p>H-(C)_MalPeg6C2-#54</p></td></tr><tr><td><p>4.4</p></td><td><p dir="rtl">SEC (Prototype O): 7.303 μF; HPLC (Prototype O): گافه</p><p>1182 =HCΔ</p></td><td><p>H-(C)_MalPeg6C2-#47</p></td></tr><tr><td><p>4.1</p></td><td></td><td><p>H-(C)_MalPeg6C2-#26</p></td></tr><tr><td><p>3.9</p></td><td><p dir="rtl">SEC (Prototype O): 7.177 μF; گافه</p><p>1180 =HCΔ</p></td><td><p>H-(C)-MalPeg6C2-#42</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>H-(C)_mc-#36</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>H-(C)_mcValCitPABC-#60</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>H-(C)_MalPeg3C2-#26</p></td></tr><tr><td><p>3.5</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-#36</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABCAmPeg3C2-#36</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#54</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>H-(C)_MalPeg3C2-#60</p></td></tr>
٤٠٦٩
-٦٠٣-
<tr><td><p>4.1</p></td><td></td><td><p>H-(C)_MalPeg6C2-#60</p></td></tr><tr><td><p>4</p></td><td></td><td><p>H-(C)_MalPeg6C2-#41</p></td></tr><tr><td><p>4.5</p></td><td><p dir="rtl">SEC (Prototype O): 7.192 μM; HPLC (Prototype O): گافه</p><p>899 =HCΔ</p></td><td><p>H-(C)-mc-#69</p></td></tr><tr><td><p>5.2</p></td><td></td><td><p>H-(C)_MalPeg3C2-#36</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-#36</p></td></tr><tr><td><p>5</p></td><td></td><td><p>H-(C)_MalPeg6C2-#36</p></td></tr><tr><td><p>4.4</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-#41</p></td></tr><tr><td><p>4.3</p></td><td><p dir="rtl">SEC (Prototype O): 7.317 μF; HPLC (Prototype O): گافه</p><p>1032 =HCΔ</p></td><td><p>H-(C)-MalPeg3C2-#41</p></td></tr><tr><td><p>4.1</p></td><td></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-#60</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-A114C-(C114)_mc-#66</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>H-L398C+L443C-(C398+C443)_mcValCitPABC-#54</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>H-K392C+L443C-(C392+C443)_mcValCitPABC-#54</p></td></tr>
٤٠٦٩
-٦٠٤-
<tr><td><p>2</p></td><td><p dir="rtl">SEC (Prototype O): 8.827 μM; HPLC (Prototype O): گافه</p><p>1344 =HCΔ</p></td><td><p>H-L443C-(C443)_mcValCitPABC-#54</p></td></tr><tr><td><p>3.4</p></td><td></td><td><p>H-L398C+V422C-</p><p>(C398+C422)_mcValCitPABC-#54</p></td></tr><tr><td><p>4.4</p></td><td><p dir="rtl">SEC (Prototype O): 7.195 μM; HPLC (Prototype O): گافه</p><p>915 =HCΔ</p></td><td><p>H-(C)-mc-#44</p></td></tr><tr><td><p>4.3</p></td><td><p dir="rtl">SEC (Prototype O): 7.364 μM; HPLC (Prototype O): گافه</p><p>1017 =HCΔ</p></td><td><p>H-(C)-Mal-PEG3C2-#45</p></td></tr><tr><td><p>4</p></td><td></td><td><p>H-(C)_2AcAmPeg6C2-#66</p></td></tr><tr><td><p>3.9</p></td><td><p dir="rtl">SEC (Prototype O): 7.419 μM; HPLC (Prototype O): گافه</p><p>1154 =HCΔ</p></td><td><p>H-(C)-Mal-PEG6C2-#45</p></td></tr><tr><td><p>4</p></td><td><p dir="rtl">SEC (Prototype O): 7.478 μF; گافه</p><p>946 =HCΔ</p></td><td><p>H-(C)-mc-#79</p></td></tr>
٤٠٦٩
-٦٠٥-
<tr><td><p>3.4</p></td><td><p dir="rtl">SEC (Prototype O): 7.247 μF; گافه</p><p>1005 =HCΔ</p></td><td><p>H-(C)-MalPeg3C2-#44</p></td></tr><tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Prototype O): 7.466 μF; گافه</p><p>1318 =HCΔ</p></td><td><p>H-(C)-mcValCitPABC-#70</p></td></tr><tr><td><p>3.4</p></td><td><p dir="rtl">SEC (Prototype O): 7.237 μF; HPLC (Prototype O): گافه</p><p>1135 =HCΔ</p></td><td><p>H-(C)-MalPeg6C2-#44</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#69</p></td></tr><tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Prototype O): 7.635 μM; HPLC (Prototype O): گافه</p><p>1349 =HCΔ</p></td><td><p>H-(C)-mcValCitPABC-#79</p></td></tr><tr><td><p>1.84</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#79</p></td></tr><tr><td><p>4.2</p></td><td><p dir="rtl">SEC (Prototype O): 7.351 μF; HPLC (Prototype O): گافه</p><p>1321 =HCΔ</p></td><td><p>H-(C)-mcValCitPABC-#44</p></td></tr><tr><td><p>1.93</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#88</p></td></tr>
٤٠٦٩
-٦٠٦-
<tr><td><p>4.5</p></td><td><p dir="rtl">SEC (Prototype O): 7.254 μF; HPLC (Prototype O): گافه</p><p>1305 =HCΔ</p></td><td><p>H-(C)-mcValCitPABC-#69</p></td></tr><tr><td><p>3.3</p></td><td></td><td><p>H-(C)_2AcAmCapValCitPABC-#66</p></td></tr><tr><td><p>1.92</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#45</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#34</p></td></tr><tr><td><p>1.95</p></td><td></td><td><p>H-A114C-(C114)_mc-#45</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#70</p></td></tr><tr><td><p>4.4</p></td><td><p dir="rtl">SEC (Prototype O): 7.083 μM; HPLC (Prototype O): گافه</p><p>1291 =HCΔ</p></td><td><p>H-(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>3.4</p></td><td><p dir="rtl">SEC (Prototype O): 7.350 μM; HPLC (Prototype O): گافه</p><p>1122 =HCΔ</p></td><td><p>H-(C)-Mal-PEG6C2-#69</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-Q347C-(C347)_mcValCitPABC-#69</p></td></tr><tr><td><p>1.6</p></td><td></td><td><p>H-Y373C-(C373)_mcValCitPABC-#69</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-E388C-(C388)_mcValCitPABC-#69</p></td></tr><tr><td><p>1.95</p></td><td></td><td><p>H-N421C-(C421)_mcValCitPABC-#69</p></td></tr>
٤٠٦٩
-٦٠٧-
<tr><td><p>2</p></td><td></td><td><p>H-L443C-(C443)_mcValCitPABC-#69</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-L443C-(C443)_mcValCitPABC-#79</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#95</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#98</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_MalPeg3C2-#69</p></td></tr><tr><td><p>3.2</p></td><td></td><td><p>H-N297Q-(Q)_AmPeg6C2-#42</p></td></tr><tr><td><p>3.04</p></td><td></td><td><p>H-N297Q-(Q)_AmPeg6C2-#54</p></td></tr><tr><td><p>3.16</p></td><td></td><td><p>H-N297Q-(Q)_AmPeg6C2-#47</p></td></tr><tr><td><p>3.36</p></td><td></td><td><p>H-N297Q-(Q)_AmPeg6C2-#36</p></td></tr><tr><td><p>3.4</p></td><td></td><td><p>H-N297Q-(Q)_AmPeg6C2-#26</p></td></tr><tr><td><p>2.8</p></td><td></td><td><p>H-N297Q-(Q)_AmPeg6C2-#66</p></td></tr><tr><td><p>2</p></td><td><p dir="rtl">SEC (Prototype O): 7.012 μM; HPLC (Prototype O): 7.012 گافه</p><p>1120 =HCΔ</p></td><td><p>H-L443C-(C443)_MalPeg6C2-#69</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-Q347C-(C347)_MalPeg6C2-#69</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-E388C-(C388)_MalPeg6C2-#69</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-N421C-(C421)_MalPeg6C2-#69</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-E380C-(C380)_MalPeg6C2-#69</p></td></tr>
٤٠٦٩
-٦٠٨-
<tr><td><p>3.9</p></td><td></td><td><p>H-L398C+L443C-</p><p>(C398+C443)_MalPeg6C2-#69</p></td></tr><tr><td><p>3.5</p></td><td></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_MalPeg6C2-#69</p></td></tr><tr><td><p>3.7</p></td><td></td><td><p>H-kA111C-(kC111)_MalPeg6C2-#69</p></td></tr><tr><td><p>2.1</p></td><td></td><td><p>H-kK183C-(kC183)_MalPeg6C2-#69</p></td></tr><tr><td><p>2.3</p></td><td></td><td><p>H-kK207C-(kC207)_MalPeg6C2-#69</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#108</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#84</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#226</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mc-#108</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#117</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#115</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#98</p></td></tr><tr><td><p>3.9</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>3.5</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-</p><p>#69</p></td></tr><tr><td><p>3.5</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_MalPeg6C2-#69</p></td></tr>
٤٠٦٩
-٦٠٩-
<tr><td><p>4.4</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_mcValCitPABC-#69</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-0#118</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>0#118</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#80</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mc-#117</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#232</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#230</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#117</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#115</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mv-#115</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mb-#69</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mv-#69</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-0#118</p></td></tr><tr><td><p>3.5</p></td><td><p dir="rtl">SEC (Prototype O): 7.797 μF; HPLC (Prototype O): گافه</p><p>937 =HCΔ</p></td><td><p>H-(C)_mc-#117</p></td></tr>
٤٠٦٩
-٦١٠-
<tr><td><p>3.56</p></td><td><p dir="rtl">SEC (Prototype O): 8.005 micrometres; HPLC (Prototype O): 8.005 گافه</p><p>1163 =HCΔ</p></td><td><p>H-(C)_MalPeg6C2-#117</p></td></tr><tr><td><p>4.1</p></td><td></td><td><p>H-(C)_mc-0#118</p></td></tr><tr><td><p>3.9</p></td><td><p dir="rtl">SEC (Protocol P):</p><p dir="rtl">NA; HPLC</p><p dir="rtl">(protocol O):</p><p>1148 =HCΔ</p></td><td><p>H-(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>4</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-</p><p>0#118</p></td></tr><tr><td><p>4.6</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-</p><p>#226</p></td></tr><tr><td><p>3.3</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-</p><p>#117</p></td></tr><tr><td><p>3.3</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_MalPeg6C2-#117</p></td></tr><tr><td><p>2.9</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#226</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mc-#172</p></td></tr>
٤٠٦٩
-٦١١-
<tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mb-0#118</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_me-0#118</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#134</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#131</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#126</p></td></tr><tr><td><p>1.7</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#123</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#126</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mv-0#118</p></td></tr><tr><td><p>4.5</p></td><td><p dir="rtl">SEC (Prototype O): 7.501 μF; HPLC (Prototype O): گافه</p><p>1150 =HCΔ</p></td><td><p>H-(C)_MalPeg6C2-#226</p></td></tr><tr><td><p>4.5</p></td><td><p dir="rtl">SEC (Prototype O): 7.418 μM; HPLC (Prototype O): گافه</p><p>927 =HCΔ</p></td><td><p>H-(C)_mc-#226</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_MalPeg6C2-#226</p></td></tr><tr><td><p>4.6</p></td><td></td><td><p>Notch-28-cG1-(C)_mc-0#118</p></td></tr>
٤٠٦٩
-٦١٢-
<tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Protocol P): 7.015 μM; HPLC (Protocol O): chlorinated گافه</p><p>911 =HCΔ</p></td><td><p>Notch-28-cG1-(C)_mc-#115</p></td></tr><tr><td><p>4.1</p></td><td></td><td><p>Notch-28-cG1-(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>3.9</p></td><td><p dir="rtl">SEC (Prototype O): 7.182 μM; HPLC (Prototype O): گافه</p><p>937 =HCΔ</p></td><td><p>Notch-28-cG1-(C)_me-0#118</p></td></tr><tr><td><p>3.3</p></td><td></td><td><p>Notch-75-cG1-(C)_mc-0#118</p></td></tr><tr><td><p>4.1</p></td><td></td><td><p>IL13Ra2-19F9-cG1-</p><p>(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>IL13Ra2-19F9-cG1-</p><p>(C)_mcValCitPABC-#112</p></td></tr><tr><td><p>4.1</p></td><td></td><td><p>Notch-28-cG1-(C)_mcValCitPABC-</p><p>#112</p></td></tr><tr><td><p>4.3</p></td><td></td><td><p>Notch-28-cG1-(C)_MalPeg6C2-#69</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>Notch-75-cG1-(C)_MalPeg6C2-#69</p></td></tr><tr><td><p>4.1</p></td><td><p dir="rtl">SEC (Prototype O): 7.010 μM; HPLC (Prototype O): 7.010 گافه</p><p>942 =HCΔ</p></td><td><p>H-(C)_m(H2O)c-0#118</p></td></tr>
٤٠٦٩
-٦١٣-
<tr><td><p>4</p></td><td><p dir="rtl">SEC (Protocol P): 6.964 μM; HPLC (Protocol O): chlorinated گافه</p><p>1166 =HCΔ</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-0#118</p></td></tr><tr><td><p>2.8</p></td><td></td><td><p>H-(C)_Mal(H2O)Peg6C2-#69</p></td></tr><tr><td><p>3.6</p></td><td></td><td><p>H-(C)_m(H2O)c-#69</p></td></tr><tr><td><p>4.4</p></td><td></td><td><p>H-(C)_me-0#118</p></td></tr><tr><td><p>4.4</p></td><td></td><td><p>H-(C)_mv-0#118</p></td></tr><tr><td><p>4.1</p></td><td><p dir="rtl">SEC (Prototype O): 7.032 μM; HPLC (Prototype O): گافه</p><p>896 =HCΔ</p></td><td><p>H-(C)_mb-0#118</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalC6-#54</p></td></tr><tr><td><p>1.7</p></td><td></td><td><p>H-A114C-(C114)_mc-#231</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_MalC6-0#118</p></td></tr><tr><td><p>4.1</p></td><td><p dir="rtl">SEC (Prototype O): 6.936 μM; HPLC (Prototype O): گافه</p><p>1152 =HCΔ</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-#115</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#158</p></td></tr><tr><td><p>1.7</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#231</p></td></tr>
٤٠٦٩
-٦١٤-
<tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Prototype O): 6.928 μM; HPLC (Prototype O): گافه</p><p>930 =HCΔ</p></td><td><p>H-(C)_m(H2O)c-#115</p></td></tr><tr><td><p>3.7</p></td><td></td><td><p>Notch-75-cG1-(C)_mc-#115</p></td></tr><tr><td><p>3.5</p></td><td></td><td><p>Notch-75-cG1-(C)_me-0#118</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>Notch-75-cG1-(C)_MalPeg6C2-0#118</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#237</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_mc-#145</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_MalPeg6C2-#145</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mc-#162</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_MalC6Am-#151</p></td></tr><tr><td><p>3.7</p></td><td></td><td><p>Notch-28-cG1-(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>3</p></td><td></td><td><p>Notch-75-cG1-(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-(kK188)_COPeg2C2ValCitPABC-#54</p></td></tr><tr><td><p>3.5</p></td><td><p dir="rtl">SEC (Prototype O): 7.766 μF; گافه</p><p>1164 =HCΔ</p></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_Mal(H2O)Peg6C2-0#118</p></td></tr>
٤٠٦٩
-٦١٥-
<tr><td><p>3.9</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_Mal(H2O)Peg6C2-#115</p></td></tr><tr><td><p>4.3</p></td><td><p dir="rtl">SEC (Prototype O): 7.813 μM; HPLC (Prototype O): گافه</p><p>911 =HCΔ</p></td><td><p>IL13Ra2-AB08-v1010-hG1-(C)_mc-</p><p>#115</p></td></tr><tr><td><p>3.3</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_m(H2O)c-0#118</p></td></tr><tr><td><p>4.5</p></td><td></td><td><p>H-(C)_mcValCitPABC-0#118</p></td></tr><tr><td><p>3.8</p></td><td><p dir="rtl">SEC (Prototype O): 7.783 μF; گافه</p><p>930 =HCΔ</p></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(C)_m(H2O)c-#115</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#154</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-A114C-(C114)_MalC6Am-#153</p></td></tr><tr><td><p>4.3</p></td><td></td><td><p>IL13Ra2-AB08-v1010-</p><p>Q347C+kK183C-hG1-</p><p>(C347+kC183)_mcValCitPABC-#54</p></td></tr><tr><td><p>2.1</p></td><td></td><td><p>IL13Ra2-AB08-v1010-Q347C-hG1-</p><p>(C347)_mcValCitPABC-#54</p></td></tr><tr><td><p>2</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(kK188)_COPeg2C2AmPeg2C2-#69</p></td></tr>
٤٠٦٩
-٦١٦-
<tr><td><p>1.9</p></td><td></td><td><p>IL13Ra2-AB08-v1010-hG1-</p><p>(kK188)_COPeg2C2ValCitPABC-#54</p></td></tr><tr><td><p>2.1</p></td><td></td><td><p>IL13Ra2-AB08-v1010-L443C-hG1-</p><p>(C443)_mcValCitPABC-#54</p></td></tr><tr><td><p>3.7</p></td><td></td><td><p>IL13Ra2-AB08-v1010-K392C+L443C-hG1-(C392+C443)_mcValCitPABC-#54</p></td></tr><tr><td><p>4</p></td><td></td><td><p>IL13Ra2-AB08-v1010-L443C+kK183C-</p><p>hG1-(C443+kC183)_mcValCitPABC-#54</p></td></tr><tr><td><p>4.2</p></td><td><p dir="rtl">SEC (Prototype O): 7.232 μF; HPLC (Prototype O): گافه</p><p>1371 =HCΔ</p></td><td><p>H-(C)_mcValCitPABC-#98</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mcValCitPABC-#246</p></td></tr><tr><td><p>4</p></td><td></td><td><p>H-H435A-(C)_mcValCitPABC-#54</p></td></tr><tr><td><p>4.2</p></td><td></td><td><p>H-M428L+N434S-(C)_mcValCitPABC-</p><p>#70</p></td></tr><tr><td><p>4</p></td><td></td><td><p>H-M428L+N434S-(C)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td><p>3.6</p></td><td></td><td><p>H-E388C+N421C-</p><p>(C388+C421)_mcValCitPABC-#54</p></td></tr>
٤٠٦٩
-٦١٧-
<tr><td><p>3.9</p></td><td></td><td><p>H-Q347C+K392C-</p><p>(C347+C392)_mcValCitPABC-#54</p></td></tr><tr><td><p>3.7</p></td><td></td><td><p>H-L443C+kK183C-</p><p>(C443+kC183)_mcValCitPABC-#54</p></td></tr><tr><td><p>3.7</p></td><td><p dir="rtl">SEC (Prototype O): 8.278 μF; گافه</p><p>1339 =HCΔ</p></td><td><p>H-Q347C+kK183C-(C347+kC183)_mcValCitPABC-#54</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-Q347C-(C347)_mcValCitPABC-#54</p></td></tr><tr><td><p>4</p></td><td></td><td><p>H-K392C+L443C-(C392+C443)_mc-</p><p>#115</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>H-E388C+N421C-(C388+C421)_mc-</p><p>#115</p></td></tr><tr><td><p>4</p></td><td></td><td><p>H-Q347C+K392C-(C347+C392)_mc-</p><p>#115</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>H-L443C+kK183C-(C443+kC183)_mc-</p><p>#115</p></td></tr><tr><td><p>3.8</p></td><td></td><td><p>H-Q347C+kK183C-(C347+kC183)_mc-</p><p>#115</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-Q347C-(C347)_mc-#115</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-kK183C-(kC183)_mcValCitPABC-#54</p></td></tr>
٤٠٦٩
-٦١٨-
<tr><td><p>2</p></td><td></td><td><p>H-E388C-(C388)_mcValCitPABC-#54</p></td></tr><tr><td><p>1.8</p></td><td></td><td><p>H-kK183C-(kC183)_mc-#115</p></td></tr><tr><td><p>2</p></td><td><p dir="rtl">SEC (Prototype O): 7.364 μM; HPLC (Prototype O): گافه</p><p>914 =HCΔ</p></td><td><p>H-E388C-(C388)_mc-#115</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-L443C-(C443)_mc-#115</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-N421C-(C421)_mcValCitPABC-#54</p></td></tr><tr><td><p>2</p></td><td></td><td><p>H-N421C-(C421)_mc-#115</p></td></tr><tr><td><p>1.9</p></td><td></td><td><p>H-A114C-(C114)_mcGly-#201</p></td></tr>
Table 20: IC50 values for selected compounds (cytotoxic peptides) from the inventor
<tr><td><p>MDA-MB-361-</p><p>DYT2 GMEAN</p><p dir="rtl">IC50 (NFG particle)</p></td><td><p>N87GMEAN IC50</p><p dir="rtl">(nanoparticle particle)</p></td><td><p>BT474</p><p>GMEAN</p><p>IC50</p><p dir="rtl">(nfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfgn)</p></td><td><p dir="rtl">Example number</p></td></tr><tr><td><p>1.045</p></td><td><p>0.543</p></td><td><p>0.368</p></td><td><p>#26</p></td></tr><tr><td><p>1.853</p></td><td><p>6.709</p></td><td><p>0.682</p></td><td><p>#30</p></td></tr><tr><td><p>1.119</p></td><td><p>1.95</p></td><td><p>0.211</p></td><td><p>#34</p></td></tr><tr><td><p>1.111</p></td><td><p>1.205</p></td><td><p>0.499</p></td><td><p>#36</p></td></tr>
٤٠٦٩
-٦١٩-
<tr><td><p>51.784</p></td><td><p>33.21</p></td><td><p>29.666</p></td><td><p>#41</p></td></tr><tr><td><p>0.195</p></td><td><p>0.327</p></td><td><p>0.125</p></td><td><p>#42</p></td></tr><tr><td><p>16.401></p></td><td><p>14.61</p></td><td><p>7.119</p></td><td><p>#44</p></td></tr><tr><td><p>0.415</p></td><td><p>0.385</p></td><td><p>0.15</p></td><td><p>#45</p></td></tr><tr><td><p>0.317</p></td><td><p>0.256<</p></td><td><p>0.244<</p></td><td><p>#47</p></td></tr><tr><td></td><td><p>3.658</p></td><td><p>0.599<</p></td><td><p>#51</p></td></tr><tr><td><p>0.206</p></td><td><p>0.221<</p></td><td><p>0.133<</p></td><td><p>#54</p></td></tr><tr><td><p>0.766</p></td><td><p>1.256</p></td><td><p>0.316</p></td><td><p>#56</p></td></tr><tr><td><p>0.957</p></td><td><p>1.245</p></td><td><p>0.524</p></td><td><p>#60</p></td></tr><tr><td><p>0.334</p></td><td><p>0.463</p></td><td><p>0.244</p></td><td><p>#66</p></td></tr><tr><td><p>40.988</p></td><td><p>65.979</p></td><td><p>80.191</p></td><td><p>#69</p></td></tr><tr><td><p>0.225</p></td><td><p>0.327</p></td><td><p>0.179</p></td><td><p>#70</p></td></tr><tr><td><p>100.000></p></td><td><p>100.000></p></td><td><p>100.000></p></td><td><p>#75</p></td></tr><tr><td><p>0.129</p></td><td><p>0.137</p></td><td><p>0.079</p></td><td><p>#79</p></td></tr><tr><td><p>32.846</p></td><td><p>28.204</p></td><td><p>20.346</p></td><td><p>#80</p></td></tr><tr><td><p>0.686</p></td><td><p>0.426</p></td><td><p>0.246</p></td><td><p>#84</p></td></tr><tr><td><p>19.87</p></td><td><p>50.302</p></td><td><p>31.493</p></td><td><p>#115</p></td></tr><tr><td><p>0.118</p></td><td><p>0.103</p></td><td><p>0.096</p></td><td><p>#117</p></td></tr>
٤٠٦٩
-٦٢٠-
<tr><td><p>100</p></td><td><p>100</p></td><td><p>100</p></td><td><p>#118</p></td></tr><tr><td><p>0.129</p></td><td><p>0.089</p></td><td><p>0.125</p></td><td><p>#123</p></td></tr><tr><td><p>0.454</p></td><td><p>0.375</p></td><td><p>0.315</p></td><td><p>#126</p></td></tr><tr><td><p>0.039</p></td><td><p>0.076</p></td><td><p>0.05</p></td><td><p>#130</p></td></tr><tr><td><p>0.081</p></td><td><p>0.185</p></td><td><p>0.072</p></td><td><p>#131</p></td></tr><tr><td><p>0.134</p></td><td><p>0.115</p></td><td><p>0.108</p></td><td><p>#134</p></td></tr><tr><td></td><td></td><td></td><td><p>#140</p></td></tr><tr><td></td><td><p>3.018</p></td><td><p>3.367</p></td><td><p>#141</p></td></tr><tr><td></td><td><p>0.259</p></td><td><p>0.279</p></td><td><p>#142</p></td></tr><tr><td></td><td></td><td></td><td><p>#143</p></td></tr><tr><td><p>0.174</p></td><td><p>0.182</p></td><td><p>0.172</p></td><td><p>#144</p></td></tr><tr><td><p>0.229</p></td><td><p>0.167</p></td><td><p>0.185</p></td><td><p>#145</p></td></tr><tr><td><p>0.387</p></td><td><p>0.195</p></td><td><p>0.435</p></td><td><p>#146</p></td></tr><tr><td><p>0.421</p></td><td><p>0.144</p></td><td><p>0.456</p></td><td><p>#147</p></td></tr><tr><td><p>0.502</p></td><td><p>0.219</p></td><td><p>0.429</p></td><td><p>#148</p></td></tr><tr><td><p>0.428</p></td><td><p>0.25</p></td><td><p>0.417</p></td><td><p>#149</p></td></tr><tr><td><p>84.599</p></td><td><p>61.953</p></td><td><p>84.867</p></td><td><p>#151</p></td></tr><tr><td><p>91.35</p></td><td><p>47.274</p></td><td><p>98.16</p></td><td><p>#153</p></td></tr>
٤٠٦٩
-٦٢١-
<tr><td><p>0.198</p></td><td><p>0.572</p></td><td><p>0.193</p></td><td><p>#154</p></td></tr><tr><td><p>0.318</p></td><td><p>0.875</p></td><td><p>0.323</p></td><td><p>#155</p></td></tr><tr><td><p>0.1</p></td><td><p>0.115</p></td><td><p>0.082</p></td><td><p>#158</p></td></tr><tr><td><p>0.074</p></td><td><p>0.075</p></td><td><p>0.07</p></td><td><p>#159</p></td></tr><tr><td><p>27.824</p></td><td><p>21.61</p></td><td><p>31.448</p></td><td><p>#162</p></td></tr><tr><td><p>99.433</p></td><td><p>72.703</p></td><td><p>100</p></td><td><p>#163</p></td></tr><tr><td><p>0.086</p></td><td><p>0.144</p></td><td><p>0.057</p></td><td><p>#172</p></td></tr><tr><td><p>0.067</p></td><td><p>0.099</p></td><td><p>0.088</p></td><td><p>#173</p></td></tr><tr><td><p>0.911</p></td><td><p>1.262</p></td><td><p>0.968</p></td><td><p>#178</p></td></tr><tr><td><p>0.113</p></td><td><p>0.117</p></td><td><p>0.159</p></td><td><p>#180</p></td></tr><tr><td><p>0.122</p></td><td><p>0.148</p></td><td><p>0.153</p></td><td><p>#182</p></td></tr><tr><td><p>3.427</p></td><td><p>5.098</p></td><td><p>2.478</p></td><td><p>#184</p></td></tr><tr><td></td><td></td><td></td><td><p>#186</p></td></tr><tr><td><p>0.404</p></td><td><p>0.283</p></td><td><p>0.25</p></td><td><p>#188</p></td></tr><tr><td><p>0.095</p></td><td><p>0.066</p></td><td><p>0.134</p></td><td><p>#190</p></td></tr><tr><td><p>0.408</p></td><td><p>0.36</p></td><td><p>0.262</p></td><td><p>#192</p></td></tr><tr><td><p>0.198</p></td><td><p>0.212</p></td><td><p>0.134</p></td><td><p>#194</p></td></tr><tr><td><p>0.017</p></td><td><p>0.029</p></td><td><p>0.048</p></td><td><p>#200</p></td></tr>
٤٠٦٩
-٦٢٢-
<tr><td><p>0.121</p></td><td><p>0.15</p></td><td><p>0.144</p></td><td><p>#201</p></td></tr><tr><td><p>0.26</p></td><td><p>0.626</p></td><td><p>0.219</p></td><td><p>#207</p></td></tr><tr><td><p>0.336</p></td><td><p>0.379</p></td><td><p>0.418</p></td><td><p>#208</p></td></tr><tr><td><p>0.058</p></td><td><p>0.067</p></td><td><p>0.067</p></td><td><p>#209</p></td></tr><tr><td></td><td></td><td></td><td><p>#217</p></td></tr><tr><td></td><td></td><td></td><td><p>#219</p></td></tr><tr><td><p>100</p></td><td><p>100</p></td><td><p>35.163</p></td><td><p>#220</p></td></tr><tr><td><p>65.401</p></td><td><p>87.857</p></td><td><p>32.402</p></td><td><p>#221</p></td></tr><tr><td><p>0.272</p></td><td><p>0.352</p></td><td><p>0.158</p></td><td><p>#222</p></td></tr><tr><td><p>10.863</p></td><td><p>13.026</p></td><td><p>7.589</p></td><td><p>#223</p></td></tr><tr><td><p>0.998</p></td><td><p>1.563</p></td><td><p>0.383</p></td><td><p>#224</p></td></tr><tr><td><p>7.575</p></td><td><p>10.524</p></td><td><p>3.449</p></td><td><p>#225</p></td></tr><tr><td><p>0.106</p></td><td><p>0.478</p></td><td><p>0.118</p></td><td><p>#226</p></td></tr><tr><td><p>12.899</p></td><td><p>18.975</p></td><td><p>11.008</p></td><td><p>#227</p></td></tr><tr><td><p>0.078</p></td><td><p>0.09</p></td><td><p>0.105</p></td><td><p>#228</p></td></tr><tr><td><p>10.218</p></td><td><p>16.566</p></td><td><p>18.372</p></td><td><p>#229</p></td></tr><tr><td><p>70.236</p></td><td><p>89.133</p></td><td><p>100</p></td><td><p>#230</p></td></tr><tr><td><p>22.855</p></td><td><p>15.127</p></td><td><p>3.706</p></td><td><p>#231</p></td></tr>
٤٠٦٩
-٦٢٣-
<tr><td><p>0.095</p></td><td><p>0.194</p></td><td><p>0.071</p></td><td><p>#232</p></td></tr><tr><td><p>5.042</p></td><td><p>8.413</p></td><td><p>1.074</p></td><td><p>#233</p></td></tr><tr><td><p>2.004</p></td><td><p>0.756</p></td><td><p>0.684</p></td><td><p>#234</p></td></tr><tr><td><p>1.278</p></td><td><p>1.32</p></td><td><p>0.852</p></td><td><p>#235</p></td></tr><tr><td><p>0.01</p></td><td><p>0.023</p></td><td><p>0.02</p></td><td><p>#236</p></td></tr><tr><td><p>0.278</p></td><td><p>0.217</p></td><td><p>0.162</p></td><td><p>#237</p></td></tr><tr><td><p>0.084</p></td><td><p>0.077</p></td><td><p>0.139</p></td><td><p>#238</p></td></tr><tr><td></td><td></td><td></td><td><p>#239</p></td></tr><tr><td><p>23.48</p></td><td><p>19.93</p></td><td><p>11.71</p></td><td><p>#240</p></td></tr><tr><td><p>0.494</p></td><td><p>0.388</p></td><td><p>0.364</p></td><td><p>#241</p></td></tr><tr><td><p>34.529</p></td><td><p>41.329</p></td><td><p>32.33</p></td><td><p>#242</p></td></tr><tr><td><p>1.284</p></td><td><p>1.301</p></td><td><p>1.252</p></td><td><p>#243</p></td></tr><tr><td><p>100</p></td><td><p>100</p></td><td><p>73.123</p></td><td><p>#244</p></td></tr><tr><td><p>31.856</p></td><td><p>33.037</p></td><td><p>11.793</p></td><td><p>#245</p></td></tr><tr><td><p>5.43</p></td><td><p>10.828</p></td><td><p>3.159</p></td><td><p>#246</p></td></tr><tr><td><p>1.334</p></td><td><p>2.061</p></td><td><p>1.007</p></td><td><p>#247</p></td></tr><tr><td></td><td></td><td></td><td><p>#257</p></td></tr>
Table 21(A): IC50 values for materials selected from the highest markets.
٤٠٦٩
-٦٢٤-
<tr><td colspan="2"><p>N87</p></td><td colspan="2"><p>HCC1954</p></td><td colspan="2"><p>BT474</p></td><td></td></tr><tr><td><p>IC50</p><p dir="rtl">MGGF Additives (nm/ml)</p></td><td><p>IC50</p><p dir="rtl">(nfnffkfnwz yaffffffnffffgfffqffgfm jrmm)</p></td><td><p>IC50</p><p dir="rtl">MGGF Additives (nm/ml)</p></td><td><p>IC50</p><p dir="rtl">(nfnffkfnwz yaffffffnffffgfffqffgfm jrmm)</p></td><td><p>IC50</p><p dir="rtl">MGGF Additives (nm/ml)</p></td><td><p>IC50</p><p dir="rtl">)Nafaaaaaaaaaaaaaaaaaaaz</p><p dir="rtl">Y</p><p dir="rtl">(C ARMM)</p></td><td><p dir="rtl">Connection number - for ADC connector</p></td></tr><tr><td><p>175.4</p><p>48</p></td><td><p>4.02</p></td><td><p>16.61</p><p>7</p></td><td><p>0.465</p></td><td><p>25.59</p><p>2</p></td><td><p>0.725</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#41</p></td></tr><tr><td><p>></p><p>6681.</p><p>150</p></td><td><p>></p><p>14.09</p><p>0</p></td><td><p>24.78</p><p>3</p></td><td><p>0.604</p></td><td><p>19.85</p><p>5</p></td><td><p>0.502</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#42</p></td></tr><tr><td><p>></p><p>29495</p><p>.311</p></td><td><p>></p><p>841.3</p><p>60</p></td><td><p>493.0</p><p>77</p></td><td><p>14.46</p><p>4</p></td><td><p>121.4</p><p>14</p></td><td><p>3.553</p></td><td><p>H-(C)_mc-#44</p></td></tr><tr><td><p>></p><p>26346</p><p>.532</p></td><td><p>></p><p>440.8</p><p>81</p></td><td><p>225.5</p><p>94</p></td><td><p>5.113</p></td><td><p>114.8</p><p>47</p></td><td><p>2.603</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#44</p></td></tr><tr><td><p>4873.</p><p>851</p></td><td><p>98.17</p><p>4</p></td><td><p>64.66</p><p>3</p></td><td><p>1.466</p></td><td><p>58.15</p><p>5</p></td><td><p>1.318</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#44</p></td></tr>
٤٠٦٩
-٦٢٥-
<tr><td><p>28.14</p><p>6</p></td><td><p>0.781</p></td><td><p>5.329</p></td><td><p>0.155</p></td><td><p>6.717</p></td><td><p>0.188</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#44</p></td></tr><tr><td><p>></p><p>27967</p><p>.742</p></td><td><p>></p><p>740.0</p><p>01</p></td><td><p>52.79</p><p>1</p></td><td><p>1.513</p></td><td><p>103.7</p><p>62</p></td><td><p>2.886</p></td><td><p>H-(C)_Mal-</p><p>PEG3C2-#45</p></td></tr><tr><td><p>9072.</p><p>131</p></td><td><p>111.4</p><p>34</p></td><td><p>54.71</p><p>5</p></td><td><p>1.423</p></td><td><p>49.90</p><p>3</p></td><td><p>1.274</p></td><td><p>H-(C)_Mal-</p><p>PEG6C2-#45</p></td></tr><tr><td><p>16.73</p><p>7</p></td><td><p>0.417</p></td><td><p>7.988</p></td><td><p>0.204</p></td><td><p>9.997</p></td><td><p>0.258</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#45</p></td></tr><tr><td><p>138.0</p><p>26</p></td><td><p>2.45</p></td><td><p>45.07</p><p>2</p></td><td><p>0.992</p></td><td><p>19.82</p><p>1</p></td><td><p>0.436</p></td><td><p>H-(C)_mc-#54</p></td></tr><tr><td><p>2427.</p><p>639</p></td><td><p>5.743</p></td><td><p>12.99</p><p>5</p></td><td><p>0.356</p></td><td><p>5147.</p><p>54</p></td><td><p>1.938</p></td><td><p>H-(C)_Mal-</p><p>PEG6C2-#69</p></td></tr><tr><td><p><</p><p>8.946</p></td><td><p><</p><p>0.185</p></td><td><p>2.878</p></td><td><p>0.073</p></td><td><p>7.17</p></td><td><p>0.18</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td><p>8.722</p></td><td><p>0.249</p></td><td><p>2.61</p></td><td><p>0.078</p></td><td><p>4.522</p></td><td><p>0.133</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#70</p></td></tr>
٤٠٦٩
-٦٢٦-
<tr><td><p>297.2</p><p>54</p></td><td><p>7.576</p></td><td><p>24.54</p><p>3</p></td><td><p>0.654</p></td><td><p>18.09</p><p>7</p></td><td><p>0.483</p></td><td><p>H-(C)_mc-#79</p></td></tr><tr><td><p>21.13</p><p>4</p></td><td><p>0.469</p></td><td><p>5.682</p></td><td><p>0.127</p></td><td><p>6.634</p></td><td><p>0.152</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#79</p></td></tr><tr><td></td><td><p>0.841</p></td><td></td><td><p>0.109</p></td><td></td><td><p>0.272</p></td><td><p>H-(C)_mc-#115</p></td></tr><tr><td></td><td><p>17.29</p><p>7</p></td><td></td><td></td><td></td><td><p>41.768</p></td><td><p>H-A114C-(C114)_mc-#51</p></td></tr><tr><td></td><td><p>8.216</p></td><td></td><td></td><td></td><td><p>3.269</p></td><td><p>H-A114C-(C114)_mc-#47</p></td></tr><tr><td></td><td><p>7.195</p></td><td></td><td></td><td></td><td><p>4.294</p></td><td><p>H-A114C-</p><p>(C114)_mc-#54</p></td></tr><tr><td></td><td><p>0.696</p></td><td></td><td><p>0.31</p></td><td></td><td><p>0.493</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#47</p></td></tr><tr><td></td><td><p>0.189</p></td><td></td><td><p>0.17</p></td><td></td><td><p>0.174</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td></td><td><p>4.314</p></td><td></td><td><p>28.2</p></td><td></td><td><p>2.548</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#26</p></td></tr>
٤٠٦٩
-٦٢٧-
<tr><td></td><td><p>></p><p>980.0</p><p>26</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>60.648</p></td><td><p>H-A114C-</p><p>(C114)_mc-#26</p></td></tr><tr><td></td><td><p>13.57</p><p>9</p></td><td></td><td><p>26.18</p></td><td></td><td><p>2.007</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#36</p></td></tr><tr><td></td><td><p>0.524</p></td><td></td><td><p>0.16</p></td><td></td><td><p>0.283</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#42</p></td></tr><tr><td></td><td><p>44.16</p><p>4</p></td><td></td><td><p>1.54</p></td><td></td><td><p>0.81</p></td><td><p>H-A114C-(C114)_mc-#42</p></td></tr><tr><td></td><td><p>0.345</p></td><td></td><td><p>0.27</p></td><td></td><td><p>0.292</p></td><td><p>H-(C)-</p><p>mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>41.01</p><p>6</p></td><td></td><td><p>14.33</p></td><td></td><td><p>15.134</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg3C2-#54</p></td></tr><tr><td></td><td><p>11.71</p></td><td></td><td><p>1.4</p></td><td></td><td><p>1.898</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg6C2-#54</p></td></tr><tr><td></td><td><p>20.00</p><p>7</p></td><td></td><td><p>3.52</p></td><td></td><td><p>4.429</p></td><td><p>H-(C)_mc-#47</p></td></tr>
٤٠٦٩
-٦٢٨-
<tr><td></td><td><p>></p><p>41.71</p><p>1</p></td><td></td><td><p>1.54</p></td><td></td><td><p>2.181</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#54</p></td></tr><tr><td></td><td><p>48.56</p><p>6</p></td><td></td><td><p>6.28</p></td><td></td><td><p>3.565</p></td><td><p>H-(C)_mc-#54</p></td></tr><tr><td></td><td><p>></p><p>543.8</p><p>52</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>5.228</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg3C2-#47</p></td></tr><tr><td></td><td><p>16.85</p><p>6</p></td><td></td><td><p>1.29</p></td><td></td><td><p>1.467</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#47</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>4.95</p></td><td></td><td><p>1.587</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg3C2-#42</p></td></tr><tr><td></td><td><p>7.543</p></td><td></td><td><p>0.68</p></td><td></td><td><p>0.506</p></td><td><p>H-(C)_mc-#41</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>11.211</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg3C2-#26</p></td></tr><tr><td></td><td><p>14.28</p><p>3</p></td><td></td><td><p>2.46</p></td><td></td><td><p>0.935</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg6C2-#47</p></td></tr><tr><td></td><td><p>5.479</p></td><td></td><td><p>0.51</p></td><td></td><td><p>0.517</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#42</p></td></tr>
٤٠٦٩
-٦٢٩-
<tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>10.992</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg6C2-#26</p></td></tr><tr><td></td><td><p>75.64</p><p>3</p></td><td></td><td><p>1.97</p></td><td></td><td><p>1.819</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg6C2-#42</p></td></tr><tr><td></td><td><p>></p><p>56.92</p><p>8</p></td><td></td><td><p>1.02</p></td><td></td><td><p>2.108</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#54</p></td></tr><tr><td></td><td><p>31.76</p><p>2</p></td><td></td><td><p>1.42</p></td><td></td><td><p>1.637</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#47</p></td></tr><tr><td></td><td><p>></p><p>817.8</p><p>59</p></td><td></td><td><p>9.55</p></td><td></td><td><p>6.385</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#26</p></td></tr><tr><td></td><td><p>></p><p>7.993</p></td><td></td><td><p>0.55</p></td><td></td><td><p>0.518</p></td><td><p>H-(C)-MalPeg6C2-</p><p>#42</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-(C)_mc-#36</p></td></tr><tr><td></td><td><p>14.91</p><p>7</p></td><td></td><td><p>6.45</p></td><td></td><td><p>0.835</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#60</p></td></tr>
٤٠٦٩
-٦٣٠-
<tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>9.43</p></td><td></td><td><p>11.506</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#26</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg3C2-#36</p></td></tr><tr><td></td><td><p>></p><p>325.7</p><p>14</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA BCAmPeg3C2-#36</p></td></tr><tr><td></td><td><p>133.4</p><p>26</p></td><td></td><td><p>2.01</p></td><td></td><td><p>1.228</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-#54</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#60</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#60</p></td></tr><tr><td></td><td><p>5.882</p></td><td></td><td><p>0.36</p></td><td></td><td><p>1.166</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#41</p></td></tr><tr><td></td><td><p>3.05</p></td><td></td><td><p>0.47</p></td><td></td><td><p>0.427</p></td><td><p>H-(C)-mc-#69</p></td></tr>
٤٠٦٩
-٦٣١-
<tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>720.82</p><p>6</p></td><td><p>H-(C)_MalPeg3C2-</p><p>#36</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg6C2-#36</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>159.1</p></td><td></td><td><p>878.90</p><p>3</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#36</p></td></tr><tr><td></td><td><p>18.72</p><p>8</p></td><td></td><td><p>2.28</p></td><td></td><td><p>2.363</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg3C2-#41</p></td></tr><tr><td></td><td><p>4.004</p></td><td></td><td><p>0.54</p></td><td></td><td><p>0.725</p></td><td><p>H-(C)-MalPeg3C2-</p><p>#41</p></td></tr><tr><td></td><td><p>392.9 05</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>979.98</p><p>2</p></td><td><p>H-</p><p>(C)_mcValCitPABCA mPeg6C2-#60</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>17.235</p></td><td><p>H-A114C-</p><p>(C114)_mc-#66</p></td></tr><tr><td></td><td><p>0.678</p></td><td></td><td><p>0.27</p></td><td></td><td><p>0.249</p></td><td><p>H-L398C+L443C-</p><p>(C398+C443)_mcVa</p><p>lCitPABC-#54</p></td></tr>
٤٠٦٩
-٦٣٢-
<tr><td></td><td><p><</p><p>0.254</p></td><td></td><td><p>0.42</p></td><td></td><td><p>0.195<</p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_mcVa lCitPABC-#54</p></td></tr><tr><td></td><td><p><</p><p>0.267</p></td><td></td><td><p>0.32</p></td><td></td><td><p>0.130<</p></td><td><p>H-L443C-</p><p>(C443)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td></td><td><p>0.504</p></td><td></td><td><p>0.27</p></td><td></td><td><p>0.387</p></td><td><p>H-L398C+V422C-</p><p>(C398+C422)_mcVa</p><p>lCitPABC-#54</p></td></tr><tr><td></td><td><p>></p><p>878.4</p><p>89</p></td><td></td><td><p>></p><p>507.2</p><p>3</p></td><td></td><td><p>3.553</p></td><td><p>H-(C)-mc-#44</p></td></tr><tr><td></td><td><p>></p><p>834.7</p><p>17</p></td><td></td><td><p>68.41</p></td><td></td><td><p>2.886</p></td><td><p>H-(C)-Mal-</p><p>PEG3C2-#45</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>703.41</p><p>9</p></td><td><p>H-</p><p>(C)_2AcAmPeg6C2</p><p>-#66</p></td></tr><tr><td></td><td><p>></p><p>268.0</p><p>47</p></td><td></td><td><p>2.74</p></td><td></td><td><p>1.274</p></td><td><p>H-(C)-Mal-</p><p>PEG6C2-#45</p></td></tr><tr><td></td><td><p>7.576</p></td><td></td><td><p>0.65</p></td><td></td><td><p>0.483</p></td><td><p>H-(C)-mc-#79</p></td></tr>
٤٠٦٩
-٦٣٣-
<tr><td></td><td><p>></p><p>440.8</p><p>81</p></td><td></td><td><p>5.11</p></td><td></td><td><p>2.603</p></td><td><p>H-(C)-MalPeg3C2-</p><p>#44</p></td></tr><tr><td></td><td><p><</p><p>0.179</p></td><td></td><td><p>0.09</p></td><td></td><td><p>0.188</p></td><td><p>H-(C)-</p><p>mcValCitPABC-#70</p></td></tr><tr><td></td><td><p>98.17</p><p>4</p></td><td></td><td><p>1.47</p></td><td></td><td><p>1.318</p></td><td><p>H-(C)-MalPeg6C2-</p><p>#44</p></td></tr><tr><td></td><td><p>0.207</p></td><td></td><td><p>0.06</p></td><td></td><td><p>0.174</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#69</p></td></tr><tr><td></td><td><p>0.469</p></td><td></td><td><p>0.15</p></td><td></td><td><p>0.152</p></td><td><p>H-(C)-</p><p>mcValCitPABC-#79</p></td></tr><tr><td></td><td><p>0.386</p></td><td></td><td><p>0.12</p></td><td></td><td><p>0.124</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#79</p></td></tr><tr><td></td><td><p>0.732</p></td><td></td><td><p>0.18</p></td><td></td><td><p>0.252</p></td><td><p>H-(C)-</p><p>mcValCitPABC-#44</p></td></tr><tr><td></td><td><p>62.82</p><p>5</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>8.127</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#88</p></td></tr><tr><td></td><td><p>0.249</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.133</p></td><td><p>H-(C)-</p><p>mcValCitPABC-#69</p></td></tr>
٤٠٦٩
-٦٣٤-
<tr><td></td><td><p>2.45</p></td><td></td><td><p>0.99</p></td><td></td><td><p>0.436</p></td><td><p>H-</p><p>(C)_2AcAmCapValC itPABC-#66</p></td></tr><tr><td></td><td><p>0.496</p></td><td></td><td><p>0.2</p></td><td></td><td><p>0.217</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#45</p></td></tr><tr><td></td><td><p>18.42</p><p>2</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>3.724</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#34</p></td></tr><tr><td></td><td><p>148.8</p><p>52</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>6.431</p></td><td><p>H-A114C-</p><p>(C114)_mc-#45</p></td></tr><tr><td></td><td><p>7.208</p></td><td></td><td><p>0.62</p></td><td></td><td><p>0.349</p></td><td><p>H-A114C-(C114)_mc-#70</p></td></tr><tr><td></td><td><p>0.469</p></td><td></td><td><p>0.24</p></td><td></td><td><p>0.226</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#112</p></td></tr><tr><td></td><td><p>1.8</p></td><td></td><td><p>0.54</p></td><td></td><td><p>0.453</p></td><td><p>H-(C)-Mal-</p><p>PEG6C2-#69</p></td></tr><tr><td></td><td><p>0.22</p></td><td></td><td><p>0.06</p></td><td></td><td><p>0.368</p></td><td><p>H-Q347C-</p><p>(C347)_mcValCitPA</p><p>BC-#69</p></td></tr>
٤٠٦٩
-٦٣٥-
<tr><td></td><td><p>0.295</p></td><td></td><td><p>0.06</p></td><td></td><td><p>0.359</p></td><td><p>H-Y373C-</p><p>(C373)_mcValCitPA</p><p>BC-#69</p></td></tr><tr><td></td><td><p>0.314</p></td><td></td><td><p>0.06</p></td><td></td><td><p>0.427</p></td><td><p>H-E388C-</p><p>(C388)_mcValCitPA</p><p>BC-#69</p></td></tr><tr><td></td><td><p>0.244</p></td><td></td><td><p>0.09</p></td><td></td><td><p>0.434</p></td><td><p>H-N421C-</p><p>(C421)_mcValCitPA</p><p>BC-#69</p></td></tr><tr><td></td><td><p>0.272</p></td><td></td><td><p>0.05</p></td><td></td><td><p>0.239</p></td><td><p>H-L443C-</p><p>(C443)_mcValCitPA</p><p>BC-#69</p></td></tr><tr><td></td><td><p>0.412</p></td><td></td><td><p>0.15</p></td><td></td><td><p>0.3</p></td><td><p>H-L443C-</p><p>(C443)_mcValCitPA</p><p>BC-#79</p></td></tr><tr><td></td><td><p>0.852</p></td><td></td><td><p>0.36</p></td><td></td><td><p>0.381</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#95</p></td></tr><tr><td></td><td><p>0.258</p></td><td></td><td><p>0.24</p></td><td></td><td><p>0.171</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#98</p></td></tr>
٤٠٦٩
-٦٣٦-
<tr><td></td><td><p>1.589</p></td><td></td><td><p>0.58</p></td><td></td><td><p>0.221</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg3C2</p><p>-#69</p></td></tr><tr><td></td><td><p>5.42</p></td><td></td><td><p>0.36</p></td><td></td><td><p>0.466</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-</p><p>#42</p></td></tr><tr><td></td><td><p>6.899</p></td><td></td><td><p>0.37</p></td><td></td><td><p>0.557</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-</p><p>#54</p></td></tr><tr><td></td><td><p>4.337</p></td><td></td><td><p>0.43</p></td><td></td><td><p>0.346</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-</p><p>#47</p></td></tr><tr><td></td><td><p>284.2</p><p>67</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>3.003</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-</p><p>#36</p></td></tr><tr><td></td><td><p>35.33</p><p>1</p></td><td></td><td><p>1.07</p></td><td></td><td><p>0.991</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-</p><p>#26</p></td></tr><tr><td></td><td><p>></p><p>1000.</p><p>000</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>13.812</p></td><td><p>H-N297Q-</p><p>(Q)_AmPeg6C2-</p><p>#66</p></td></tr>
٤٠٦٩
-٦٣٧-
<tr><td></td><td><p>1.989</p></td><td></td><td><p>0.25</p></td><td></td><td><p>0.251</p></td><td><p>H-L443C-</p><p>(C443)_MalPeg6C2</p><p>-#69</p></td></tr><tr><td></td><td><p>0.887</p></td><td></td><td><p>0.3</p></td><td></td><td><p>0.267</p></td><td><p>H-Q347C-</p><p>(C347)_MalPeg6C2</p><p>-#69</p></td></tr><tr><td></td><td><p>3.035</p></td><td></td><td><p>0.46</p></td><td></td><td><p>0.382</p></td><td><p>H-E388C-(C388)_MalPeg6C2 -#69</p></td></tr><tr><td></td><td><p>1.329</p></td><td></td><td><p>0.45</p></td><td></td><td><p>0.35</p></td><td><p>H-N421C-</p><p>(C421)_MalPeg6C2</p><p>-#69</p></td></tr><tr><td></td><td><p>5.588</p></td><td></td><td><p>0.49</p></td><td></td><td><p>0.482</p></td><td><p>H-E380C-</p><p>(C380)_MalPeg6C2</p><p>-#69</p></td></tr><tr><td></td><td><p>1.346</p></td><td></td><td><p>0.3</p></td><td></td><td><p>0.226</p></td><td><p>H-L398C+L443C-</p><p>(C398+C443)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>1.63</p></td><td></td><td><p>0.31</p></td><td></td><td><p>0.268</p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_MalPeg6C2-#69</p></td></tr>
٤٠٦٩
-٦٣٨-
<tr><td></td><td><p>1.635</p></td><td></td><td><p>0.34</p></td><td></td><td><p>0.297</p></td><td><p>H-kA111C-</p><p>(kC111)_MalPeg6C</p><p>2-#69</p></td></tr><tr><td></td><td><p>2.23</p></td><td></td><td><p>0.5</p></td><td></td><td><p>0.257</p></td><td><p>H-kK183C-</p><p>(kC183)_MalPeg6C</p><p>2-#69</p></td></tr><tr><td></td><td><p>1.744</p></td><td></td><td><p>0.41</p></td><td></td><td><p>0.252</p></td><td><p>H-kK207C-</p><p>(kC207)_MalPeg6C</p><p>2-#69</p></td></tr><tr><td></td><td><p>0.777</p></td><td></td><td><p>0.12</p></td><td></td><td><p>0.212</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#108</p></td></tr><tr><td></td><td><p>1.733</p></td><td></td><td><p>12.2</p></td><td></td><td><p>0.627</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#84</p></td></tr><tr><td></td><td><p>0.239</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.2</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#226</p></td></tr><tr><td></td><td><p>113.8</p><p>89</p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-A114C-(C114)_mc-#108</p></td></tr>
٤٠٦٩
-٦٣٩-
<tr><td></td><td><p>0.239</p></td><td></td><td><p>0.17</p></td><td></td><td><p>0.242</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#117</p></td></tr><tr><td></td><td><p>0.211</p></td><td></td><td><p>0.2</p></td><td></td><td><p>0.202</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#115</p></td></tr><tr><td></td><td><p>1.46</p></td><td></td><td><p>0.47</p></td><td></td><td><p>0.576</p></td><td><p>H-A114C-(C114)_MalPeg6C2 -#98</p></td></tr><tr><td></td><td><p>0.505</p></td><td></td><td><p>0.17</p></td><td></td><td><p>0.257</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-0#118</p></td></tr><tr><td></td><td><p>0.398</p></td><td></td><td><p>0.24</p></td><td></td><td><p>0.251</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-0#118</p></td></tr><tr><td></td><td><p>0.887</p></td><td></td><td><p>0.31</p></td><td></td><td><p>0.341</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#80</p></td></tr><tr><td></td><td><p>0.465</p></td><td></td><td><p>0.14</p></td><td></td><td><p>0.197</p></td><td><p>H-A114C-(C114)_mc-#117</p></td></tr><tr><td></td><td><p>1.367</p></td><td></td><td><p>1.31</p></td><td></td><td><p>0.376</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#232</p></td></tr>
٤٠٦٩
-٦٤٠-
<tr><td></td><td><p>3.179</p></td><td></td><td><p>0.85</p></td><td></td><td><p>0.504</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-#230</p></td></tr><tr><td></td><td><p>0.792</p></td><td></td><td><p>0.21</p></td><td></td><td><p>0.335</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-#117</p></td></tr><tr><td></td><td><p>0.45</p></td><td></td><td><p>0.23</p></td><td></td><td><p>0.243</p></td><td><p>H-A114C-(C114)_mc-#115</p></td></tr><tr><td></td><td><p>0.65</p></td><td></td><td><p>0.15</p></td><td></td><td><p>0.21</p></td><td><p>H-A114C-(C114)_mv-#115</p></td></tr><tr><td></td><td><p>2.137</p></td><td></td><td><p>0.43</p></td><td></td><td><p>0.256</p></td><td><p>H-A114C-</p><p>(C114)_mb-#69</p></td></tr><tr><td></td><td><p>1.043</p></td><td></td><td><p>0.27</p></td><td></td><td><p>0.215</p></td><td><p>H-A114C-</p><p>(C114)_mv-#69</p></td></tr><tr><td></td><td><p>0.342</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.151</p></td><td><p>H-A114C-</p><p>(C114)_mc-0#118</p></td></tr><tr><td></td><td><p>0.314</p></td><td></td><td><p>0.06</p></td><td></td><td><p>0.162</p></td><td><p>H-(C)_mc-#117</p></td></tr><tr><td></td><td><p>0.515</p></td><td></td><td><p>0.07</p></td><td></td><td><p>0.283</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#117</p></td></tr><tr><td></td><td><p>0.303</p></td><td></td><td><p>0.10<</p></td><td></td><td><p>0.18</p></td><td><p>H-(C)_mc-0#118</p></td></tr>
٤٠٦٩
-٦٤١-
<tr><td></td><td><p>0.499</p></td><td></td><td><p>0.15</p></td><td></td><td><p>0.269</p></td><td><p>H-(C)_MalPeg6C2-</p><p>0#118</p></td></tr><tr><td></td><td><p>0.685</p></td><td></td><td><p>0.22</p></td><td></td><td><p>0.28</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-#226</p></td></tr><tr><td></td><td><p>0.694</p></td><td></td><td><p>0.41</p></td><td></td><td><p>0.296</p></td><td><p>H-A114C-(C114)_mc-#172</p></td></tr><tr><td></td><td><p>0.709</p></td><td></td><td><p>0.33</p></td><td></td><td><p>0.318</p></td><td><p>H-A114C-</p><p>(C114)_mb-0#118</p></td></tr><tr><td></td><td><p>0.64</p></td><td></td><td><p>0.33</p></td><td></td><td><p>0.256</p></td><td><p>H-A114C-</p><p>(C114)_me-0#118</p></td></tr><tr><td></td><td><p>0.501</p></td><td></td><td><p>0.34</p></td><td></td><td><p>0.301</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#134</p></td></tr><tr><td></td><td><p>1.614</p></td><td></td><td><p>0.76</p></td><td></td><td><p>0.357</p></td><td><p>H-A114C-</p><p>(C114)_mc-#131</p></td></tr><tr><td></td><td><p>1.377</p></td><td></td><td><p>0.36</p></td><td></td><td><p>0.284</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-#126</p></td></tr><tr><td></td><td><p>1.867</p></td><td></td><td><p>0.34</p></td><td></td><td><p>0.362</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-#123</p></td></tr>
٤٠٦٩
-٦٤٢-
<tr><td></td><td><p>3.294</p></td><td></td><td><p>0.49</p></td><td></td><td><p>0.319</p></td><td><p>H-A114C-(C114)_mc-#126</p></td></tr><tr><td></td><td><p>0.719</p></td><td></td><td><p>0.25</p></td><td></td><td><p>0.209</p></td><td><p>H-A114C-</p><p>(C114)_mv-0#118</p></td></tr><tr><td></td><td><p>1.126</p></td><td></td><td><p>0.22</p></td><td></td><td><p>0.575</p></td><td><p>H-(C)_MalPeg6C2-</p><p>#226</p></td></tr><tr><td></td><td><p>0.69</p></td><td></td><td><p>0.18</p></td><td></td><td><p>0.359</p></td><td><p>H-(C)_mc-#226</p></td></tr><tr><td></td><td><p>0.448</p></td><td></td><td><p>0.11</p></td><td></td><td><p>0.26</p></td><td><p>H-(C)_m(H2O)c-</p><p>0#118</p></td></tr><tr><td></td><td><p>0.9</p></td><td></td><td><p>0.19</p></td><td></td><td><p>0.482</p></td><td><p>H-</p><p>(C)_Mal(H2O)Peg6</p><p>C2-0#118</p></td></tr><tr><td></td><td><p>5.769</p></td><td></td><td><p>0.51</p></td><td></td><td><p>0.832</p></td><td><p>H-</p><p>(C)_Mal(H2O)Peg6</p><p>C2-#69</p></td></tr><tr><td></td><td><p>1.529</p></td><td></td><td><p>0.28</p></td><td></td><td><p>0.418</p></td><td><p>H-(C)_m(H2O)c-</p><p>#69</p></td></tr><tr><td></td><td><p>0.218</p></td><td></td><td><p>0.11</p></td><td></td><td><p>0.186</p></td><td><p>H-(C)_me-0#118</p></td></tr><tr><td></td><td><p>0.265</p></td><td></td><td><p>0.14</p></td><td></td><td><p>0.201</p></td><td><p>H-(C)_mv-0#118</p></td></tr><tr><td></td><td><p>0.267</p></td><td></td><td><p>0.13</p></td><td></td><td><p>0.222</p></td><td><p>H-(C)_mb-0#118</p></td></tr>
٤٠٦٩
-٦٤٣-
<tr><td></td><td><p>8.003</p></td><td></td><td><p>5.11</p></td><td></td><td><p>0.662</p></td><td><p>H-A114C-</p><p>(C114)_MalC6-#54</p></td></tr><tr><td></td><td><p>1000></p></td><td></td><td><p>></p><p>1000.</p><p>00</p></td><td></td><td><p>></p><p>1000.0</p><p>00</p></td><td><p>H-A114C-</p><p>(C114)_mc-#231</p></td></tr><tr><td></td><td><p>15.40</p><p>7</p></td><td></td><td><p>113</p></td><td></td><td><p>0.976</p></td><td><p>H-A114C-</p><p>(C114)_MalC6-</p><p>0#118</p></td></tr><tr><td></td><td><p>3.439</p></td><td></td><td><p>0.28</p></td><td></td><td><p>1.06</p></td><td><p>H-</p><p>(C)_Mal(H2O)Peg6</p><p>C2-#115</p></td></tr><tr><td></td><td><p>0.739</p></td><td></td><td><p>0.35</p></td><td></td><td><p>0.247</p></td><td><p>H-A114C-(C114)_mc-#158</p></td></tr><tr><td></td><td><p>13.44</p><p>7</p></td><td></td><td><p>24.41</p></td><td></td><td><p>1.178</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#231</p></td></tr><tr><td></td><td><p>0.498</p></td><td></td><td><p>0.17</p></td><td></td><td><p>0.393</p></td><td><p>H-(C)_m(H2O)c-</p><p>#115</p></td></tr><tr><td></td><td><p>27.90</p><p>7</p></td><td></td><td><p>0.68</p></td><td></td><td><p>0.97</p></td><td><p>H-A114C-(C114)_mc-#237</p></td></tr><tr><td></td><td><p>643.3</p><p>91</p></td><td></td><td><p>585.5</p><p>9</p></td><td></td><td><p>4.681</p></td><td><p>H-A114C-(C114)_mc-#145</p></td></tr>
٤٠٦٩
-٦٤٤-
<tr><td></td><td><p>89.12</p><p>5</p></td><td></td><td><p>190.5</p><p>9</p></td><td></td><td><p>12.856</p></td><td><p>H-A114C-</p><p>(C114)_MalPeg6C2</p><p>-#145</p></td></tr><tr><td></td><td><p>1.144</p></td><td></td><td><p>0.15</p></td><td></td><td><p>0.377</p></td><td><p>H-A114C-(C114)_mc-#162</p></td></tr><tr><td></td><td><p>0.694</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.42</p></td><td><p>H-A114C-</p><p>(C114)_MalC6Am-</p><p>#151</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td></td><td><p>H-</p><p>(kK188)_COPeg2C2</p><p>ValCitPABC-#54</p></td></tr><tr><td></td><td><p>0.182</p></td><td></td><td><p>0.14</p></td><td></td><td><p>0.227</p></td><td><p>H-</p><p>(C)_mcValCitPABC-0#118</p></td></tr><tr><td></td><td><p>0.363</p></td><td></td><td><p>0.32</p></td><td></td><td><p>0.323</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#154</p></td></tr><tr><td></td><td><p>0.34</p></td><td></td><td><p>0.27</p></td><td></td><td><p>0.377</p></td><td><p>H-A114C-</p><p>(C114)_MalC6Am-</p><p>#153</p></td></tr><tr><td></td><td><p>0.162</p></td><td></td><td><p>0.14</p></td><td></td><td><p>0.211</p></td><td><p>H-</p><p>(C)_mcValCitPABC-</p><p>#98</p></td></tr>
٤٠٦٩
-٦٤٥-
<tr><td></td><td><p>3.197</p></td><td></td><td><p>0.65</p></td><td></td><td><p>0.357</p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPA</p><p>BC-#246</p></td></tr><tr><td></td><td><p>0.237</p></td><td></td><td><p>0.17</p></td><td></td><td><p>0.358</p></td><td><p>H-H435A-</p><p>(C)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>0.114</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.322</p></td><td><p>H-M428L+N434S-(C)_mcValCitPABC-#70</p></td></tr><tr><td></td><td><p>0.217</p></td><td></td><td></td><td></td><td><p>0.354</p></td><td><p>H-M428L+N434S-</p><p>(C)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>0.855</p></td><td></td><td><p>0.99</p></td><td></td><td><p>1.38</p></td><td><p>H-E388C+N421C-</p><p>(C388+C421)_mcVa lCitPABC-#54</p></td></tr><tr><td></td><td><p>0.147</p></td><td></td><td><p>0.29</p></td><td></td><td><p>0.276</p></td><td><p>H-Q347C+K392C-</p><p>(C347+C392)_mcVa lCitPABC-#54</p></td></tr><tr><td></td><td><p><</p><p>0.111</p></td><td></td><td><p>0.37</p></td><td></td><td><p>0.129<</p></td><td><p>H-L443C+kK183C-</p><p>(C443+kC183)_mcV</p><p>alCitPABC-#54</p></td></tr>
٤٠٦٩
-٦٤٦-
<tr><td></td><td><p>0.08</p></td><td></td><td><p>0.25</p></td><td></td><td><p>0.146</p></td><td><p>H-Q347C+kK183C-</p><p>(C347+kC183)_mcV</p><p>alCitPABC-#54</p></td></tr><tr><td></td><td><p>0.111</p></td><td></td><td><p>0.33</p></td><td></td><td><p>0.153</p></td><td><p>H-Q347C-</p><p>(C347)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td></td><td><p>0.304</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.323</p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_mc-</p><p>#115</p></td></tr><tr><td></td><td><p>0.997</p></td><td></td><td><p>0.42</p></td><td></td><td><p>1.251</p></td><td><p>H-E388C+N421C-</p><p>(C388+C421)_mc-</p><p>#115</p></td></tr><tr><td></td><td><p>0.219</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.342</p></td><td><p>H-Q347C+K392C-</p><p>(C347+C392)_mc-</p><p>#115</p></td></tr><tr><td></td><td><p>0.268</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.319</p></td><td><p>H-L443C+kK183C-</p><p>(C443+kC183)_mc-</p><p>#115</p></td></tr><tr><td></td><td><p>0.403</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.347</p></td><td><p>H-Q347C+kK183C-</p><p>(C347+kC183)_mc-</p><p>#115</p></td></tr><tr><td></td><td><p>0.278</p></td><td></td><td><p>0.18</p></td><td></td><td><p>0.272</p></td><td><p>H-Q347C-</p><p>(C347)_mc-#115</p></td></tr>
٤٠٦٩
-٦٤٧-
<tr><td></td><td><p>0.194</p></td><td></td><td><p>0.34</p></td><td></td><td><p>0.287</p></td><td><p>H-kK183C-</p><p>(kC183)_mcValCitP</p><p>ABC-#54</p></td></tr><tr><td></td><td><p>0.084</p></td><td></td><td><p>0.38</p></td><td></td><td><p>0.098</p></td><td><p>H-E388C-</p><p>(C388)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td></td><td><p>0.269</p></td><td></td><td><p>0.27</p></td><td></td><td><p>0.28</p></td><td><p>H-kK183C-(kC183)_mc-#115</p></td></tr><tr><td></td><td><p>0.301</p></td><td></td><td><p>0.15</p></td><td></td><td><p>0.302</p></td><td><p>H-E388C-(C388)_mc-#115</p></td></tr><tr><td></td><td><p>0.259</p></td><td></td><td><p>0.1</p></td><td></td><td><p>0.222</p></td><td><p>H-L443C-(C443)_mc-#115</p></td></tr><tr><td></td><td><p><</p><p>0.051</p></td><td></td><td><p>0.42</p></td><td></td><td><p>0.051<</p></td><td><p>H-N421C-</p><p>(C421)_mcValCitPA</p><p>BC-#54</p></td></tr><tr><td></td><td><p>0.306</p></td><td></td><td><p>0.23</p></td><td></td><td><p>0.312</p></td><td><p>H-N421C-(C421)_mc-#115</p></td></tr><tr><td></td><td></td><td></td><td></td><td></td><td><p>0.321</p></td><td><p>H-A114C-</p><p>(C114)_mcGly-</p><p>#201</p></td></tr>
Table 21(b): IC50 values for special substances selected from the invention
<tr><td><p>MDA-MB-468</p></td><td><p>DYT2</p></td><td></td></tr>
٤٠٦٩
-٦٤٨-
<tr><td><p dir="rtl">IC50 MF of added body GALAGAAD (NFC) ARM/ml)</p></td><td><p>IC50</p><p dir="rtl">(NFG particle)</p></td><td><p dir="rtl">IC50 MF of added body GALAGAAD (NFC) ARM/ml)</p></td><td><p>IC50</p><p dir="rtl">(NFG particle)</p></td><td><p dir="rtl">Connection number - for ADC connector</p></td></tr><tr><td><p>35714.286></p></td><td></td><td><p>17528.581></p></td><td><p>69.685></p></td><td><p>H-(C)_MalPeg3C2-#41</p></td></tr><tr><td><p>25857.971></p></td><td><p>629.281></p></td><td><p>5455.61</p></td><td><p>33.396</p></td><td><p>H-(C)_MalPeg6C2-#42</p></td></tr><tr><td><p>34090.909></p></td><td><p>1000.000></p></td><td><p>34090.909></p></td><td><p>1000.000></p></td><td><p>H-(C)_mc-#44</p></td></tr><tr><td><p>44117.647></p></td><td><p>1000.000></p></td><td><p>44117.647></p></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg3C2-#44</p></td></tr><tr><td><p>44117.647></p></td><td><p>1000.000></p></td><td><p>44117.647></p></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg6C2-#44</p></td></tr><tr><td><p>35714.286></p></td><td><p>1000.000></p></td><td><p>7.246</p></td><td><p>0.203</p></td><td><p>H-(C)_mcValCitPABC-#44</p></td></tr><tr><td><p>34883.721></p></td><td><p>1000.000></p></td><td><p>34883.721></p></td><td><p>1000.000></p></td><td><p>H-(C)_Mal-PEG3C2-#45</p></td></tr><tr><td><p>38461.538></p></td><td><p>1000.000></p></td><td><p>38461.538></p></td><td><p>1000.000></p></td><td><p>H-(C)_Mal-PEG6C2-#45</p></td></tr><tr><td><p>24435.914</p></td><td><p>613.294</p></td><td><p>14.304</p></td><td><p>0.371</p></td><td><p>H-(C)_mcValCitPABC-#45</p></td></tr><tr><td><p>45454.545></p></td><td><p>1000.000></p></td><td><p>45454.545></p></td><td><p>1000.000></p></td><td><p>H-(C)_mc-#54</p></td></tr><tr><td><p>35714.286></p></td><td><p>1000.000></p></td><td><p>29849.279></p></td><td><p>467.163></p></td><td><p>H-(C)_Mal-PEG6C2-#69</p></td></tr><tr><td><p>21860.354</p></td><td><p>547.953</p></td><td><p>7.54</p></td><td><p>0.156</p></td><td><p>H-(C)_mcValCitPABC-#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td><p>3.332</p></td><td><p>0.098</p></td><td><p>H-(C)_mcValCitPABC-#70</p></td></tr><tr><td><p>36694.065</p></td><td><p>978.508</p></td><td><p>37500.000></p></td><td><p>1000.000></p></td><td><p>H-(C)_mc-#79</p></td></tr><tr><td><p>15383.462</p></td><td><p>351.392</p></td><td><p>9.528</p></td><td><p>0.212</p></td><td><p>H-(C)_mcValCitPABC-#79</p></td></tr>
٤٠٦٩
-٦٤٩-
<tr><td></td><td></td><td></td><td><p>0.21</p></td><td><p>H-(C)_mc-#115</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#51</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#47</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#54</p></td></tr><tr><td></td><td><p>445.014</p></td><td></td><td><p>383.667</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#47</p></td></tr><tr><td></td><td><p>362.213</p></td><td></td><td><p>0.372</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>930.555></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#26</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#26</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>927.422></p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#36</p></td></tr><tr><td></td><td><p>530.596</p></td><td></td><td><p>0.436</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#42</p></td></tr><tr><td></td><td><p>567.735</p></td><td></td><td><p>727.245></p></td><td><p>H-A114C-(C114)_mc-#42</p></td></tr><tr><td></td><td><p>471.905</p></td><td></td><td><p>0.275</p></td><td><p>H-(C)-mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-</p><p>#54</p></td></tr>
٤٠٦٩
-٦٥٠-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-</p><p>#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mc-#47</p></td></tr><tr><td></td><td><p>1651.007></p></td><td></td><td><p>1651.007></p></td><td><p>H-(C)_MalPeg3C2-#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mc-#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-</p><p>#47</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg3C2-#47</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-</p><p>#42</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mc-#41</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-</p><p>#26</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-</p><p>#47</p></td></tr><tr><td></td><td><p>358.435</p></td><td></td><td><p>9.675</p></td><td><p>H-(C)_MalPeg3C2-#42</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-</p><p>#26</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-</p><p>#42</p></td></tr>
٤٠٦٩
-٦٥١-
<tr><td></td><td><p>1731.544></p></td><td></td><td><p>1731.544></p></td><td><p>H-(C)_MalPeg6C2-#54</p></td></tr><tr><td></td><td><p>1651.007></p></td><td></td><td><p>1651.007></p></td><td><p>H-(C)_MalPeg6C2-#47</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg6C2-#26</p></td></tr><tr><td></td><td><p>642.029></p></td><td></td><td><p>5.705</p></td><td><p>H-(C)-MalPeg6C2-#42</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mc-#36</p></td></tr><tr><td></td><td><p>544.495></p></td><td></td><td><p>699.241></p></td><td><p>H-(C)_mcValCitPABC-#60</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg3C2-#26</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-</p><p>#36</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-</p><p>(C114)_mcValCitPABCAmPeg3C2-</p><p>#36</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_MalPeg6C2-#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg3C2-#60</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg6C2-#60</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg6C2-#41</p></td></tr><tr><td></td><td><p>899.249></p></td><td></td><td><p>71.831></p></td><td><p>H-(C)-mc-#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg3C2-#36</p></td></tr>
٤٠٦٩
-٦٥٢-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-</p><p>#36</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_MalPeg6C2-#36</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg3C2-</p><p>#41</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>69.685></p></td><td><p>H-(C)-MalPeg3C2-#41</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_mcValCitPABCAmPeg6C2-</p><p>#60</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#66</p></td></tr><tr><td></td><td><p>801.354</p></td><td></td><td><p>0.463</p></td><td><p>H-L398C+L443C-</p><p>(C398+C443)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>565.01</p></td><td></td><td><p>0.171<</p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>500.958</p></td><td></td><td><p>0.371</p></td><td><p>H-L443C-(C443)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>610.884</p></td><td></td><td><p>0.48</p></td><td><p>H-L398C+V422C-</p><p>(C398+C422)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)-mc-#44</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)-Mal-PEG3C2-#45</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_2AcAmPeg6C2-#66</p></td></tr>
٤٠٦٩
-٦٥٣-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)-Mal-PEG6C2-#45</p></td></tr><tr><td></td><td><p>978.508</p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)-mc-#79</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)-MalPeg3C2-#44</p></td></tr><tr><td></td><td><p>547.953</p></td><td></td><td><p>0.116</p></td><td><p>H-(C)-mcValCitPABC-#70</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)-MalPeg6C2-#44</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.083</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td></td><td><p>351.392</p></td><td></td><td><p>0.212</p></td><td><p>H-(C)-mcValCitPABC-#79</p></td></tr><tr><td></td><td><p>472.593</p></td><td></td><td><p>0.199</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#79</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.248</p></td><td><p>H-(C)-mcValCitPABC-#44</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#88</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.098</p></td><td><p>H-(C)-mcValCitPABC-#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-(C)_2AcAmCapValCitPABC-#66</p></td></tr><tr><td></td><td><p>968.025></p></td><td></td><td><p>2.37</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#45</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#34</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#45</p></td></tr>
٤٠٦٩
-٦٥٤-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#70</p></td></tr><tr><td></td><td><p>563.999></p></td><td></td><td><p>0.185</p></td><td><p>H-(C)_mcValCitPABC-#112</p></td></tr><tr><td></td><td><p>748.275</p></td><td></td><td><p>0.963</p></td><td><p>H-(C)-Mal-PEG6C2-#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.094</p></td><td><p>H-Q347C-(C347)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.156</p></td><td><p>H-Y373C-(C373)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.117</p></td><td><p>H-E388C-(C388)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.162</p></td><td><p>H-N421C-(C421)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.1</p></td><td><p>H-L443C-(C443)_mcValCitPABC-</p><p>#69</p></td></tr><tr><td></td><td><p>370.53</p></td><td></td><td><p>0.303</p></td><td><p>H-L443C-(C443)_mcValCitPABC-</p><p>#79</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>61.8</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#95</p></td></tr><tr><td></td><td><p>609.904</p></td><td></td><td><p>0.218</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#98</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_MalPeg3C2-#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-N297Q-(Q)_AmPeg6C2-#42</p></td></tr>
٤٠٦٩
-٦٥٥-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-N297Q-(Q)_AmPeg6C2-#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-N297Q-(Q)_AmPeg6C2-#47</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-N297Q-(Q)_AmPeg6C2-#36</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-N297Q-(Q)_AmPeg6C2-#26</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-N297Q-(Q)_AmPeg6C2-#66</p></td></tr><tr><td></td><td><p>758.157</p></td><td></td><td><p>1000.000></p></td><td><p>H-L443C-(C443)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>832.08</p></td><td></td><td><p>1.752</p></td><td><p>H-Q347C-(C347)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>973.529></p></td><td></td><td><p>6.883</p></td><td><p>H-E388C-(C388)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>472.466</p></td><td></td><td><p>1.027</p></td><td><p>H-N421C-(C421)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>873.254</p></td><td></td><td><p>65.641></p></td><td><p>H-E380C-(C380)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>846.418</p></td><td></td><td><p>0.827</p></td><td><p>H-L398C+L443C-</p><p>(C398+C443)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>804.407</p></td><td></td><td><p>32.438></p></td><td><p>H-K392C+L443C-</p><p>(C392+C443)_MalPeg6C2-#69</p></td></tr><tr><td></td><td><p>740.791</p></td><td></td><td><p>0.423</p></td><td><p>H-kA111C-(kC111)_MalPeg6C2-</p><p>#69</p></td></tr><tr><td></td><td><p>749.154</p></td><td></td><td><p>1000.000></p></td><td><p>H-kK183C-(kC183)_MalPeg6C2-</p><p>#69</p></td></tr><tr><td></td><td><p>586.857</p></td><td></td><td><p>138.618></p></td><td><p>H-kK207C-(kC207)_MalPeg6C2-</p><p>#69</p></td></tr>
٤٠٦٩
-٦٥٦-
<tr><td></td><td><p>873.831</p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#108</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>976.796</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#84</p></td></tr><tr><td></td><td><p>385.851</p></td><td></td><td><p>0.101</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#226</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#108</p></td></tr><tr><td></td><td><p>469.882</p></td><td></td><td><p>0.107</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#117</p></td></tr><tr><td></td><td><p>989.147</p></td><td></td><td><p>0.142</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#115</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>355.331</p></td><td><p>H-A114C-(C114)_MalPeg6C2-#98</p></td></tr><tr><td></td><td><p>865.455></p></td><td></td><td><p>0.126</p></td><td><p>H-A114C-(C114)_MalPeg6C2-</p><p>0#118</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.215</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>0#118</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.432</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#80</p></td></tr><tr><td></td><td><p>414.892></p></td><td></td><td><p>0.107</p></td><td><p>H-A114C-(C114)_mc-#117</p></td></tr><tr><td></td><td><p>959.259</p></td><td></td><td><p>38.422</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#232</p></td></tr>
٤٠٦٩
-٦٥٧-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_MalPeg6C2-</p><p>#230</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.179</p></td><td><p>H-A114C-(C114)_MalPeg6C2-</p><p>#117</p></td></tr><tr><td></td><td><p>699.755></p></td><td></td><td><p>0.238</p></td><td><p>H-A114C-(C114)_mc-#115</p></td></tr><tr><td></td><td><p>668.891></p></td><td></td><td><p>0.322</p></td><td><p>H-A114C-(C114)_mv-#115</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mb-#69</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mv-#69</p></td></tr><tr><td></td><td><p>432.816</p></td><td></td><td><p>0.098</p></td><td><p>H-A114C-(C114)_mc-0#118</p></td></tr><tr><td></td><td><p>194.684</p></td><td></td><td><p>0.093<</p></td><td><p>H-(C)_mc-#117</p></td></tr><tr><td></td><td><p>361.061</p></td><td></td><td><p>0.080<</p></td><td><p>H-(C)_MalPeg6C2-#117</p></td></tr><tr><td></td><td><p>541.542</p></td><td></td><td><p>0.073<</p></td><td><p>H-(C)_mc-0#118</p></td></tr><tr><td></td><td><p>465.455</p></td><td></td><td><p>0.074</p></td><td><p>H-(C)_MalPeg6C2-0#118</p></td></tr><tr><td></td><td><p>574.794</p></td><td></td><td><p>0.513</p></td><td><p>H-A114C-(C114)_MalPeg6C2-</p><p>#226</p></td></tr><tr><td></td><td><p>500.864</p></td><td></td><td><p>1.48</p></td><td><p>H-A114C-(C114)_mc-#172</p></td></tr><tr><td></td><td><p>506.604</p></td><td></td><td><p>0.208</p></td><td><p>H-A114C-(C114)_mb-0#118</p></td></tr><tr><td></td><td><p>903.571</p></td><td></td><td><p>0.236</p></td><td><p>H-A114C-(C114)_me-0#118</p></td></tr>
٤٠٦٩
-٦٥٨-
<tr><td></td><td><p>648.066</p></td><td></td><td><p>1.434</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#134</p></td></tr><tr><td></td><td><p>480.901</p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#131</p></td></tr><tr><td></td><td><p>656.645</p></td><td></td><td><p>54.268</p></td><td><p>H-A114C-(C114)_MalPeg6C2-</p><p>#126</p></td></tr><tr><td></td><td><p>543.693</p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_MalPeg6C2-</p><p>#123</p></td></tr><tr><td></td><td><p>749.49</p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#126</p></td></tr><tr><td></td><td><p>490.276</p></td><td></td><td><p>0.147</p></td><td><p>H-A114C-(C114)_mv-0#118</p></td></tr><tr><td></td><td><p>582.309</p></td><td></td><td><p>0.206</p></td><td><p>H-(C)_MalPeg6C2-#226</p></td></tr><tr><td></td><td><p>477.622</p></td><td></td><td><p>0.219</p></td><td><p>H-(C)_mc-#226</p></td></tr><tr><td></td><td><p>306.626</p></td><td></td><td><p>0.071</p></td><td><p>H-(C)_m(H2O)c-0#118</p></td></tr><tr><td></td><td><p>441.766</p></td><td></td><td><p>0.059<</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-0#118</p></td></tr><tr><td></td><td><p>459.502</p></td><td></td><td><p>0.203</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-#69</p></td></tr><tr><td></td><td><p>740.334</p></td><td></td><td><p>0.315</p></td><td><p>H-(C)_m(H2O)c-#69</p></td></tr><tr><td></td><td><p>455.314</p></td><td></td><td><p>0.061<</p></td><td><p>H-(C)_me-0#118</p></td></tr><tr><td></td><td><p>531.617</p></td><td></td><td><p>0.084</p></td><td><p>H-(C)_mv-0#118</p></td></tr><tr><td></td><td><p>584.327</p></td><td></td><td><p>0.076</p></td><td><p>H-(C)_mb-0#118</p></td></tr><tr><td></td><td><p>65.721</p></td><td></td><td><p>52.056</p></td><td><p>H-A114C-(C114)_MalC6-#54</p></td></tr>
٤٠٦٩
-٦٥٩-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#231</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_MalC6-0#118</p></td></tr><tr><td></td><td><p>698.101</p></td><td></td><td><p>0.095</p></td><td><p>H-(C)_Mal(H2O)Peg6C2-#115</p></td></tr><tr><td></td><td><p>329.554</p></td><td></td><td><p>0.164</p></td><td><p>H-A114C-(C114)_mc-#158</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#231</p></td></tr><tr><td></td><td><p>534.743</p></td><td></td><td><p>0.069<</p></td><td><p>H-(C)_m(H2O)c-#115</p></td></tr><tr><td></td><td><p>646.464</p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#237</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mc-#145</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_MalPeg6C2-</p><p>#145</p></td></tr><tr><td></td><td><p>676.764</p></td><td></td><td><p>0.201</p></td><td><p>H-A114C-(C114)_mc-#162</p></td></tr><tr><td></td><td><p>75.696</p></td><td></td><td><p>0.469</p></td><td><p>H-A114C-(C114)_MalC6Am-#151</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>H-(kK188)_COPeg2C2ValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.081</p></td><td><p>H-(C)_mcValCitPABC-0#118</p></td></tr><tr><td></td><td><p>566.056</p></td><td></td><td><p>1.708</p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#154</p></td></tr><tr><td></td><td><p>69.259</p></td><td></td><td><p>0.114</p></td><td><p>H-A114C-(C114)_MalC6Am-#153</p></td></tr>
٤٠٦٩
-٦٦٠-
<tr><td></td><td><p>270.019</p></td><td></td><td><p>0.23</p></td><td><p>H-(C)_mcValCitPABC-#98</p></td></tr><tr><td></td><td><p>1000.000></p></td><td></td><td><p>1000.000></p></td><td><p>H-A114C-(C114)_mcValCitPABC-</p><p>#246</p></td></tr><tr><td></td><td><p>339.77</p></td><td></td><td><p>0.208</p></td><td><p>H-H435A-(C)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>380.393</p></td><td></td><td><p>0.069</p></td><td><p>H-M428L+N434S-</p><p>(C)_mcValCitPABC-#70</p></td></tr><tr><td></td><td></td><td></td><td><p>0.178</p></td><td><p>H-M428L+N434S-</p><p>(C)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>826.243</p></td><td></td><td><p>1.033</p></td><td><p>H-E388C+N421C-</p><p>(C388+C421)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>390.7</p></td><td></td><td><p>0.103</p></td><td><p>H-Q347C+K392C-</p><p>(C347+C392)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>395.707</p></td><td></td><td><p>0.103<</p></td><td><p>H-L443C+kK183C-</p><p>(C443+kC183)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>384.028</p></td><td></td><td><p>0.051<</p></td><td><p>H-Q347C+kK183C-</p><p>(C347+kC183)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>393.412</p></td><td></td><td><p>2.89</p></td><td><p>H-Q347C-(C347)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>542.081</p></td><td></td><td><p>0.07</p></td><td><p>H-K392C+L443C-(C392+C443)_mc-#115</p></td></tr>
٤٠٦٩
-٦٦١-
<tr><td></td><td><p>1000.000></p></td><td></td><td><p>0.227</p></td><td><p>H-E388C+N421C-</p><p>(C388+C421)_mc-#115</p></td></tr><tr><td></td><td><p>934.867</p></td><td></td><td><p>0.068</p></td><td><p>H-Q347C+K392C-</p><p>(C347+C392)_mc-#115</p></td></tr><tr><td></td><td><p>757.604</p></td><td></td><td><p>0.071</p></td><td><p>H-L443C+kK183C-(C443+kC183)_mc-#115</p></td></tr><tr><td></td><td><p>741.434</p></td><td></td><td><p>0.073</p></td><td><p>H-Q347C+kK183C-</p><p>(C347+kC183)_mc-#115</p></td></tr><tr><td></td><td><p>888.128</p></td><td></td><td><p>0.098</p></td><td><p>H-Q347C-(C347)_mc-#115</p></td></tr><tr><td></td><td><p>160.012</p></td><td></td><td><p>1.329</p></td><td><p>H-kK183C-</p><p>(kC183)_mcValCitPABC-#54</p></td></tr><tr><td></td><td><p>287.88</p></td><td></td><td><p>0.658</p></td><td><p>H-E388C-(C388)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>775.698</p></td><td></td><td><p>0.179</p></td><td><p>H-kK183C-(kC183)_mc-#115</p></td></tr><tr><td></td><td><p>958.96</p></td><td></td><td><p>0.124</p></td><td><p>H-E388C-(C388)_mc-#115</p></td></tr><tr><td></td><td><p>451.857</p></td><td></td><td><p>0.108</p></td><td><p>H-L443C-(C443)_mc-#115</p></td></tr><tr><td></td><td><p>263.107</p></td><td></td><td><p>0.601</p></td><td><p>H-N421C-(C421)_mcValCitPABC-</p><p>#54</p></td></tr><tr><td></td><td><p>668.857</p></td><td></td><td><p>0.108</p></td><td><p>H-N421C-(C421)_mc-#115</p></td></tr><tr><td></td><td></td><td></td><td><p>0.073</p></td><td><p>H-A114C-(C114)_mcGly-#201</p></td></tr>
٤٠٦٩
-٦٦٢-
Table 22: The price of the medicinal formula transferred from the joint stock. There are different materials from the invention of the medicinal formula transferred from the joint stock Unlimited title, for materials containing MMAE, MMAD or MMAF. The AUCs at the end of the t-term are excluded from the 336-hour period except when observed.
<tr><td></td><td colspan="2"><p dir="rtl">AUC (end in t)</p><p dir="rtl">(Metroglycemic ml* kg/ml)</p></td><td></td><td></td></tr><tr><td><p dir="rtl">rate</p><p>ADC/Ab</p></td><td><p>Ab</p></td><td><p>ADC</p></td><td><p dir="rtl">Dosage</p></td><td><p>ADC</p></td></tr><tr><td><p>74</p></td><td><p>1 4560</p></td><td><p>1 3390</p></td><td><p>3</p></td><td rowspan="3"><p>H(C)-#D54</p></td></tr><tr><td><p>80</p></td><td><p>1 16400</p></td><td><p>1 13200</p></td><td><p>10</p></td></tr><tr><td><p>91</p></td><td><p>1 41700</p></td><td><p>1 37800</p></td><td><p>30</p></td></tr><tr><td><p>68</p></td><td><p>20840</p></td><td><p>14140</p></td><td><p>10</p></td><td rowspan="3"><p>H(C)-#A69</p></td></tr><tr><td><p>69</p></td><td><p>63480</p></td><td><p>44040</p></td><td><p>30</p></td></tr><tr><td><p>69</p></td><td><p>212000</p></td><td><p>146000</p></td><td><p>100</p></td></tr><tr><td><p>84</p></td><td><p>15780</p></td><td><p>13300</p></td><td><p>10</p></td><td rowspan="3"><p>H(C)-MalPEG6C2-MMAD</p></td></tr><tr><td><p>93</p></td><td><p>60280</p></td><td><p>56180</p></td><td><p>30</p></td></tr><tr><td><p>92</p></td><td><p>146800</p></td><td><p>134400</p></td><td><p>100</p></td></tr><tr><td><p>53</p></td><td><p>14500</p></td><td><p>7650</p></td><td><p>10</p></td><td rowspan="2"><p>H(C)-mc-MMAD</p></td></tr><tr><td><p>47</p></td><td><p>43800</p></td><td><p>20700</p></td><td><p>30</p></td></tr>
٤٠٦٩
-٦٦٣-
<tr><td><p>48</p></td><td><p>121000</p></td><td><p>58000</p></td><td><p>100</p></td><td></td></tr><tr><td><p>37</p></td><td><p>3 2950</p></td><td><p>3 1080</p></td><td><p>3</p></td><td rowspan="3"><p>H(C)-vc-MMAE</p></td></tr><tr><td><p>37</p></td><td><p>3 10600</p></td><td><p>3 3930</p></td><td><p>10</p></td></tr><tr><td></td><td><p>3 18400</p></td><td><p>3 13400</p></td><td><p>30</p></td></tr><tr><td><p>44</p></td><td><p>24500</p></td><td><p>10700</p></td><td><p>10</p></td><td rowspan="3"><p>H(C)-mc-MMAF</p></td></tr><tr><td><p>45</p></td><td><p>71500</p></td><td><p>32000</p></td><td><p>30</p></td></tr><tr><td><p>48</p></td><td><p>176000</p></td><td><p>83600</p></td><td><p>100</p></td></tr><tr><td><p>73</p></td><td><p>5200</p></td><td><p>3800</p></td><td><p>3</p></td><td rowspan="2"><p>H(K)-MCC-DM1</p></td></tr><tr><td><p>79</p></td><td><p>16200</p></td><td><p>12800</p></td><td><p>10</p></td></tr>
79 49600 39100 30
1 Symbolizes the end P R M F P R-312 hours
<p dir="rtl">2 Symbolizes the end P R M F P R-168 hours</p>
<p dir="rtl">3 Symbolizes the end p t mf p t-96 hours</p>
Table 23: Prices of the transferred pharmaceutical formula, kilograms, for different substances, in a different composition, and for different substances. GF
5 Including MMAE, MMAD or MMAF. Subtract the AUCs at the end of
336 An hour, except when observing
<tr><td></td><td colspan="2"><p dir="rtl">AUC (end in t)</p><p dir="rtl">(Metrometer* hour/ml)</p></td><td></td><td></td></tr><tr><td><p dir="rtl">rate</p></td><td><p>Ab</p></td><td><p>ADC</p></td><td><p dir="rtl">Dosage</p></td><td><p>ADC</p></td></tr>
٤٠٦٩
-٦٦٤-
<tr><td><p>ADC/Ab</p></td><td></td><td></td><td></td><td></td></tr><tr><td><p>39</p></td><td><p>1 2720</p></td><td><p>1 1070</p></td><td><p>3</p></td><td><p>H(C)-#D44</p></td></tr><tr><td><p>46</p></td><td><p>4890</p></td><td><p>2240</p></td><td><p>3</p></td><td><p>H(C)-#D70</p></td></tr><tr><td><p>52</p></td><td><p>4770</p></td><td><p>2490</p></td><td><p>3</p></td><td><p>H(C)-#D69</p></td></tr><tr><td><p>63</p></td><td><p>5722</p></td><td><p>3594</p></td><td><p>3</p></td><td><p>H(C)-#A69</p></td></tr><tr><td><p>49</p></td><td><p>5415</p></td><td><p>2641</p></td><td><p>3</p></td><td><p>H(C)-</p><p>MalPEG6C2-</p><p>MMAD</p></td></tr><tr><td><p>72</p></td><td><p>4970</p></td><td><p>3580</p></td><td><p>3</p></td><td><p>H(C)-mc-MMAD</p></td></tr><tr><td><p>49</p></td><td><p>3290</p></td><td><p>1600</p></td><td><p>3</p></td><td><p>H(C)-vc-MMAE</p></td></tr><tr><td><p>64</p></td><td><p>4800</p></td><td><p>3080</p></td><td><p>3</p></td><td><p>H(C)-mc-MMAF</p></td></tr>
1 Symbolizes the end P R M F P R-168 hours
Table 24: The data shows the details of the following paragraphs Use of approved links for information on succinimide in the closed session.
<tr><td><p dir="rtl">Atomic PK</p><p>ADC/Ab</p></td><td><p>ADC AUC</p><p dir="rtl">atomic</p><p dir="rtl">) h/ml)</p></td><td><p dir="rtl">GSH stabilizers (6 days) (remaining dose: day 6)</p></td><td colspan="2"><p>Herceptin ADC</p></td></tr><tr><td><p>:55</p></td><td><p>2160</p></td><td><p>:65</p></td><td><p dir="rtl">The meeting is closed</p></td><td><p>mc-#118</p></td></tr>
٤٠٦٩
-٦٦٥-
<tr><td><p>:65</p></td><td><p>3490</p></td><td><p>:87</p></td><td><p dir="rtl">For the sake of God</p><p dir="rtl">M. Toula</p></td><td></td></tr><tr><td><p>:70</p></td><td><p>2010</p></td><td><p>:82</p></td><td><p dir="rtl">The meeting is closed</p></td><td rowspan="2"><p>MalPeg6C2-#118</p></td></tr><tr><td><p>:77</p></td><td><p>3000</p></td><td><p>:100</p></td><td><p dir="rtl">For the sake of God</p><p dir="rtl">M. Toula</p></td></tr><tr><td><p>:52</p></td><td><p>3590</p></td><td><p>:51</p></td><td><p dir="rtl">The meeting is closed</p></td><td rowspan="2"><p>mc-#8261</p></td></tr><tr><td><p>:73</p></td><td><p>4470</p></td><td><p>:96</p></td><td><p dir="rtl">For the sake of God</p><p dir="rtl">M. Toula</p></td></tr><tr><td><p>:72</p></td><td><p>2950</p></td><td><p>:61</p></td><td><p dir="rtl">The meeting is closed</p></td><td rowspan="2"><p>MalPeg6C2-</p><p>#8261</p></td></tr><tr><td></td><td></td><td><p>:104</p></td><td><p dir="rtl">For the sake of God</p><p dir="rtl">M. Toula</p></td></tr><tr><td><p>:58</p></td><td><p>1930</p></td><td></td><td><p dir="rtl">The meeting is closed</p></td><td rowspan="2"><p>mc-#115</p></td></tr><tr><td><p>:68</p></td><td><p>2330</p></td><td></td><td><p dir="rtl">For the sake of God</p><p dir="rtl">M. Toula</p></td></tr>
٤٠٦٩
-٦٦٦-
Table 25 (A): Selected liquids and methods of their synthesis
<tr><td><p dir="rtl">Water in milligrams</p><p dir="rtl">(productivity)</p></td><td><p dir="rtl">Purification method</p></td><td><p dir="rtl">Added using any method or method of illumination.</p></td><td><p dir="rtl">Example</p></td></tr><tr><td><p dir="rtl">10.5 mg (43:)</p></td><td><p dir="rtl">Method M</p></td><td><p dir="rtl">Example #107</p></td><td><p>#220</p></td></tr><tr><td><p dir="rtl">15.2 mg (76:)</p></td><td><p dir="rtl">Method M</p></td><td><p dir="rtl">Example #107</p></td><td><p>#221</p></td></tr><tr><td><p dir="rtl">14 (39:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent L</p></td><td><p>#222</p></td></tr><tr><td><p dir="rtl">16.6 mg (42:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent L</p></td><td><p>#223</p></td></tr><tr><td><p dir="rtl">18.8 mg (68:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent L</p></td><td><p>#224</p></td></tr><tr><td><p dir="rtl">17.3 mg (64:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent L</p></td><td><p>#225</p></td></tr><tr><td><p dir="rtl">354 (78:)</p></td><td><p dir="rtl">Hillel Trommatog RM</p><p>silica</p></td><td><p dir="rtl">Example #146</p></td><td><p>#226</p></td></tr><tr><td><p dir="rtl">19.4 mg (77:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent L</p></td><td><p>#227</p></td></tr><tr><td><p dir="rtl">30 (51:)</p></td><td><p dir="rtl">Method*E1</p></td><td><p dir="rtl">Example #131</p></td><td><p>#228</p></td></tr><tr><td><p dir="rtl">16 (61:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">Example #151</p></td><td><p>#229</p></td></tr><tr><td><p dir="rtl">69 (42:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent L</p></td><td><p>#230</p></td></tr><tr><td><p dir="rtl">4.2 mg (44:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent *L</p></td><td><p>#231</p></td></tr><tr><td><p dir="rtl">113 (50:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">Example #98</p></td><td><p>#232</p></td></tr><tr><td><p dir="rtl">88 (82:)</p></td><td><p dir="rtl">Hillel Trommatog RM</p><p>silica</p></td><td><p dir="rtl">Example #146</p></td><td><p>#233</p></td></tr>
٤٠٦٩
-٦٦٧-
<tr><td><p dir="rtl">8.5 mg (78:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent L</p></td><td><p>#234</p></td></tr><tr><td><p dir="rtl">27 (77:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">General rent *L</p></td><td><p>#235</p></td></tr><tr><td><p dir="rtl">3.7 mg (14:)</p></td><td><p>achiral</p></td><td><p dir="rtl">Example #131</p></td><td><p>#236</p></td></tr><tr><td><p dir="rtl">38.6 mg (93:)</p></td><td><p dir="rtl">Hillel Trommatog RM</p><p>silica</p></td><td><p dir="rtl">Example #145</p></td><td><p>#237</p></td></tr><tr><td><p dir="rtl">419 (81:)</p></td><td><p dir="rtl">Hillel Trommatog RM</p><p>silica</p></td><td><p dir="rtl">Example #145</p></td><td><p>#238</p></td></tr><tr><td><p dir="rtl">315 (48:)</p></td><td><p dir="rtl">Hillel Trommatog RM</p><p>silica</p></td><td><p dir="rtl">Example #130</p></td><td><p>#239</p></td></tr><tr><td><p dir="rtl">6 (20:)</p></td><td><p dir="rtl">Method*E1</p></td><td><p dir="rtl">Example #142</p></td><td><p>#240</p></td></tr><tr><td><p dir="rtl">6 (20:)</p></td><td><p dir="rtl">Method*E1</p></td><td><p dir="rtl">Example #142</p></td><td><p>#241</p></td></tr><tr><td><p dir="rtl">8 Mug (10:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">Example #145</p></td><td><p>#242</p></td></tr><tr><td><p dir="rtl">12 (22:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">Example #145</p></td><td><p>#243</p></td></tr><tr><td><p dir="rtl">9.6 mg (20:)</p></td><td><p dir="rtl">Method*J</p></td><td><p dir="rtl">Example #145</p></td><td><p>#244</p></td></tr><tr><td><p dir="rtl">38 (55:)</p></td><td><p>C18</p><p dir="rtl">Medium pressure</p></td><td><p dir="rtl">General rent M</p></td><td><p>#245</p></td></tr><tr><td><p dir="rtl">78 mag (80:)</p></td><td><p>C18</p><p dir="rtl">Medium pressure</p></td><td><p dir="rtl">Example #130</p></td><td><p>#246</p></td></tr><tr><td><p dir="rtl">10.5 mg (57:)</p></td><td><p dir="rtl">Method *M</p></td><td><p dir="rtl">Example #178</p></td><td><p>#247</p></td></tr>
Table 25(b): Selected fruits, their IUPAC name, and recognition data
٤٠٦٩
-٦٦٨-
<tr><td><p dir="rtl">Spectrometry: LC-MS or</p><p>HPLC</p><p dir="rtl">m/z Al-Malaliq and Zamzaf lost their time. Remaining in minutes.</p><p>1H NMR (400 MHz, DMSO-d6)</p><p dir="rtl">Unless it gives rise to a dispute, yes</p></td><td><p>IUPAC AS</p></td><td><p dir="rtl">Example</p></td></tr><tr><td><p dir="rtl">HPLC (protocol m/z): CB</p><p>1.57(746.51 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2R,4S)-4-carboxy-1-phenylpentan-2 -yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#220</p></td></tr><tr><td><p dir="rtl">HPLC (protocol m/z:DB).</p><p>1.57(622.42 [M+H+]</p><p dir="rtl">minute(</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-(bicyclo[1.1.1]pent-1-ylamino)-1-methoxy -2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#221</p></td></tr>
٤٠٦٩
-٦٦٩-
<tr><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>2.19(744.9 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400 MHz, CDCl3) δ 7.16-7.22</p><p>(m), 6.99-7.08 (m),</p><p>6.42-6.51(m), 6.106.17(m), 4.87-4.96</p><p>(m), 4.65-4.79 (m),</p><p>4.27-4.36(m), 4.044.27(m), 3.95-4.02</p><p>(m), 3.87-3.93 (m),</p><p>3.64-3.84(m), 3.443.57(m), 3.22-3.42</p><p>(m), 3.08-3.17 (m),</p><p>2.98-3.07(m), 2.902.93(m), 2.85-2.89</p><p>(m), 2.53-2.57 (m),</p><p>2.35-2.51(m), 2.192.27(m), 2.02-2.16</p><p>(m), 1.93-2.00 (m),</p><p>1.77-1.90(m), 1.571.70(m), 1.35-1.52</p><p>(m), 1.26-1.33 (m),</p><p>1.19-1.25(m), 1.111.16(m), 1.03-1.11</p><p>(m), 0.83-1.02 (m),</p><p>0.79-0.88(m).</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(1R)-2-methoxy -2-oxo-1-(1-phenylcyclopropyl)ethyl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-</p><p>methyl-1-oxoheptan-4-yl]-N-meth yl-L-valinamide</p></td><td><p>#222</p></td></tr>
-٦٧٠-
<tr><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>2.17(744.4 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400MHz,</p><p>CD3OD) δ 8.19-8.24</p><p>(m), 7.87-7.92 (m),</p><p>7.20-7.38(m), 4.715.04(m), 4.61-4.71</p><p>(m), 4.47-4.52 (m),</p><p>4.38-4.44(m), 4.054.13(m), 3.99-4.04</p><p>(m), 3.90-3.98 (m),</p><p>3.64-3.73(m), 3.523.60(m), 3.46-3.52</p><p>(m), 3.37-3.46 (m),</p><p>3.35-3.37(m), 3.293.35(m), 3.24-3.28</p><p>(m), 3.15-3.19 (m),</p><p>3.08-3.14(m), 3.013.06(m), 2.84-2.87</p><p>(m), 2.43-2.63 (m),</p><p>1.96-2.20(m), 1.681.95(m), 1.60-1.66</p><p>(m), 1.52-1.57 (m),</p><p>1.33-1.44(m), 1.271.32(m), 1.23-1.27</p><p>(m), 1.12-1.17 (m),</p><p>1.04-1.10(m), 0.96</p><p><sub>-</sub></p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(1S)-2-methoxy -2-oxo-1-(1-phenylcyclopropyl)ethyl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-</p><p>methyl-1-oxoheptan-4-yl]-N-meth yl-L-valinamide</p></td></tr>
#223
٤٠٦٩
-٦٧١-
<tr><td><p dir="rtl">LC-MS (protocol m/z:H).</p></td><td></td></tr><tr><td><p>2.15(730.8 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400MHz,</p><p>CD3OD)δ 7.09-7.18</p><p>(m), 6.95-7.08 (m),</p><p>4.88-4.93(m), 4.754.85(m), 4.72-4.74</p><p>(m), 4.62-4.70 (m),</p><p>4.50-4.59(m), 4.094.16(m), 3.96-4.06</p></td><td></td></tr><tr><td><p>(m), 3.82-3.90 (m),</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-</p></td></tr><tr><td><p>3.67-3.76(m), 3.58-</p></td><td><p>2-[(1R,2R)-3-({(1R)-1-[(7R)-</p></td></tr><tr><td><p>3.67(m), 3.58-3.67</p></td><td><p>bicyclo[4.2.0]octa-1,3,5-trien-7-yl]-2-</p></td></tr><tr><td><p>(m), 3.45-3.54 (m),</p></td><td><p>methoxy-2-oxoethyl}amino)-1-methoxy-</p></td></tr><tr><td><p>3.33-3.44(m), 3.33-</p></td><td><p>2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-</p></td></tr><tr><td><p>3.44(m), 3.28-3.33</p></td><td><p>methoxy-5-methyl-1-o</p></td></tr><tr><td><p>(m), 3.10-3.27 (m),</p><p>3.00-3.10(m), 2.933.00(m), 2.75-2.78</p><p>(m), 2.56-2.65 (m),</p><p>2.36-2.45(m), 2.172.35(m), 1.94-2.16</p><p>(m), 1.67-1.94 (m),</p><p>1.48-1.67(m), 1.271.33(m), 1.23-1.27</p><p>(m), 1.17-1.26 (m),</p><p>1.08-1.17(m), 0.98</p><p><sub>-</sub></p></td><td><p>xoheptan-4-yl]-N-methyl-L-valinamide</p></td></tr>
#224
٤٠٦٩
-٦٧٢-
<tr><td><p dir="rtl">LC-MS (protocol m/z:H).</p><p>2.19(730.9 [M+H+]</p><p dir="rtl">minute(.</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(1S)-1-[(7S)-bicyclo[4.2. 0]octa-1,3,5-trien-7-yl]-2-</p><p>methoxy-2-oxoethyl}amino)-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-o</p><p>xoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#225</p></td></tr>
٤٠٦٩
-٦٧٣-
<tr><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.24(732.4 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR δ 8.47-8.53</p><p>(m), 8.24-8.29 (m),</p><p>7.81-7.91(m), 7.147.27(m), 4.54-4.75</p><p>(m), 4.44-4.54 (m),</p><p>3.94-4.02(m), 3.723.78(m), 3.61-3.69</p><p>(m), 3.28-3.36 (m),</p><p>3.14-3.28(m), 2.993.08(m), 2.81-2.97</p><p>(m), 2.29-2.57 (m),</p><p>2.16-2.29(m), 1.912.16(m), 1.60-1.87</p><p>(m), 1.35-1.53 (m),</p><p>0.99-1.33(m), 0.800.99(m), 0.71-0.80</p><p>(m).</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S)-1 -methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl- L-valinamide</p></td><td><p>#226</p></td></tr>
٤٠٦٩
-٦٧٤-
<tr><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.29(730.4 [M+H+]</p><p dir="rtl">minute(.</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-({(1S)-1-[(7R)-bicyclo[4.2. 0]octa-1,3,5-trien-7-yl]-2-</p><p>methoxy-2-oxoethyl}amino)-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-o</p><p>xoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#227</p></td></tr><tr><td><p dir="rtl">HPLC (protocol *m/z:)A</p><p>7.103(746.5 [M+H+]</p><p dir="rtl">minute(.</p></td><td><p>N,N,2-trimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-3-{[(2S) -1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N- methyl</p><p>-L-valinamide</p></td><td><p>#228</p></td></tr><tr><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>0.70(m/z 732.3 [M+H+]</p><p dir="rtl">minute(.</p></td><td><p>N,N,2-trimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1S)-1-carboxy-2-phenylethyl [amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#229</p></td></tr>
٤٠٦٩
-٦٧٥-
<tr><td><p dir="rtl">HPLC (protocol m/z:G).</p><p>1.25(730.4 [M+H+]</p><p dir="rtl">minute(.</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(R)-carboxy(1-phenylcyclopropyl)methyl]amino}- 1-methoxy-2-methyl-3-</p><p>oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#230</p></td></tr>
٤٠٦٩
-٦٧٦-
<tr><td><p dir="rtl">LC-MS (Prototype Q1):</p></td><td></td><td></td></tr><tr><td><p>m/z 1020.6 [M+H+]</p><p dir="rtl">(0.83 minutes).</p><p>1H NMR (400MHz,</p><p>CD3OD)δ 8.19-8.23(m), 7.99-8.07(m),</p><p>7.93-7.98(m), 7.417.45(m), 7.23-7.31</p><p>(m), 7.17-7.22 (m),</p><p>7.00-7.04(m), 6.326.37(m), 6.20-6.24</p><p>(m), 4.72-4.93 (m),</p><p>4.61-4.69(m), 4.054.17(m), 3.88-3.93</p></td><td><p>difluoro{2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(3R,4R,7S)-7-benzyl-15-{2-</p><p>[(3,5-dimethyl-1H-pyrrol-2-yl-</p><p>kappaN)methylidene]-2H-pyrrol-5-yl-</p></td><td></td></tr><tr><td><p>(m), 3.72-3.81 (m),</p><p>3.63-3.70(m), 3.563.62(m), 3.48-3.56</p><p>(m), 3.25-3.44 (m),</p><p>3.16-3.25(m), 3.093.14(m), 2.98-3.09</p><p>(m), 2.81-2.90 (m),</p><p>2.54-2.67(m), 2.392.53(m), 2.09-2.32</p><p>(m), 1.75-1.97 (m),</p><p>1.60-1.69(m), 1.521.59(m), 1.32-1.44</p><p>(m), 1.28-1.32 (m),</p><p>1.16-1.21(m), 0.98</p><p><sub>-</sub></p></td><td><p>kappaN}-4-methyl-5,8,13-trioxo-2-oxa-</p><p>6,9,12-triazapentadecan</p><p>-3-yl]pyrrolidin-1-yl}-3-methoxy-5-</p><p>methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamidato}boron</p></td><td><p>#231</p></td></tr>
-٦٧٧-
<tr><td></td><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.34(769.3 [M+H+]</p></td><td></td><td></td></tr><tr><td></td><td><p dir="rtl">minute(.</p><p>1H NMR δ 9.04-9.17(m), 8.88-8.94(m),</p><p>8.70- 8.86(m), 8.628.67(m), 7.79-7.84</p><p>(m), 7.76-7.79 (m),</p><p>7.65-7.69(m), 7.617.64(m), 7.20-7.31</p><p>(m), 7.12-7.20 (m),</p><p>5.44-5.52(m), 5.345.46(m), 4.70-4.78</p><p>(m), 4.56-4.67 (m),</p></td><td><p>2-methyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo -3-{[(1S)-2-</p></td><td></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>4.47-4.54(m), 3.944.04(m), 3.76-3.83</p><p>(m), 3.52-3.61 (m),</p><p>3.36-3.52(m), 3.283.35(m), 3.10-3.27</p><p>(m), 2.93-3.08 (m),</p><p>2.77-2.80(m), 2.642.70(m), 2.35-2.54</p><p>(m), 2.09-2.34 (m),</p><p>1.96-2.09(m), 1.541.88(m), 1.38-1.52</p><p>(m), 1.18-1.36 (m),</p><p>1.03-1.13(m), 0.811.01(m), 0.68-0.81</p></td><td><p>phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#232</p></td></tr>
-٦٧٨-
<tr><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.28(732.2 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR δ 8.48- 8.53(m), 8.22-8.28(m),</p><p>7.80-7.92(m), 7.147.28(m), 4.74-4.79</p><p>(m), 4.54-4.72 (m),</p><p>4.43-4.52(m), 4.244.35(m), 4.07-4.12</p><p>(m), 3.94-4.02 (m),</p><p>3.72-3.78(m), 3.613.69(m), 3.48-3.58</p><p>(m), 3.40-3.48 (m),</p><p>3.11-3.35(m), 2.983.11(m), 2.75-2.97</p><p>(m), 2.64-2.69 (m),</p><p>2.30-2.55(m), 2.172.28(m), 2.03-2.14</p><p>(m), 1.92-2.02 (m),</p><p>1.59-1.87(m), 1.351.54(m), 1.21-1.33</p><p>(m), 1.112-1.20 (m),</p><p>1.00-1.09(m), 0.700.98(m).</p></td><td><p>methyl N-{(2R,3R)-3-[(2S)-1-</p><p>{(3R,4S,5S)-4-[{N-[(3-aminooxetan-3-yl)carbonyl]-L-valyl}(methyl)amino]-3-methoxy-5-methylheptanoyl}pyrrolidin-2- yl]-3-methoxy-2-methylpropanoyl}-L-phenylalaninate</p></td><td><p>#233</p></td></tr>
٤٠٦٩
-٦٧٩-
<tr><td></td><td><p dir="rtl">LC-MS (protocol m/z:H).</p></td><td></td><td></td></tr><tr><td></td><td><p>2.29(589.9 [M+H+2]</p><p dir="rtl">minute(.</p><p>1H NMR (400 MHz, CD3OD) δ 8.55-8.61</p><p>(m), 8.40- 8.45 (m),</p><p>8.34-8.39(m), 8.238.28(m), 8.14-8.19</p><p>(m), 7.84-7.95 (m),</p><p>7.79-7.84(m), 7.717.77(m), 7.61-7.68</p><p>(m), 7.46-7.52 (m),</p><p>7.34-7.40(m), 7.097.27(m), 7.03-7.09</p></td><td><p>2-methylalanyl-N-{(3R,4S,5S)-1-[(2S)-2-{(3R,4R,7S,12S)-7-benzyl-14-[3-chloro-4-(propan) -2-yloxy)phenyl]-4-methyl-12-[4-(8-methylimidazo[1,2-)</p></td><td></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>(m), 4.77-4.90 (m),</p><p>4.58-4.77(m), 4.434.55(m), 4.17-4.33</p><p>(m), 4.07-4.16 (m),</p><p>4.00-4.07(m), 3.793.85(m), 3.58-3.70</p><p>(m), 3.44-3.52 (m),</p><p>3.12-3.40(m), 2.803.12(m), 2.64-2.71</p><p>(m), 2.62-2.64 (m),</p><p>2.38-2.47(m), 2.002.33(m), 1.66-2.00</p><p>(m), 1.46-1.63 (m),</p><p>1.29-1.44(m), 1.07</p><p><sub>-</sub></p></td><td><p>a]pyridin-2-yl)benzyl]-5,8,14-trioxo-2,9-dioxa-6,13-diazatetr</p><p>adecan-3-yl}pyrrolidin-1-yl]-3-methoxy-</p><p>5-methyl-1-oxoheptan-4-yl}-N-methyl-</p><p>L-valinamide</p></td><td><p>#234</p></td></tr>
-٦٨٠-
<tr><td></td><td><p dir="rtl">LC-MS (Prototype Q1):</p></td><td></td><td></td></tr><tr><td></td><td><p>0.84(m/z 944.3 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400 MHz, CD3OD) δ 8.54-8.59(m), 8.29- 8.33(m), 7.87-8.02(m), 7.807.87(m), 7.68-7.74</p><p>(m), 7.62-7.67 (m),</p><p>7.20-7.38(m), 4.985.06(m), 4.84-4.97</p><p>(m), 4.66-4.79 (m),</p><p>4.61-4.66(m), 4.134.19(m), 3.98-4.04</p><p>(m), 3.91-3.96 (m),</p><p>3.79-3.85(m), 3.643.73(m), 3.38-3.56</p><p>(m), 3.34-3.38 (m),</p></td><td><p>2-methylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-{[4-(5-fluoro- 1,3-benzothiazol-2-yl)-2-methylphenyl]amino}-1-oxo-3-</p></td><td rowspan="2"><p>#235</p></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>3.28-3.34(m), 3.173.27(m), 3.12-3.16</p><p>(m), 3.03-3.11 (m),</p><p>2.99-3.03(m), 2.862.87(m), 2.80-2.82</p><p>(m), 2.69-2.71 (m),</p><p>2.31-2.54(m), 2.272.31(m), 2.06-2.27</p><p>(m), 1.88-2.00 (m),</p><p>1.74-1.88(m), 1.64</p><p><sub>-</sub></p></td><td><p>phenylpropan-2-yl]amino}-1-methoxy-2-</p><p>methyl-3-oxopropyl]pyrrolidin-1-yl}-3</p><p>-methoxy-5-methyl-1-oxoheptan-4-yl]-</p><p>N-methyl-L-valinamide</p></td></tr>
-٦٨١-
<tr><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>0.74(m/z 758.3 [M+H+]</p><p dir="rtl">minute(.</p></td><td><p>1,2-dimethyl-D-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-</p><p>methoxy-3-{[(2S)-1-methoxy-1-oxo-3-phenylpropan-2-yl]amino}-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-5-methyl-1- oxoheptan-4-yl]-N-methyl</p><p>-L-valinamide</p></td><td><p>#236</p></td></tr>
٤٠٦٩
-٦٨٢-
<tr><td></td><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>0.67(m/z 771.2 [M+H+]</p><p dir="rtl">minute(.</p></td><td></td><td></td></tr><tr><td></td><td><p>1H NMR (400 MHz, CD3OD) δ 7.95-7.96</p><p>(m), 7.48-7.55 (m),</p><p>7.45-7.48(m), 7.267.31(m), 6.94-7.18</p><p>(m), 5.45-5.49 (m),</p><p>5.19-5.22(m), 5.115.17(m), 4.97-5.00</p><p>(m), 4.78-4.87 (m),</p><p>4.68-4.77(m), 4.594.64(m), 4.27-4.34</p><p>(m), 3.99-4.16 (m),</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-1-</p><p>{(2S)-2-[(1R,2R)-3-{[(2S)-3-(1H-indol-</p><p>3-yl)-1-methoxy-1-oxopropan-2-</p></td><td></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>3.84-3.92(m), 3.783.82(m), 3.62-3.78</p><p>(m), 3.49-3.59 (m),</p><p>3.41-3.49(m), 3.203.41(m), 2.99-3.20</p><p>(m), 2.95-2.98 (m),</p><p>2.82-2.86(m), 2.772.79(m), 2.62-2.68</p><p>(m), 2.28-2.49 (m),</p><p>2.19-2.27(m), 1.982.16(m), 1.56-1.91</p><p>(m), 1.31-1.49 (m),</p><p>1.19-1.30(m), 1.15</p><p><sub>-</sub></p></td><td><p>yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#237</p></td></tr>
-٦٨٣-
<tr><td><p dir="rtl">٤٠٦٩</p></td><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>m/z 758.84 [M+H+]</p><p dir="rtl">(0.71 minutes).</p><p>1H NMR (400MHz,</p><p>CD3OD)δ 7.15-7.32</p><p>(m), 5.86-6.00 (m),</p><p>5.28-5.40(m), 5.175.27(m), 4.97-5.04</p><p>(m), 4.69-4.91 (m),</p><p>4.57-4.69(m), 4.054.21(m), 3.91-3.96</p><p>(m), 3.79-3.88 (m),</p><p>3.71-3.78(m), 3.623.70(m), 3.25-3.56</p><p>(m), 3.15-3.24 (m),</p><p>3.08-3.14(m), 2.903.02(m), 2.79-2.87</p><p>(m), 2.42-2.52 (m),</p><p>2.20-2.38(m), 2.122.20(m), 2.03-2.12</p><p>(m), 2.00-2.03 (m),</p><p>1.71-2.1.96(m), 1.331.70(m), 1.23-1.32</p><p>(m), 1.17-1.23 (m),</p><p>1.12-1.17(m), 1.051.10(m), 0.94-1.05</p><p>(m), 0.82-0.89 (m).</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -{[(2S)-1-oxo-3-phenyl-1-(prop-2-en-1-yloxy)propan-2-yl]amino}propyl]pyrrolidin-1-yl}-5-</p><p>methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#238</p></td></tr>
-٦٨٤-
<tr><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>1.46(786.6 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR δ 8.35-8.42 (m), 8.21- 8.31 (m),</p><p>8.14-8.20(m), 7.157.29(m), 4.66-4.76</p><p>(m), 4.53-4.65 (m),</p><p>4.46-4.53(m), 4.324.42(m), 4.07-4.15</p><p>(m), 3.96-4.04 (m),</p><p>3.76-3.82(m), 3.413.61(m), 3.30-3.38</p><p>(m), 3.16-3.30 (m),</p><p>3.08-3.15(m) 2.993.08(m), 2.92-2.96</p><p>(m), 2.78-2.90 (m),</p><p>2.63-2.78(m), 2.372.58(m), 2.18-2.36</p><p>(m), 2.03-2.13 (m),</p><p>1.89-2.01(m), 1.641.88(m), 1.35-1.62</p><p>(m), 1.31-1.35 (m),</p><p>1.17-1.31(m), 1.031.14(m), 0.70-1.01</p><p>(m).</p></td><td><p>2-methyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-tert-butoxy-1 -oxo-3-phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-</p><p>methyl-1-oxoheptan-4-yl]-N-methyl</p><p>-L-valinamide</p></td><td><p>#239</p></td></tr>
٤٠٦٩
-٦٨٥-
<tr><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>0.66(m/z 798.2 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400MHz,</p><p>CD3OD)δ 8.43-8.49</p><p>(m), 7.50-7.53 (m),</p><p>7.42-7.48(m), 7.067.20(m), 4.21-4.83</p><p>(m), 3.95-4.13 (m),</p><p>3.76-3.88(m), 3.533.67(m), 3.16-3.47</p><p>(m), 3.08-3.15 (m)</p><p>3.00-3.16(m), 2.772.90(m), 2.70-2.73</p><p>(m), 2.62-2.69 (m),</p><p>2.45-2.58(m), 2.342.41(m), 2.21-2.29</p><p>(m), 2.12-2.21 (m),</p><p>1.55-2.09(m), 1.391.54(m), 1.16-1.36</p><p>(m), 1.04-1.14 (m),</p><p>0.85-0.99(m), 0.730.80(m), 0.00-0.02</p><p>(m).</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -({(2S)-1-oxo-3-phenyl-1-[(1H-1,2,3-triazol-4-ylmethyl)amino]propan-2-yl}amino)propyl]pyrrolidin-1-yl }-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#240</p></td></tr>
٤٠٦٩
-٦٨٦-
<tr><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>0.69(m/z 755.1 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400 MHz, CD3OD) δ 8.36-8.67</p><p>(m), 7.26-7.50 (m),</p><p>7.10-7.26(m), 5.135.17(m), 4.95-4.99</p><p>(m), 4.67-4.84 (m),</p><p>4.61-4.66(m), 4.504.60(m), 3.77-4.12</p><p>(m), 3.69-3.75 (m),</p><p>3.56-3.66(m), 3.44</p><p>3.54(m), 3.19-3.44(m) 3.12-3.19(m), 3.033.12(m), 2.74-2.94</p><p>(m), 2.37-2.60 (m),</p><p>2.14-2.36(m), 1.602.13(m), 1.47-1.59</p><p>(m), 1.19-1.40 (m),</p><p>1.11-1.16(m), 0.881.11(m), 0.75-0.84</p><p>(m), 0.02-0.06 (m).</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3 -{[(2S)-1-oxo-3-phenyl-1-(prop-2-yn-1-ylamino)propan-2-yl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1 -oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td><p>#241</p></td></tr>
٤٠٦٩
-٦٨٧-
<tr><td><p dir="rtl">٤٠٦٩</p></td><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>m/z 722.95 [M+H+]</p><p dir="rtl">(0.52 minutes).</p><p>1H NMR (400MHz,</p><p>CD3OD) δ 8.78-8.86 (m), 8.71-8.73 (m),</p><p>7.96-8.00(m), 7.347.40(m), 4.74-4.91</p><p>(m), 4.67-4.71 (m),</p><p>4.55-4.63(m), 4.134.22(m), 4.04-4.10</p><p>(m), 3.97-4.01 (m),</p><p>3.84-3.92(m), 3.663.82(m), 3.42-3.64</p><p>(m), 3.26-3.42 (m)</p><p>3.11-3.21(m), 2.902.92(m), 2.83-2.84</p><p>(m), 2.59-2.64 (m),</p><p>2.48-2.56(m), 2.322.41(m), 2.09-2.24</p><p>(m), 1.99-2.08 (m),</p><p>1.68-1.95(m), 1.591.66(m), 1.51-1.58</p><p>(m), 1.35-1.45 (m).</p><p>1.22-1.26(m), 1.171.21(m). 0.95-1.12</p><p>(m), 0.83-0.89 (m).</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-1-</p><p>{(2S)-2-[(1R,2R)-3-{[(2S)-3-(1H-imidazol-4-yl)-1-methoxy-1-oxopropan-2-yl]amino}-1 -methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl] -N-methyl-L-valinamide</p></td><td><p>#242</p></td></tr>
-٦٨٨-
<tr><td></td><td><p dir="rtl">LC-MS (Prototype Q1):</p></td><td></td><td></td></tr><tr><td></td><td><p>0.52(m/z 748.2 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400MHz,</p><p>CD3OD), δ 8.91-8.99 (m), 8.42-8.46 (m),</p><p>8.15-8.20(m), 7.928.01(m), 7.00-7.10</p><p>(m), 6.64-6.74 (m),</p><p>5.22-5.26(m), 5.065.09(m), 4.79-4.95</p><p>(m), 4.65-4.79 (m),</p><p>4.59-4.65(m), 4.124.21(m), 4.05-4.12</p><p>(m), 3.91-3.99 (m),</p><p>3.84-3.90(m), 3.673.79(m), 3.60-3.66</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-3-(4-hydroxyphenyl)-1 -methoxy-1-oxopropan-2-yl]amino}-1-methoxy-2-</p></td><td><p>#243</p></td></tr><tr><td><p dir="rtl">٤٠٦٩</p></td><td><p>(m), 3.39-3.57 (m),</p><p>3.34-3.39(m) 3.293.34(m), 3.12-3.27</p><p>(m), 2.98-3.00 (m),</p><p>2.78-2.88(m), 2.612.65(m), 2.55-2.57</p><p>(m), 2.46-2.53 (m),</p><p>2.10-2.36(m), 1.681.96(m), 1.61-1.68</p><p>(m), 1.55-1.60 (m),</p><p>1.35-1.53(m), 1.19</p><p><sub>-</sub></p></td><td><p>methyl-3-oxopropyl]pyrrolidin-1-yl}-3-</p><p>methoxy-5-methyl-1-oxoheptan-4-yl]-</p><p>N-methyl-L-valinamide</p></td><td></td></tr>
-٦٨٩-
<tr><td><p dir="rtl">LC-MS (Prototype Q1):</p><p>0.66(m/z 718.4 [M+H+]</p><p dir="rtl">minute(.</p><p>1H NMR (400 MHz, CD3OD), δ 7.87-7.92</p><p>(m), 7.71-7.76</p><p>(m),7.46-7.53 (m),</p><p>7.40-7.46(m), 7.197.33(m), 4.81-4.96</p><p>(m), 4.68-4.77 (m),</p><p>4.60-4.65(m), 4.474.53(m), 4.01-4.17</p><p>(m), 3.94-3.98 (m),</p><p>3.81-3.86(m), 3.683.76(m), 3.56-3.64</p><p>(m), 3.40-3.50 (m),</p><p>3.36-3.40(m) 3.263.35(m), 3.23-3.26</p><p>(m), 3.16-3.22 (m),</p><p>3.12-3.16(m), 2.943.06(m), 2.91-2.93</p><p>(m), 2.86-2.88 (m),</p><p>2.41-2.66(m), 2.322.41(m), 1.97-2.23</p><p>(m), 1.85-1.97 (m),</p><p>1.71-1.85(m), 1.621.68(m), 1.50-1.61</p><p>(m), 1.37-1.46 (m),</p><p>--</p></td><td><p>N,2-dimethylalanyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(1R)-1-carboxy-2-phenylethyl]amino }-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td></tr>
#244
٤٠٦٩
-٦٩٠-
<tr><td><p dir="rtl">LC-MS (protocol m/z:Q).</p></td><td></td><td></td></tr><tr><td><p>0.87(835.0 [M+Na+]</p><p dir="rtl">minute(.</p><p>1H NMR δ 9.58-9.69(m), 8.84-9.16(m),</p><p>8.69-8.77(m), 8.548.60(m), 8.44-8.50</p><p>(m), 8.32-8.42 (m),</p><p>8.25-8.30(m), 7.137.31(m), 7.00-7.01</p><p>(m), 4.97-5.06 (m),</p><p>4.88-4.97(m), 4.574.75(m), 4.45-4.57</p></td><td><p>1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-3-methoxy-1-{(2S)-2-[(1R,2R)-1-methoxy-2-methyl-3 -oxo-3-{[(2S)-1-</p><p>oxo-3-phenyl-1-(piperazin-1-yl)propan-</p></td><td><p>#245</p></td></tr><tr><td><p>(m), 3.84-4.45 (m),</p><p>3.62-3.84(m), 3.403.62(m), 3.13-3.33</p><p>(m), 2.77-3.10 (m),</p><p>2.67-2.75(m), 2.472.57(m), 2.38-2.45</p><p>(m), 1.92-2.35 (m),</p><p>1.58-1.88(m), 1.371.55(m), 1.22-1.32</p><p>(m), 0.97-1.06 (m),</p><p>0.84-0.97(m), 0.73</p><p>0.81(m).</p></td><td><p>2-yl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide</p></td><td></td></tr>
٤٠٦٩
-٦٩١-
<tr><td><p dir="rtl">LC-MS (protocol m/z:Q).</p><p>0.91(366.2[M+H+2]</p><p dir="rtl">minute(.</p><p>1H NMR δ 9.56-9.65(m), 8.70-8.76(m),</p><ul style="list-style:none;"><li><p>8.05 -8.09(m), 7.777.92(m), 7.14-7.30</p></li></ul><p>(m), 4.60-4.72 (m),</p><ul style="list-style:none;"><li><p>4.46- 4.57(m), 3.614.39(m), 3.41-3.61</p></li></ul><p>(m), 3.11-3.33 (m),</p><ul style="list-style:none;"><li><p>2.97- 3.09(m), 2.792.94(m), 2.63-2.74</p></li></ul><p>(m), 2.38-2.56 (m),</p><ul style="list-style:none;"><li><p>2.13- 2.37(m), 1.932.13(m), 1.45-1.89</p></li></ul><p>(m), 1.21-1.32 (m),</p><ul style="list-style:none;"><li><p>1 09-1.14(m), 1.03</p></li></ul><p>1.08(m), 0.84-095(m), 0.73-0.80(m).</p></td><td><p>1,2-dimethyl-L-prolyl-N-[(3R,4S,5S)-1-{(2S)-2-[(1R,2R)-3-{[(2S)-1-amino-3 -phenylpropan-2-yl]amino}-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl}-3-methoxy-5-methyl-1-oxoheptan-4-yl]-N-methyl- L-valin amide</p></td><td><p>#246</p></td></tr>
٤٠٦٩
-٦٩٢-
<tr><td><p dir="rtl">HPLC (protocol 08): m/z</p><p>2.56) 700.51 [Μ+Η+]</p><p dir="rtl">minute).</p></td><td><p>2-methyl-D-prolyl-N-[(3R,4S,5S)-l-{(2S)-2-[(lR,2R)-3-{[2-(cyclohepta-2,4,6- trien-l-yl)ethyl]amino}-l-00100-2-0611-3-</p><p>0X0pr0pyl]pyrr0lidin-l-yl}-3-meth0xy-5-</p><p dir="rtl">-- 00611- Ha- - Most important</p><p>valin</p><p>amide</p></td><td><p>324</p></td></tr>
[A] Shows the efficiency of mouse-human chimeric Anti-Notch ADCs
At 5 mg/kg in HCC2429 lung allografts; [B]and] shows the efficiency of Anti<sup>-</sup>Notch ADCs Chimeric mouse-human at a dose of mg/kg in xenografts 468—MDA—MB; D] and [E] show the efficiency of anti-Notch chimeric ADCs, mouse-human, at a dose of at
5 5 mg/kg in gastric invasive patches Ν87.
Efficiency of feeding a yeast-gamma rat at a dose of • mg/kg in intra-lung infusions HCC2429
<tr><td colspan="15"><p dir="rtl">Then chat on HCC2429. Humping Norm 2M-524</p></td><td></td></tr><tr><td><p>huN0g8.8-</p><p dir="rtl">780 D7</p></td><td><p>lu£g8.8-vcoioi</p></td><td><p>buNegS.S-</p></td><td><p>1588.</p><p>--</p></td><td><p dir="rtl">-;.no</p></td><td><p>6790</p></td><td><p>0175-ν50101</p></td><td><p dir="rtl">-0128 5;%vd6</p></td><td><p>ch2 8.</p><p>0101</p></td><td><p>Ch75-</p><p>owOBl</p></td><td><p>eh28-ΜΑ1 him</p><p dir="rtl">H?</p></td><td><p>cti28-KMOlil</p></td><td><p dir="rtl">-,,Dr</p><p dir="rtl">3377]</p></td><td><p>chiE-</p></td><td></td><td></td></tr><tr><td><p dir="rtl">185 p. 3;</p></td><td><p dir="rtl">1.9 This;</p></td><td><p>·T±1H9</p></td><td><p dir="rtl">They are her</p></td><td><p dir="rtl">95 slander;</p></td><td><p dir="rtl">٠,٠٠”</p></td><td><p dir="rtl">195±h3</p></td><td><p dir="rtl">١٩٥ ٣٣</p></td><td><p>T6i 195</p></td><td><p dir="rtl">E19 +9</p></td><td><p dir="rtl">١١١ ±٧؛</p></td><td><p dir="rtl">١٩1 ٢٩</p></td><td><p dir="rtl">١٩٥*٣٩</p></td><td><p>T7i195</p></td><td><p dir="rtl">,٠,٠,-</p></td><td><p>τ-</p></td></tr><tr><td><p dir="rtl">11 *١١١</p></td><td></td><td><p dir="rtl">Uncle*+1</p></td><td><p>16ν+50.</p></td><td><p dir="rtl">٦.٣±١,١</p></td><td><p>6Ί± 41</p></td><td><p dir="rtl">٠٥٠ ٠٨٦؛</p></td><td><p dir="rtl">٣/٨ ٧٧٤</p></td><td><p dir="rtl">٣٩٥ + ؛٥</p></td><td><p dir="rtl">٤٨٣ + 31</p></td><td><p>1-</p></td><td><p dir="rtl">٤٤-٩</p></td><td><p dir="rtl">٥٢٥ +١٠١</p></td><td><p dir="rtl">٤٥٧ ±٣'١</p></td><td><p>106±5.Γ</p></td><td><p dir="rtl">٦</p></td></tr><tr><td><p>1ΥΜ 059</p></td><td></td><td><p dir="rtl">٤1) 11</p></td><td><p dir="rtl">٦٣٠٧ ±١٧٥</p></td><td><p dir="rtl">E;1,±1;A</p></td><td><p dir="rtl">٤٣ ±,٩</p></td><td><p>,V* 366</p></td><td><p dir="rtl">٧٣٥٣٣٩</p></td><td><p dir="rtl">٢٩:٦ ±٦؛</p></td><td><p dir="rtl">،١٥٥٥١,</p></td><td><p dir="rtl">638 3A1</p></td><td><p dir="rtl">؛٥٠ ،,,!</p></td><td><p dir="rtl">؛١٣٦،٦٥</p></td><td><p dir="rtl">٥٠٦ +٩٦</p></td><td><p>1.,\'ί ..1</p></td><td><p>'</p></td></tr><tr><td><p dir="rtl">9.98±9A-</p></td><td><p>2v0il1l8</p></td><td><p dir="rtl">٦٠٦٦±»،٣</p></td><td><p dir="rtl">٩٣٩+١٢٣</p></td><td><p dir="rtl">1.7, ±1-1 A</p></td><td><p dir="rtl">١٠٨٤٩٧٩</p></td><td><p dir="rtl">318 D44</p></td><td><p>ν9±319</p></td><td><p dir="rtl">2 ٣٣</p></td><td><p dir="rtl">63±8 ha</p></td><td><p dir="rtl">,»٧ ",،</p></td><td></td><td><p dir="rtl">M 1ί»1</p></td><td><p dir="rtl">56 D 171</p></td><td><p dir="rtl">10,8 d3,9</p></td><td><p dir="rtl">٦</p></td></tr><tr><td><p dir="rtl">ί09;1±;.Γ</p></td><td><p dir="rtl">1549 dh;39</p></td><td><p dir="rtl">١٥٠٦-٣٦٩٧</p></td><td><p dir="rtl">A-284</p></td><td><p dir="rtl">1٧٦٧٢-٢٦٤</p></td><td><p dir="rtl">]H*</p></td><td><p dir="rtl">7A, D30</p></td><td><p dir="rtl">٢٦ +٧٦</p></td><td><p dir="rtl">6607 i;T</p></td><td><p dir="rtl">٠,١٠٦,٠</p></td><td><p dir="rtl">٠٥٠٠.١٠,</p></td><td><p>1v10i 718</p></td><td><p dir="rtl">١١,٤1*٢٥٣</p></td><td><p dir="rtl">٦٥٣-١٣٣</p></td><td><p dir="rtl">',,a,,"</p></td><td><p dir="rtl">٩</p></td></tr><tr><td><p dir="rtl">63 AH 11</p></td><td><p>.12</p></td><td><p dir="rtl">H:11+383</p></td><td><p>1+ 11,</p></td><td></td><td><p dir="rtl">A.6 D10</p></td><td><p dir="rtl">191 D3</p></td><td><p>νϊ± 19.</p></td><td><p>14</p></td><td><p>16,±73ν</p></td><td><p dir="rtl">١٣ ١٢ ٥٦٤ ٢</p></td><td><p dir="rtl">Extension</p></td><td><p>fl,,l,°0</p></td><td><p dir="rtl">١٦٦٤،٦١</p></td><td><p dir="rtl">M2411*</p></td><td><p>11</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٤٠٠٧٦١,٩٣</p></td><td><p dir="rtl">٢٥٧]-٣٥٠</p></td><td><p dir="rtl">2535±D26</p></td><td><p dir="rtl">They are a drag</p></td><td><p dir="rtl">٩٦</p></td><td><p dir="rtl">٢٩٢-٩٦</p></td><td><p dir="rtl">١٢٢ ±١٥</p></td><td><p dir="rtl">,090 y;8a</p></td><td><p dir="rtl">١٥١٩</p></td><td><p dir="rtl">١٠٩٦-٢٦٤</p></td><td><p dir="rtl">؛٣٣٩٤١٥٣</p></td><td><p dir="rtl">H086-1671</p></td><td><p dir="rtl">٢٠٣٠*٢٩٣</p></td><td><p dir="rtl">٩١٣</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p dir="rtl">٢٠ ٢1±</p></td><td><p dir="rtl">٢٦1 ١٠٥٤</p></td><td><p>13i 9v</p></td><td></td><td><p dir="rtl">١٥٥٦±,٣٠</p></td><td><p dir="rtl">٩٩ 1 ٦٩</p></td><td><p>-</p></td><td><p>,0ΐ±91ν</p></td><td><p>-</p></td><td><p dir="rtl">1٦</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">١٥٣٦٧٧٠</p></td><td><p dir="rtl">١٠٦+٢٨</p></td><td><p dir="rtl">٤٨٤ +1</p></td><td><p dir="rtl">801 i;1</p></td><td></td><td><p dir="rtl">١٩٦٦ ±؛١؛</p></td><td><p dir="rtl">6331±A7,</p></td><td><p>-</p></td><td><p>275±1,τ,</p></td><td><p>-</p></td><td><p dir="rtl">٩٩</p></td></tr><tr><td></td><td></td><td></td><td><p>-</p></td><td></td><td><p dir="rtl">2 ٨٥ ٦١٥٦٤</p></td><td><p dir="rtl">This uncle;</p></td><td><p dir="rtl">٤٩1 ٢٣٨</p></td><td><p dir="rtl">8 this,</p></td><td><p dir="rtl">؛41٣٥-؛٣</p></td><td></td><td></td><td></td><td><p dir="rtl">؛١٦٩ ±,٠؛</p></td><td></td><td><p dir="rtl">٢٣</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">١٩٥٩-٢٥٢</p></td><td><p dir="rtl">،٦٠٠٦</p></td><td><p dir="rtl">،٣١٩٤٦٥٠</p></td><td><p>ί7ί 7ν</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p>τ6</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>,.0,ι,ί00</p></td><td><p dir="rtl">٣٦ * ٢٠</p></td><td><p dir="rtl">533 count 290</p></td><td><p dir="rtl">,٦،٠٠،-</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p dir="rtl">٣٠</p></td></tr><tr><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p dir="rtl">1٢,١,±٣.٩</p></td><td><p dir="rtl">٣٦ 4 ٣٤</p></td><td><p dir="rtl">It is *461</p></td><td><p dir="rtl">٠٠, ،٠٠,</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td></td><td><p dir="rtl">٣٣</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">6; This;</p></td><td><p>-</p></td><td><p>199ί11.</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p dir="rtl">،٣٦</p></td></tr><tr><td><p>-</p></td><td></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">5.1 Yes</p></td><td><p>-</p></td><td><p dir="rtl">٣٢٣*٣11</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p>i0</p></td></tr><tr><td></td><td></td><td><p>-</p></td><td></td><td><p>"</p></td><td></td><td><p dir="rtl">A0A*,.,</p></td><td></td><td><p dir="rtl">64 cm</p></td><td><p>"</p></td><td></td><td></td><td><p>"</p></td><td></td><td></td><td><p dir="rtl">؛؛</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">,١٠,٠٢٠</p></td><td><p>-</p></td><td><p dir="rtl">f; +3;</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p dir="rtl">Mr. Dr</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p>-</p></td><td><p dir="rtl">Zero i my class</p></td><td><p>-</p></td><td><p dir="rtl">H8</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p>-‘</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p>-</p></td><td><p dir="rtl">Zero d zero</p></td><td><p>-</p></td><td><p>13Λ + 138</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p dir="rtl">٦٥</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p>-</p></td><td><p dir="rtl">Safarkh Sler</p></td><td><p>-</p></td><td><p dir="rtl">201 2.1</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p dir="rtl">٧٢</p></td></tr><tr><td></td><td></td><td></td><td></td><td><p>-</p></td><td></td><td><p dir="rtl">Sahhad Slar</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p>-</p></td><td><p>14</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">I described my name</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td><p dir="rtl">٠‘</p></td></tr><tr><td><p>.</p></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">Aafar + Hahr</p></td><td></td><td><p>-</p></td><td></td><td></td><td></td><td></td><td></td><td></td><td><p dir="rtl">١٦</p></td></tr>
٤٠٦٩
-٦٩٣-
<tr><td colspan="9"><p dir="rtl">Efficacy of human rat yeast ADC's at a dose of 1 mg/kg in intramammary infusions 468-MDA-MB</p></td></tr><tr><td colspan="8"><p dir="rtl">We love it so much 468&MDA-M. Tumor hump < m2 ± 54)</p></td><td></td></tr><tr><td><p>288031</p></td><td><p>28,83377</p></td><td><p>1028.8-=03 1</p></td><td><p>di7jimc013i</p></td><td><p>[1714 201+</p></td><td><p>eh75-tneOJ3l</p></td><td><p>075-2337</p></td><td><p>PBS</p></td><td><p dir="rtl">today</p></td></tr><tr><td><p dir="rtl">306 O3</p></td><td><p dir="rtl">٢.٢±١٥</p></td><td><p dir="rtl">٣.١±؛٦</p></td><td><p dir="rtl">٥-٣؛؛,</p></td><td><p>2,±2'Λ</p></td><td><p dir="rtl">١٨٤٣٠٣</p></td><td><p dir="rtl">؛,١٩٤٣</p></td><td><p dir="rtl">٣٠٣ ١٠</p></td><td><p dir="rtl">-١</p></td></tr><tr><td><p dir="rtl">٢٦٦٢٤٣</p></td><td><p dir="rtl">٠٢-١٥٤٢</p></td><td><p>1-</p></td><td></td><td><p dir="rtl">١٦٤٢٧٥</p></td><td><p dir="rtl">Α;Τ142</p></td><td><p dir="rtl">٢٦٤٢١</p></td><td><p dir="rtl">t;2±;1</p></td><td></td></tr><tr><td><p>1+5</p></td><td><p dir="rtl">٢٦٦ ١٩</p></td><td><p dir="rtl">٩؛٣ + ٦٩</p></td><td><p dir="rtl">٦؛٢±، ,</p></td><td><p dir="rtl">E+23</p></td><td><p>-53</p></td><td><p dir="rtl">٥٤٢٣٩,</p></td><td><p dir="rtl">٣٦٠+0</p></td><td><p dir="rtl">٥</p></td></tr><tr><td><p>G36 it1</p></td><td><p dir="rtl">٤٢١±٢٥</p></td><td><p dir="rtl">٣٥٤٤٢٧</p></td><td><p>15έ368</p></td><td><p dir="rtl">٦؛؟±٧'٢</p></td><td><p dir="rtl">٣٥٣-٣١</p></td><td><p dir="rtl">;i3.2</p></td><td><p dir="rtl">39; ±2Λ</p></td><td><p>A</p></td></tr><tr><td><p dir="rtl">86a;a;</p></td><td><p>τ.± 449</p></td><td><p dir="rtl">٤٩٤ +٢٧</p></td><td><p dir="rtl">٨٤٢٥٠,</p></td><td><p dir="rtl">٣1٣±٣١</p></td><td><p dir="rtl">1|٣±٢٦</p></td><td><p dir="rtl">'٢٤٣٣١,</p></td><td><p>t,i,33</p></td><td><p dir="rtl">١٢</p></td></tr><tr><td><p dir="rtl">532±H3</p></td><td><p dir="rtl">٤٨٤ ±٨؛</p></td><td><p dir="rtl">3;,ΐί-</p></td><td><p dir="rtl">٣٣٢ +٢٣</p></td><td><p>Ai 276</p></td><td><p>τ3±τ9.</p></td><td><p dir="rtl">٢٣٤٣.٠٠</p></td><td><p dir="rtl">,،،٠-٠</p></td><td><p dir="rtl">١٥</p></td></tr><tr><td><p dir="rtl">,؛٤٥٤٥</p></td><td><p dir="rtl">11 2-٢٦</p></td><td><p dir="rtl">٣٧٤٥٥٢</p></td><td><p>1+</p></td><td><p>τ.±τ.4</p></td><td></td><td><p dir="rtl">٢٤٢٣٤</p></td><td><p dir="rtl">٤٦٤٦٠٨</p></td><td><p dir="rtl">١٩</p></td></tr><tr><td><p dir="rtl">16.5-6,</p></td><td><p dir="rtl">٥١١±٣٨</p></td><td><p>38±6.τ</p></td><td><p dir="rtl">A 4 22</p></td><td><p dir="rtl">٢1±١٥٦</p></td><td><p dir="rtl">٢٦٤٢,٠</p></td><td><p dir="rtl">.؛٢,٤٢</p></td><td><p dir="rtl">٤؛٦±؛٣</p></td><td><p dir="rtl">٢٢</p></td></tr><tr><td><p dir="rtl">٥٢٤٦٦٤</p></td><td><p dir="rtl">;.6±;τ</p></td><td><p>65i6l6</p></td><td><p dir="rtl">,٢٥٤,٥</p></td><td><p dir="rtl">No2±;6</p></td><td><p dir="rtl">١٦٩ ١4±</p></td><td><p dir="rtl">٢٢٤٢٦</p></td><td><p>-</p></td><td><p dir="rtl">٢</p></td></tr><tr><td><p dir="rtl">٦٩٥ ٠.٧٤</p></td><td><p dir="rtl">1;6±τ;</p></td><td><p dir="rtl">A. No±8 e</p></td><td><p dir="rtl">they</p></td><td><p dir="rtl">1٩,±١٦</p></td><td><p dir="rtl">٩٨١٩</p></td><td><p dir="rtl">٣٧٨ ؛٢٣</p></td><td><p dir="rtl">٧٣٤٧٨٠</p></td><td><p dir="rtl">٣٩</p></td></tr><tr><td><p dir="rtl">mm *66</p></td><td><p dir="rtl">٧٢٧ ±٥٧</p></td><td></td><td><p dir="rtl">٣١٠٢١٥</p></td><td><p dir="rtl">٢٣,±٢١</p></td><td><p dir="rtl">٢.٣؛٣٣</p></td><td><p dir="rtl">.؛,؛،؛</p></td><td><p dir="rtl">٨,٢ ؛٧٨</p></td><td><p dir="rtl">٣٢</p></td></tr><tr><td><p>MiXMx</p></td><td><p dir="rtl">,,ί0;0</p></td><td><p dir="rtl">C9B'D0</p></td><td><p dir="rtl">٢.٤٢,٠</p></td><td><p dir="rtl">1٩,٢.٤</p></td><td><p dir="rtl">-- ٠ ٠ ٠</p></td><td><p dir="rtl">٥٢٤٣.٨</p></td><td><p dir="rtl">■;01 Mi</p></td><td><p dir="rtl">٣٦</p></td></tr><tr><td><p dir="rtl">٠٠٠^٠٠٠٠</p></td><td><p dir="rtl">٩٤+٦٩</p></td><td><p dir="rtl">٩٠٤٨٨٢</p></td><td><p dir="rtl">Mh +41</p></td><td><p dir="rtl">3;,±τ0</p></td><td><p dir="rtl">٣٧٦-٩</p></td><td><p dir="rtl">٦؛٢±٥١</p></td><td><p>-+-</p></td><td></td></tr><tr><td><p dir="rtl">٨٢٤١.٠٢</p></td><td></td><td><p>+1</p></td><td><p dir="rtl">,٢٩٤٤٧</p></td><td><p dir="rtl">٤١٦٢</p></td><td><p>2ti312</p></td><td><p dir="rtl">٩٤٣٧٣؛</p></td><td><p dir="rtl">.٠٤,؛؛,١</p></td><td></td></tr><tr><td><p dir="rtl">٩٢٤١.٦٦</p></td><td><p dir="rtl">٣٦١١٤٨</p></td><td><p>13,±113Λ</p></td><td></td><td><p dir="rtl">٣١٤,٩٣</p></td><td><p dir="rtl">٠٨٤٢٦٢</p></td><td><p dir="rtl">٦٩٤٤٥٩</p></td><td><p dir="rtl">؛١٤٦٤١١٧</p></td><td><p>A</p></td></tr><tr><td><p>9Α4,164</p></td><td><p dir="rtl">1368 Dalah</p></td><td><p dir="rtl">A.13±'121</p></td><td><p>'Ai 563</p></td><td><p dir="rtl">٣,٤٢٧٧</p></td><td><p dir="rtl">1A;±i9</p></td><td><p dir="rtl">٥٣٩ ،,,</p></td><td><p dir="rtl">١٤٤٤,٣٦٦</p></td><td><p dir="rtl">٥١</p></td></tr><tr><td><p dir="rtl">١٣٩٤١٢٠٦</p></td><td><p dir="rtl">١٣٢٦ ٥٦</p></td><td><p dir="rtl">±1Τ8Λ;13</p></td><td><p dir="rtl">٠٠٠٠٠٠٠</p></td><td><p dir="rtl">٣٧٢٢</p></td><td><p dir="rtl">٤٠٤٤٢٢</p></td><td><p dir="rtl">5iT;.A</p></td><td><p dir="rtl">١٣٤٤ ؛١٥٥</p></td><td><p dir="rtl">٥٤</p></td></tr><tr><td><p>1.2±113γ</p></td><td><p dir="rtl">٥٣٠, ؛٣٢</p></td><td><p>151±12Λ.</p></td><td><p dir="rtl">٦٦٥ ؛٥٦</p></td><td><p dir="rtl">-٢٦±٣٦</p></td><td><p dir="rtl">;j^ Aa0</p></td><td><p dir="rtl">٥٩٤ *٩</p></td><td><p dir="rtl">١٢٦٦ ؛١٦١</p></td><td><p dir="rtl">٥٧</p></td></tr><tr><td></td><td><p dir="rtl">1 +٣٩</p></td><td><p dir="rtl">٤٩٤١٢,١٠,</p></td><td><p dir="rtl">٥٢٤٦٩٠</p></td><td><p dir="rtl">675 D36</p></td><td><p dir="rtl">497; ,A</p></td><td><p dir="rtl">٦٥٩±..١</p></td><td><p dir="rtl">١٤٩٢-١٢٩</p></td><td><p dir="rtl">٦١</p></td></tr><tr><td><p>-</p></td><td><p dir="rtl">·158 +R0;</p></td><td><p dir="rtl">٢٠؛1±١٦٠</p></td><td><p dir="rtl">٦٤٤٧٥٨</p></td><td><p dir="rtl">٣٦٣+٤٥</p></td><td><p dir="rtl">٥١٩ ؛٨٣</p></td><td><p dir="rtl">718±No11</p></td><td><p>-</p></td><td><p dir="rtl">؛٦</p></td></tr><tr><td></td><td><p>ν1415”.</p></td><td><p dir="rtl">؟1٥0 ١٩٨4</p></td><td><p>-</p></td><td><p>-1</p></td><td><p dir="rtl">٦٣٦±،'١١</p></td><td><p dir="rtl">]M8DB15</p></td><td></td><td><p>1</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p dir="rtl">٧.٦±١.٢</p></td><td><p dir="rtl">M-</p></td><td><p>-</p></td><td><p dir="rtl">unless</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>--1</p></td><td></td><td><p>-</p></td><td><p>-</p></td><td><p>7Α</p></td></tr>
<img file="SA4069B1_D0324.tif" />
Efficacy of anti-Notch ADC's Siri human rat at a dose of • mg/kg in breast infusions 468-0-04
<tr><td colspan="15"><p dir="rtl">Let's talk about it, 1468-0, the size of their bull, name] ± 05ΕΜ</p></td><td></td></tr><tr><td><p>i0w67S0</p></td><td><p>02880107</p></td><td><p>08920131</p></td><td><p>1298.823377</p></td><td></td><td><p>ch75-ra5780</p></td><td><p>ch75-ve,"01</p></td><td><p dir="rtl">E0078a8p</p></td><td><p>„1.ΓΙ,,ΙΙ</p></td><td><p>ch75-rac0,31</p></td><td><p>602013!</p></td><td><p dir="rtl">1 d 1 p. 80 pearls</p></td><td><p>ch28-mc3377</p></td><td><p>ch28-mc0t31</p></td><td><p>PBS</p></td><td><p dir="rtl">Thabuj</p></td></tr><tr><td><p dir="rtl">؛٢,٤٣١</p></td><td><p>At 36,</p></td><td><p dir="rtl">٣٠٨٦ *٢٣</p></td><td><p dir="rtl">-٦٥،٣٦</p></td><td><p dir="rtl">Mam 214</p></td><td><p dir="rtl">+٨</p></td><td><p dir="rtl">362b7</p></td><td><p dir="rtl">٣٠٢٠٩,</p></td><td><p>,,,,If</p></td><td><p dir="rtl">٣٠+1</p></td><td><p dir="rtl">٢,٠٢١١</p></td><td><p dir="rtl">؛٥٠٣١!</p></td><td><p>,.0Γ12</p></td><td><p dir="rtl">؛,١٣٠٣</p></td><td><p dir="rtl">١,٠٧,٩</p></td><td><p>,-</p></td></tr><tr><td><p dir="rtl">9.4 ٦١٦</p></td><td><p dir="rtl">333j27</p></td><td><p dir="rtl">٣٥٨</p></td><td></td><td><p dir="rtl">353 Not2</p></td><td><p dir="rtl">A34;17</p></td><td><p dir="rtl">٣٢٩ +٢١</p></td><td><p dir="rtl">*٣٢ ؛.,</p></td><td><p dir="rtl">١٣٠</p></td><td><p dir="rtl">٣٧ ؛11</p></td><td><p dir="rtl">٣٣١ ؛١٦</p></td><td><p>1+1</p></td><td><p dir="rtl">٢٣١*.٣</p></td><td><p dir="rtl">١٩٤٢,٠١</p></td><td><p dir="rtl">396/30</p></td><td><p>،</p></td></tr><tr><td><p dir="rtl">٣.٠٧ ؛٦٨</p></td><td><p dir="rtl">,;r ;22</p></td><td><p dir="rtl">6M39 234</p></td><td><p>,1,,Ί</p></td><td><p dir="rtl">٣٨٥ ٣٣</p></td><td><p dir="rtl">٣٢٣-٢١</p></td><td><p dir="rtl">٢٩٧ +٢٣</p></td><td><p dir="rtl">١٤٣,٣,</p></td><td><p dir="rtl">٣:١±؛١</p></td><td><p dir="rtl">٣1٥؛؛1</p></td><td><p dir="rtl">٣٩٥ ؛٥,</p></td><td><p>1ί±301</p></td><td><p>1ν±117</p></td><td><p dir="rtl">٢1٥±١٨</p></td><td><p dir="rtl">؛٢٥٤٤٦</p></td><td><p dir="rtl">٠</p></td></tr><tr><td><p dir="rtl">٤٢٦ ٣١٤</p></td><td><p dir="rtl">٣٥ ٣٥</p></td><td><p dir="rtl">١١٦-٠٠،</p></td><td><p dir="rtl">Ι,Α ;31</p></td><td><p dir="rtl">٣٢٤,٣١</p></td><td><p dir="rtl">٣٠1 +٢٥</p></td><td><p dir="rtl">١٦٤,١٩</p></td><td><p dir="rtl">237 Taha</p></td><td><p dir="rtl">9j1 9th ed</p></td><td><p dir="rtl">٣٢٤ ٢٢</p></td><td><p dir="rtl">٣٣,١ ؛,1</p></td><td><p dir="rtl">1٣٤٢٥1</p></td><td><p dir="rtl">23 Taha</p></td><td><p dir="rtl">١٥٤٣٦٣</p></td><td><p dir="rtl">٤٥٢ ٣١</p></td><td><p dir="rtl">١,</p></td></tr><tr><td><p dir="rtl">Λ5; ;23</p></td><td><p dir="rtl">.٣٦±٦١</p></td><td><p dir="rtl">٥٣٧ ٥٦</p></td><td><p dir="rtl">٥-٠،،،-></p></td><td><p dir="rtl">٤٩٦ ؛٥؛</p></td><td><p dir="rtl">No, 254</p></td><td><p dir="rtl">١٢٤١٠٨</p></td><td><p dir="rtl">١٣٦ +٦٩</p></td><td><p dir="rtl">٣،٩ +٨</p></td><td><p dir="rtl">٥٧, ٢٠</p></td><td><p dir="rtl">E11+9</p></td><td><p dir="rtl">١٦٧٣ ؛١,</p></td><td><p dir="rtl">٠-" ٠,٠</p></td><td><p dir="rtl">١,٤١٤٢</p></td><td><p dir="rtl">57Α *0,</p></td><td><p>,Λ</p></td></tr><tr><td><p dir="rtl">6;0±ί3</p></td><td><p>11 -</p></td><td><p dir="rtl">٤٦ ٥٥٤</p></td><td><p dir="rtl">٦٩،،>,</p></td><td><p dir="rtl">495 My uncle</p></td><td><p dir="rtl">٣٢٣ ؛٢؛</p></td><td><p dir="rtl">٤٧٠-,</p></td><td><p dir="rtl">*M</p></td><td><p dir="rtl">٢٤ ±٧</p></td><td><p>3742,ί</p></td><td><p dir="rtl">٦٨ ؛٦</p></td><td><p dir="rtl">°،١,٠٠</p></td><td><p>0-ίΐ,.</p></td><td><p dir="rtl">Miss</p></td><td><p dir="rtl">٦٤٦١٥؛</p></td><td><p dir="rtl">٢١</p></td></tr><tr><td><p dir="rtl">٣١٦١٤</p></td><td><p dir="rtl">Oh 66</p></td><td><p dir="rtl">٦٩٤٦٣٨</p></td><td><p dir="rtl">٧,٤٦٣٨</p></td><td><p dir="rtl">؛٥٨ ±٥٦</p></td><td><p dir="rtl">I want to destroy it</p></td><td><p dir="rtl">37 p. 11</p></td><td><p dir="rtl">163 ha</p></td><td><p dir="rtl">؛, ±٧</p></td><td><p dir="rtl">١١٠١ + ٢٤</p></td><td><p dir="rtl">١٠٤٣٦</p></td><td><p dir="rtl">١٥ *٠٠</p></td><td><p dir="rtl">١٣٢-٦٥</p></td><td><p dir="rtl">١١٣ +١٢</p></td><td></td><td><p dir="rtl">٨,</p></td></tr><tr><td><p dir="rtl">ν37±;6</p></td><td><p dir="rtl">*B;1.1</p></td><td><p dir="rtl">٧١ ١٦٤,</p></td><td><p dir="rtl">٠</p></td><td><p dir="rtl">٦٦٣؛؛٦</p></td><td><p dir="rtl">٣٤ ؛٥٠١</p></td><td><p dir="rtl">٦, +</p></td><td><p dir="rtl">١٧٦ *٠٠</p></td><td><p dir="rtl">٠-*~</p></td><td><p dir="rtl">٩٠٦ ؛٣١</p></td><td><p>'، -~</p></td><td><p dir="rtl">٧,,؛,1</p></td><td><p dir="rtl">,,a*.,</p></td><td><p dir="rtl">١٣١ ؛٢٥</p></td><td><p>ΛVI 00-</p></td><td><p dir="rtl">٥؟</p></td></tr><tr><td><p>1+1</p></td><td><p dir="rtl">,٩٩٤٢٦</p></td><td><p dir="rtl">ΑΑ1±;1,</p></td><td><p dir="rtl">,١٦٠٤٨٨</p></td><td><p dir="rtl">٥٦٤٧,٢</p></td><td><p>V',,,.</p></td><td><p dir="rtl">٦٢ +٩</p></td><td><p dir="rtl">١٤,١٩؛</p></td><td><p dir="rtl">Row; Smazhar</p></td><td><p dir="rtl">٢٦٧ ؛٢٦</p></td><td><p dir="rtl">21;A1</p></td><td><p dir="rtl">١٤ ؛٢٣</p></td><td><p dir="rtl">:٩٤,٢,</p></td><td><p dir="rtl">11 ±٣٧</p></td><td><p dir="rtl">٣٤٩٦٨-,</p></td><td><p dir="rtl">٢٩</p></td></tr><tr><td><p dir="rtl">ΑΛΑ;,;</p></td><td><p>Ur,</p></td><td><p>141</p></td><td><p dir="rtl">Dr; *13</p></td><td><p dir="rtl">٧٥٣ ؛٧٥</p></td><td><p dir="rtl">٤٢ ٧,٤</p></td><td><p>At,.</p></td><td><p dir="rtl">,؛١٤٢؛</p></td><td><p dir="rtl">Seductive 1 folded</p></td><td><p dir="rtl">E2 fold</p></td><td><p dir="rtl">31 ed. 1</p></td><td><p dir="rtl">؛٢٧٤١٧</p></td><td><p dir="rtl">1،,٠,,</p></td><td><p dir="rtl">١٦٨ ±٣٥</p></td><td><p dir="rtl">'..;,,,I</p></td><td><p dir="rtl">٤٣</p></td></tr><tr><td><p dir="rtl">E• 1.24</p></td><td><p dir="rtl">٧'١.٦٤٣١</p></td><td></td><td><p dir="rtl">10.6 AI;,</p></td><td><p dir="rtl">؛٧٧٤٨٢</p></td><td><p dir="rtl">٣؛ ؛٧٧٤</p></td><td><p dir="rtl">١١ ؛٨</p></td><td><p dir="rtl">٣؛,١٤؛</p></td><td><p dir="rtl">Saghr y gumhawi</p></td><td><p dir="rtl">٢٩٢ ؛٢٥</p></td><td><p dir="rtl">؛؛ ١٦٠</p></td><td><p dir="rtl">١.٩٨ ؛٨؛</p></td><td><p dir="rtl">-,٣٧٤١</p></td><td><p dir="rtl">191;τ;</p></td><td><p dir="rtl">١١٤*1٢٦</p></td><td><p dir="rtl">٤٦</p></td></tr><tr><td><p dir="rtl">1.28±28A</p></td><td><p dir="rtl">٤٣٩ * 11</p></td><td><p>,11+1</p></td><td><p dir="rtl">؛,٥٠٤١١,</p></td><td><p dir="rtl">٠٨٩٦-,</p></td><td><p dir="rtl">٨٦٤,٩٥</p></td><td><p dir="rtl">٧ ؛٧</p></td><td><p dir="rtl">٥٣٤٢٩٥</p></td><td><p dir="rtl">Son-in-law I Semler</p></td><td><p dir="rtl">٤ ٣٣ ؛٤٦</p></td><td><p dir="rtl">١٧٤٢٧</p></td><td><p dir="rtl">٤٤٦٠١</p></td><td><p dir="rtl">٢٢٢ *٣٢</p></td><td><p dir="rtl">٢٣٣ ؛٥٦</p></td><td><p dir="rtl">١٢١-٩٢</p></td><td><p dir="rtl">٩؛</p></td></tr><tr><td><p dir="rtl">5'Τ1,;Γ;1</p></td><td><p dir="rtl">١٥٥٤٥١٠٧</p></td><td><p dir="rtl">٦٢١٩ ؛٧٥،</p></td><td><p dir="rtl">٨٩٤١٣٥٦,</p></td><td><p dir="rtl">١.٦٤١,٩٢</p></td><td><p dir="rtl">١١٠٤٦٥٢</p></td><td><p dir="rtl">٠٥١٥'</p></td><td><p dir="rtl">٦٥٤٣٦٩</p></td><td><p dir="rtl">ḍrzạnr</p></td><td><p dir="rtl">٠.؛ ؛٥٢</p></td><td><p dir="rtl">٧٢ ٣.٩٤</p></td><td><p dir="rtl">٢٧٣ ؛٥٩</p></td><td><p dir="rtl">446- R2</p></td><td><p dir="rtl">٣٩٨ ±٦٧</p></td><td><p dir="rtl">,.!١,٠١'</p></td><td><p dir="rtl">٥٧</p></td></tr><tr><td><p>νν± 1161</p></td><td><p>Λλ±</p></td><td><p dir="rtl">١٦١٠٦١٨٧</p></td><td><p dir="rtl">٥٨٤١١٩٦,</p></td><td><p>97±,6Α</p></td><td></td><td><p dir="rtl">٦٤١٥,</p></td><td><p dir="rtl">٦١٠,٧٣</p></td><td><p dir="rtl">Sakr; slr</p></td><td><p dir="rtl">472±,e</p></td><td><p>2Α± 69</p></td><td><p dir="rtl">•٣٣ ٦٧٤</p></td><td><p dir="rtl">٣٠٥١٣،</p></td><td><p dir="rtl">٢٢٨ +٦٩</p></td><td><p>-</p></td><td><p dir="rtl">.٦</p></td></tr><tr><td><p dir="rtl">·'١٣١ ؛٩٣</p></td><td><p dir="rtl">٥٩1 ١٤١</p></td><td><p dir="rtl">6.32;-ι6</p></td><td><p dir="rtl">٢٧٤١٣٢٦,</p></td><td><p dir="rtl">١,٢٤١.٩٣</p></td><td><p dir="rtl">٤٧.٩؛١١</p></td><td><p dir="rtl">,٤٢؛,</p></td><td><p dir="rtl">١٥؛ +٧٦</p></td><td><p dir="rtl">Saqr Kh Haghar</p></td><td><p dir="rtl">٩٨؛ ٥.١٤</p></td><td><p dir="rtl">٣٩٤٦٧</p></td><td><p dir="rtl">؛٣٥ ٦٧٤</p></td><td><p dir="rtl">٠٥١٦"</p></td><td><p dir="rtl">٢٢٠</p></td><td><p>-</p></td><td><p dir="rtl">٦٣</p></td></tr><tr><td><p>-</p></td><td><p dir="rtl">٦٥٥ ؛١٦٥</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p dir="rtl">٧,٨ *٠,٦</p></td><td><p>1+1</p></td><td><p dir="rtl">866 Bal</p></td><td><p dir="rtl">torticollis; zero</p></td><td><p dir="rtl">٥٦٣ ؛٦٣</p></td><td><p dir="rtl">2. ؛٣٧</p></td><td><p dir="rtl">٣٧١ ؛٧٧</p></td><td></td><td><p dir="rtl">٢٧٩ ؛٨٥</p></td><td><p>-</p></td><td><p dir="rtl">٦٧</p></td></tr><tr><td><p>-</p></td><td><p dir="rtl">٧،٥±٦',</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٥,٩,٩'</p></td><td><p dir="rtl">٣؛ ٣٧٤</p></td><td><p dir="rtl">١٩؛ ١١٤</p></td><td><p dir="rtl">Scharlmgr</p></td><td><p dir="rtl">٦٦٥*٧٤</p></td><td><p dir="rtl">؛٧٤١١؛</p></td><td><p dir="rtl">٣٨٣ ؛٧؛</p></td><td><p dir="rtl">٥٧٤٦٨٢</p></td><td><p dir="rtl">٤٣٤ ؛٩١</p></td><td><p>-</p></td><td><p>7ί</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٥؛±٣٦</p></td><td><p>-</p></td><td><p dir="rtl">zero. ±0</p></td><td><p>-</p></td><td><p dir="rtl">؛١١ ؛٥١</p></td><td><p dir="rtl">A;2;</p></td><td><p>-</p></td><td><p dir="rtl">·٧؛ ؛١٣,</p></td><td><p>-</p></td><td><p dir="rtl">٧٧</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٦ ٣٧</p></td><td><p>-</p></td><td><p dir="rtl">Sgrdsnr</p></td><td><p>-</p></td><td><p dir="rtl">١٧ ٧,٤</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>1،</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٢٧,٤٠٤</p></td><td><p>-</p></td><td><p dir="rtl">Zero ± min</p></td><td><p>-</p></td><td><p dir="rtl">163±H7</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>1Λ</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">Torticollis</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td></td><td><p>، ،</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">desert; Small</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td></td><td></td></tr><tr><td><p>-</p></td><td></td><td></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">Small * seductive</p></td><td><p>"</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>'</p></td><td><p dir="rtl">١,٧</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">torticollis; Alar</p></td><td></td><td></td><td><p>-</p></td><td></td><td></td><td></td><td><p dir="rtl">١٢٦</p></td></tr>
٤٠٦٩
-٦٩٤-
<img file="SA4069B1_D0325.tif" />
Efficacy of anti-Notch ADC's in human rat at a dose of 1 mg/kg in gastric bypass Ν87
<tr><td colspan="8"><p dir="rtl">Malignant lesions: 003468 tumor cells (blood ± SEM)</p></td><td></td></tr><tr><td><p>039:18</p></td><td><p>328-8=0103</p></td><td><p>-13526780</p></td><td><p dir="rtl">L!A6-75g</p></td><td><p dir="rtl">EH7Y06A2±A</p></td><td><p>ΐΕ2ϊ-«5101</p></td><td><p>Dck280cOI3J</p></td><td><p>25</p></td><td><p dir="rtl">Theob</p></td></tr><tr><td><p dir="rtl">٣٩٣ +11</p></td><td><p dir="rtl">Y 29 gm 6</p></td><td><p dir="rtl">1.85 h</p></td><td><p>Yes r91</p></td><td><p>17i 2ΑΑ</p></td><td><p dir="rtl">٢٩٤ ؛٦٦</p></td><td><p dir="rtl">211 ed. 611</p></td><td><p>111 ΓΑΑ</p></td><td><p dir="rtl">-a</p></td></tr><tr><td><p dir="rtl">16m*31</p></td><td><p dir="rtl">٧٢٢-٦٠</p></td><td><p dir="rtl">٦٣-٢١</p></td><td><p>2A±516</p></td><td><p dir="rtl">،،٠، ٠,٠،</p></td><td><p dir="rtl">P2</p></td><td><p dir="rtl">11 ؛٢٥</p></td><td><p>.4-12</p></td><td><p>,</p></td></tr><tr><td><p dir="rtl">٧٢٣ ٤٣٧</p></td><td><p dir="rtl">ν0β;7Ί</p></td><td><p dir="rtl">έΐντ.;</p></td><td><p dir="rtl">,٦٠،-,</p></td><td><p dir="rtl">1±٥٢١؛</p></td><td><p dir="rtl">،٠، ٠٠٠</p></td><td><p dir="rtl">٥٩٣ 11؛</p></td><td><p>21+</p></td><td><p>1</p></td></tr><tr><td><p dir="rtl">٤٦٣١٠١٩</p></td><td></td><td><p dir="rtl">56Λ ;; ,a</p></td><td><p dir="rtl">٤٣٧ ؛١٩</p></td><td><p>،،-،-,</p></td><td><p dir="rtl">٢٦٤١٢</p></td><td><p dir="rtl">٦٢٢ ؛٥٠</p></td><td><p dir="rtl">1rr5;6v</p></td><td><p dir="rtl">١١</p></td></tr><tr><td><p>1+9ΛΛ</p></td><td><p dir="rtl">ν70;;12</p></td><td><p dir="rtl">M44 P87</p></td><td><p>1Λ±270</p></td><td><p dir="rtl">.٩١,±٥١</p></td><td><p>Τ1±</p></td><td><p dir="rtl">٠٠٠ ٠٠٠</p></td><td><p>Λ541ί6.</p></td><td><p dir="rtl">:١</p></td></tr><tr><td><p dir="rtl">٩٧ ١ +,</p></td><td><p>l6Vi\27</p></td><td><p dir="rtl">،٠٠٠٠،</p></td><td><p>2 0-0ΪΑ</p></td><td><p>1 650Α5</p></td><td><p>2-1 1Α2</p></td><td><p dir="rtl">٠٥1</p></td><td><p>Ί0111292</p></td><td><p dir="rtl">،٠</p></td></tr><tr><td><p dir="rtl">٦٢٠١ +١٥٦</p></td><td><p dir="rtl">ν75;,1Λ</p></td><td><p dir="rtl">A6;1114</p></td><td><p dir="rtl">2* tam</p></td><td><p>Λ0+ί014</p></td><td><p>254 1Α9</p></td><td><p dir="rtl">٥٢٨ * 11</p></td><td><p dir="rtl">١١٠٠٦±-١١١</p></td><td><p dir="rtl">٢٩</p></td></tr><tr><td><p dir="rtl">23 +٦٦١٩</p></td><td><p>0 L,AAί.</p></td><td><p dir="rtl">٤٣ ±١٣١</p></td><td><p>“4t,0</p></td><td><p dir="rtl">٣٠٥-١٤</p></td><td><p dir="rtl">؛١٩ ؛٣٠</p></td><td><p dir="rtl">٥٢١ ٧٢</p></td><td><p>-</p></td><td><p dir="rtl">٢٥</p></td></tr><tr><td><p dir="rtl">What +137</p></td><td><p>---. -..</p></td><td><p dir="rtl">٤٢٢ ±1٢٢</p></td><td><p dir="rtl">.٢٢٣ *٦</p></td><td><p dir="rtl">291 ;ΛΑ</p></td><td><p>261 17ί</p></td><td><p dir="rtl">Oh, 7Λ</p></td><td><p>-</p></td><td><p dir="rtl">١٨</p></td></tr><tr><td><p dir="rtl">-621b-16</p></td><td><p dir="rtl">٤٢ 1 +١٤٨</p></td><td><p dir="rtl">;«,,,I</p></td><td></td><td><p dir="rtl">Dr</p></td><td><p dir="rtl">١٧٦ 2 ٣٢</p></td><td><p>ν01 m59</p></td><td><p>-</p></td><td><p dir="rtl">٢١</p></td></tr><tr><td><p dir="rtl">٦١٤٦٥+٢٣٧</p></td><td><p dir="rtl">٦.١٥ *١٦٢</p></td><td><p>IVVi 49</p></td><td><p>«τ0 226</p></td><td><p dir="rtl">١١٠,٦٠,</p></td><td><p dir="rtl">٦١٤ ٠,٥٤</p></td><td><p dir="rtl">٦١٠١ +١٩</p></td><td><p>-</p></td><td><p dir="rtl">٢٥</p></td></tr><tr><td><p>-</p></td><td><p>1Λ61\'91</p></td><td><p dir="rtl">،٠١ ؛١٩٠</p></td><td><p dir="rtl">16;D1.A</p></td><td><p dir="rtl">01 hand 133</p></td><td><p>5η 21</p></td><td><p>,Al 1(</p></td><td><p>-</p></td><td><p dir="rtl">٢١</p></td></tr><tr><td><p>-</p></td><td><p dir="rtl">911;Λ,2</p></td><td><p>1,wi.f</p></td><td><p dir="rtl">9.5 Taha</p></td><td><p dir="rtl">٤٩٣+١٥٨</p></td><td><p dir="rtl">٥.١٠١١٠٩</p></td><td><p dir="rtl">3'Λ1 ;115</p></td><td><p>-</p></td><td><p dir="rtl">٤٦</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٨٠٦ ١٦٨</p></td><td></td><td><p dir="rtl">٥٩٧٣+1</p></td><td><p dir="rtl">1 ٣٤</p></td><td><p dir="rtl">.٩1١.٢؛1</p></td><td><p>-</p></td><td><p dir="rtl">·٥</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>1,ri1..</p></td><td><p dir="rtl">1.15±7.A</p></td><td><p>1ί00,1.</p></td><td><p>ΛΓ1 3604</p></td><td><p dir="rtl">E 10 *152</p></td><td><p>-</p></td><td><p dir="rtl">٠٠</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">,؛٦±؛٢٥</p></td><td><p dir="rtl">Λ06;252</p></td><td><p dir="rtl">,,,،٠-,</p></td><td><p>Α»ί 279</p></td><td><p dir="rtl">93;1j207</p></td><td><p>-</p></td><td><p dir="rtl">٦٢</p></td></tr><tr><td></td><td><p>-</p></td><td><p dir="rtl">78.9 *363</p></td><td></td><td><p>τ0,0--'0.</p></td><td><p>119</p></td><td><p>-</p></td><td></td><td><p dir="rtl">1٩</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٨٢٠+19</p></td><td><p dir="rtl">٤ ٥٣</p></td><td><p>-</p></td><td><p>-</p></td><td><p>ν7</p></td></tr><tr><td><p>Γ</p></td><td><p>-</p></td><td><p>-</p></td><td></td><td><p>,</p></td><td><p dir="rtl">'٦٢١ 11</p></td><td><p>-</p></td><td></td><td><p dir="rtl">١٢,</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">Α1Γ ;1910</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">.١</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">٢,٩٤</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">١٥</p></td></tr><tr><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">A-9*213</p></td><td><p>-</p></td><td><p>-</p></td><td><p dir="rtl">١٠١</p></td></tr>
<img file="SA4069B1_D0326.tif" />
Efficacy of anti-Notch ADC's yeast 0 mg/kg rat gastric infusion Ν87
<tr><td colspan="5"><p dir="rtl">Dakhlaak Dakhla Shamdakh 03468-0 Hahab Lurum (mm; 50)</p></td><td></td></tr><tr><td><p>750(1120-0131</p></td><td><p>170 00131</p></td><td><p>281020/-0131</p></td><td><p dir="rtl">[1013 s</p></td><td><p>PBS</p></td><td><p dir="rtl">For a day</p></td></tr><tr><td><p dir="rtl">3922 Dh,</p></td><td><p dir="rtl">٣٦٠-١٢</p></td><td><p>1ν± 39</p></td><td><p dir="rtl">21Ί;1Λ</p></td><td><p dir="rtl">332 dilm</p></td><td><p dir="rtl">-a</p></td></tr><tr><td><p dir="rtl">٠،١٠ ٠،,</p></td><td><p dir="rtl">٤11 ؛٢٢</p></td><td><p dir="rtl">٤1٩ *1؛</p></td><td><p dir="rtl">4903 number 46</p></td><td><p>,Ai *069</p></td><td></td></tr><tr><td><p dir="rtl">٤٥٦٤</p></td><td><p>3Λ± 461</p></td><td><p dir="rtl">٤٤1 ٢٤</p></td><td><p dir="rtl">499 p?</p></td><td><p dir="rtl">٧٠٦ ٥٦</p></td><td><p>V</p></td></tr><tr><td><p dir="rtl">;11±6Α</p></td><td><p dir="rtl">461 ;ΤΓ</p></td><td><p dir="rtl">٣1٦ ±٢٩</p></td><td><p dir="rtl">,٠، ٠٠٠,</p></td><td><p dir="rtl">-Α21 ;1-1</p></td><td><p dir="rtl">٦١</p></td></tr><tr><td><p>70i3fv</p></td><td><p dir="rtl">230 d3</p></td><td><p dir="rtl">٣-٣ +٢٤</p></td><td><p dir="rtl">٣٩2 ٤٣</p></td><td><p dir="rtl">959 years</p></td><td><p dir="rtl">;a</p></td></tr><tr><td><p dir="rtl">٢١٠٩ ٠٠،</p></td><td><p dir="rtl">٠٠٠,٠،</p></td><td><p dir="rtl">٢٣٦ ؛'\٢</p></td><td><p dir="rtl">counting</p></td><td><p dir="rtl">A0A, A0A</p></td><td><p>6Λ</p></td></tr><tr><td><p dir="rtl">١٦,٦ +1</p></td><td><p dir="rtl">٤٤٨-٤</p></td><td><p>,Α 626</p></td><td><p>0ί0 227</p></td><td><p dir="rtl">١٢٥١ ؛١٢,</p></td><td></td></tr><tr><td><p dir="rtl">٢٦ 111</p></td><td><p dir="rtl">٤٢٢؛٠٥</p></td><td><p>*'. --</p></td><td><p dir="rtl">؛٢٢ ؛٥٥</p></td><td><p dir="rtl">٦٢٢٠ ؛١١٢</p></td><td><p dir="rtl">٢٥</p></td></tr><tr><td><p>2ν± 266</p></td><td><p dir="rtl">٤٨٦٧ ؛٠١</p></td><td><p>ίϋ256</p></td><td><p>6τ0 262</p></td><td><p dir="rtl">؛٦٢٥ ؛١٢٢</p></td><td><p>2Λ</p></td></tr><tr><td><p>----.</p></td><td><p>561 5Γ.</p></td><td><p dir="rtl">H15 49</p></td><td><p dir="rtl">٣٠١٩ ؛٦٦</p></td><td></td><td><p dir="rtl">A</p></td></tr><tr><td><p dir="rtl">٣٠٦+٢٩</p></td><td><p dir="rtl">,؛٥ ؛٥٦</p></td><td><p dir="rtl">٢١٣ *٥٢</p></td><td><p dir="rtl">419;Αο</p></td><td></td><td><p dir="rtl">٣٥</p></td></tr><tr><td><p>τ2±2501</p></td><td><p dir="rtl">M;55</p></td><td><p dir="rtl">٢١٥ ؛٦٥</p></td><td><p>Α7± ί5Γ</p></td><td></td><td><p>Τ1</p></td></tr><tr><td><p dir="rtl">'٠,- ٠،,</p></td><td><p dir="rtl">٦١٩+٦٦</p></td><td><p dir="rtl">،٣ *١١</p></td><td><p dir="rtl">٥٢٦ ؛١.٠١</p></td><td></td><td><p dir="rtl">٢؛</p></td></tr><tr><td><p dir="rtl">٤٣٢ 11؛</p></td><td><p>-----</p></td><td><p dir="rtl">٢.١١ ٨٢</p></td><td><p dir="rtl">559 du</p></td><td></td><td><p dir="rtl">٦؛</p></td></tr><tr><td><p dir="rtl">٠٠,١٠،،</p></td><td><p>Α7± 691'</p></td><td><p dir="rtl">+٤١ +٩٦</p></td><td><p dir="rtl">٦٢١٠ ؛١٢٩</p></td><td></td><td><p dir="rtl">١؛</p></td></tr><tr><td><p dir="rtl">٤٤٤ ؛٥٦</p></td><td><p dir="rtl">٥ ٩٧٥-1</p></td><td><p dir="rtl">1;7ί4·1</p></td><td><p dir="rtl">1.Μ;9;1</p></td><td></td><td><p dir="rtl">٥٢</p></td></tr><tr><td><p>2+21</p></td><td><p>9.±75τ</p></td><td><p>11Γ±9 m2</p></td><td><p dir="rtl">١٠١٢ ١٦,٠٠</p></td><td></td><td><p dir="rtl">٥٦</p></td></tr><tr><td><p dir="rtl">٦٢ - ٦٠</p></td><td><p dir="rtl">٩1٩*1٢</p></td><td><p dir="rtl">٥٤٢ ؛١٢٩</p></td><td><p dir="rtl">7Λ2;112</p></td><td></td><td><p dir="rtl">٦٢</p></td></tr><tr><td><p>Λ6± 51'9</p></td><td><p dir="rtl">Λ2ν;10ν</p></td><td><p dir="rtl">٥٢٥ ؛١٤٠١</p></td><td><p dir="rtl">؟٨٤ ٤٦٩٤</p></td><td></td><td><p dir="rtl">٠ ٦٧</p></td></tr><tr><td><p dir="rtl">،٠٠٠٠,٠٠</p></td><td><p dir="rtl">٦٠٤-١٣٩</p></td><td><p dir="rtl">٧١٦ ؛١٩١</p></td><td><p dir="rtl">٠,٩١ 1 ؛٢٧٢</p></td><td></td><td><p dir="rtl">٦٠٧</p></td></tr><tr><td><p>1210 Yes,</p></td><td><p>165±69ν2</p></td><td><p dir="rtl">٠١٥٥ ؛٢٢٠</p></td><td></td><td></td><td><p>،،</p></td></tr><tr><td></td><td><p dir="rtl">±1٢٢٢؛١٩</p></td><td><p dir="rtl">,»٠،،,</p></td><td></td><td></td><td><p dir="rtl">١,</p></td></tr><tr><td><p dir="rtl">112-٩,١</p></td><td></td><td><p dir="rtl">-٧٥١±؛.٢</p></td><td></td><td></td><td><p>9Λ</p></td></tr>
٤٠٦٩
-٦٩٥-
Contents203
16 sheets
Sheet 1 Sheet 2 Sheet 3 Sheet 4 Sheet 5 Sheet 6 Sheet 7 Sheet 8 Sheet 9 Sheet 10 Sheet 11 Sheet 12 Sheet 13 Sheet 14 Sheet 15 Sheet 16
85 members in 28 offices
Priority claims4
| Document | Office | Kind | Date |
|---|---|---|---|
| 201161561255 | United States of America | P | |
| 61561255 | United States of America | – | |
| 201261676423 | United States of America | P | |
| 61676423 | United States of America | – |
Members85
| Document | Office | Kind | |
|---|---|---|---|
| CA2812432A1 | Canada | A1 | |
| CA2812885A1 | Canada | A1 | |
| CA2852860A1 | Canada | A1 | |
| US2013129753A1 | United States of America | A1 | |
| WO2013071411A1 | World Intellectual Property Organization (WIPO) | A1 | |
| WO2013071412A1 | World Intellectual Property Organization (WIPO) | A1 | |
| WO2013071413A1 | World Intellectual Property Organization (WIPO) | A1 | |
| WO2013072813A2 | World Intellectual Property Organization (WIPO) | A2 | |
| AU2012318286A1 | Australia | A1 | |
| AU2012321071A1 | Australia | A1 | |
| AU2012323993A1 | Australia | A1 | |
| CA2812129A1 | Canada | A1 | |
| WO2013071411A8 | World Intellectual Property Organization (WIPO) | A8 | |
| WO2013071412A8 | World Intellectual Property Organization (WIPO) | A8 | |
| WO2013071413A8 | World Intellectual Property Organization (WIPO) | A8 | |
| WO2013072813A3 | World Intellectual Property Organization (WIPO) | A3 | |
| TW201333043A | Taiwan Province of China | A | |
| CA2812432C | Canada | C | |
| CO6950440A2 | Colombia | A2 | |
| AU2012338436A1 | Australia | A1 | |
| KR20140077207A | Republic of Korea | A | |
| AR088694A1 | Argentina | A1 | |
| SG11201401452PA | Singapore | A | |
| IL232529A0 | Israel | A0 | |
| IL232529D0 | Israel | D0 | |
| CA2812885C | Canada | C | |
| MX2014005984A | Mexico | A | |
| US8828401B2 | United States of America | B2 | |
| EP2780039A2 | European Patent Office (EPO) | A2 | |
| US2014309464A1 | United States of America | A1 | |
| CA2812129C | Canada | C | |
| US2014323749A1 | United States of America | A1 | |
| US2014336397A1 | United States of America | A1 | |
| PE20141790A1 | Peru | A1 | |
| CN104185477A | China | A | |
| US2014363452A1 | United States of America | A1 | |
| JP2015502350A | Japan | A | |
| AU2012318286B2 | Australia | B2 | |
| AU2012321071B2 | Australia | B2 | |
| US9006472B2 | United States of America | B2 | |
| US9012704B2 | United States of America | B2 | |
| SA112330989B1 | Saudi Arabia | B1 | |
| SA4069B1This record | Saudi Arabia | B1 | |
| AU2012338436B2 | Australia | B2 | |
| US9138486B2 | United States of America | B2 | |
| ZA201403299B | South Africa | B | |
| US2015307551A1 | United States of America | A1 | |
| NZ624470A | New Zealand | A | |
| HK1204273A | Hong Kong, China | A | |
| HK1204273A1 | Hong Kong, China | A1 | |
| AU2015264844A1 | Australia | A1 | |
| RU2014116878A | Russian Federation | A | |
| US9249186B2 | United States of America | B2 | |
| RU2586885C2 | Russian Federation | C2 | |
| AU2012323993B2 | Australia | B2 | |
| AU2015264844B2 | Australia | B2 | |
| KR101733853B1 | Republic of Korea | B1 | |
| CN104185477B | China | B | |
| TWI589592B | Taiwan Province of China | B | |
| JP6192233B2 | Japan | B2 | |
| EP2780039B1 | European Patent Office (EPO) | B1 | |
| IL232529A | Israel | A | |
| MX352738B | Mexico | B | |
| DK2780039T3 | Denmark | T3 | |
| PT2780039T | Portugal | T | |
| ES2657014T3 | Spain | T3 | |
| PL2780039T3 | Poland | T3 | |
| HUE035463T2 | Hungary | T2 | |
| EP3327027A1 | European Patent Office (EPO) | A1 | |
| SI2780039T1 | Slovenia | T1 | |
| EP2780039B9 | European Patent Office (EPO) | B9 | |
| MY168297A | Malaysia | A | |
| ES2657014T9 | Spain | T9 | |
| PE20190515A1 | Peru | A1 | |
| CA2852860C | Canada | C | |
| BR112014012609A2 | Brazil | A2 | |
| EP3327027B1 | European Patent Office (EPO) | B1 | |
| DK3327027T3 | Denmark | T3 | |
| PT3327027T | Portugal | T | |
| SI3327027T1 | Slovenia | T1 | |
| PL3327027T3 | Poland | T3 | |
| EP3327027B9 | European Patent Office (EPO) | B9 | |
| HUE053589T2 | Hungary | T2 | |
| ES2852052T3 | Spain | T3 | |
| ES2852052T9 | Spain | T9 |
Numbers
- Publication
- 4069
- Publication, DOCDB
- 4069
- Application
- 112330989
- Application, DOCDB
- 112330989
Titles2
- Arabic
- ببتيدات سامة للخلايا ومواد اقتران جسم مضاد وعقار منها
- English
- Cytotoxic peptides and antibody drug conjugates thereof
Classification
- CPC, 23
- C07K7/02
- A61K38/08
- C07D417/12
- A61K47/6889
- A61K47/6811
- A61K47/6851
- A61K47/6855
- A61K47/6863
- C07K5/0205
- A61K38/06
- A61K38/07
- A61P35/00
- A61P43/00
- A61K47/68031
- A61K47/50
- A61K39/395
- C07D417/10
- C07D417/14
- C07K5/02
- C07K16/00
- C07K5/0808
- C07K7/06
- C07K2319/30
- IPC, 4
- C07K7 02
- A61K39 395
- A61K47 48
- A61K38 08