Nova Patents
PL1933871T3

Human monoclonal antibodies to activin receptor-like kinase-1

Abstract

This record has no abstract on file.

Term

Term ended

Projected expiry passed 6 September 2026, 0 years ago.

  1. Priority
  2. Filed
  3. Published
  4. Projected expiry
  5. Today

1 claim: 1 independent, 0 dependent

  1. 1
    Patent claims Zastrzeżenia patentowe Neutralizujące przeciwciało monoklonalne przeciw ALK-1 lub jego część wiążąca antygen, które to przeciwciało lub jego część wiążąca zawiera sekwencje aminokwasowe CDR1, CDR2 i CDR3 domen zmiennych ciężkiego i lekkiego łańcucha odpowiednio:The neutralizing anti-ALK-1 monoclonal antibody or antigen binding portion thereof, which antibody or binding portion thereof comprises the amino acid sequences CDR1, CDR2 and CDR3 of the heavy and light chain variable domains, respectively: SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO and 8;SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO SEQ ID NO i 8;and 16;i 16;and 20;i 20;and 28;i 28;and 32;i 32;and 40;i 40;and 48;i 48;and 52;i 52;and 56;i 56;and 60;i 60;and 64;i 64;and 68;i 68;and 72 or 104 and 127. i 72 lub 104 i 127. Przeciwciało lub jego część wiążąca antygen według zastrzeżenia, gdzie domeny VH i VL przeciwciała lub jego części wiążącej antygen zawierają następujące sekwencje, odpowiednio: The antibody or antigen binding portion thereof according to claim, wherein the VH and VL domains of the antibody or antigen binding portion thereof comprise the following sequences, respectively: and 8;i 8;and 16;i 16;and 20;i 20;and 28;i 28;and 32;i 32;and 40;i 40;and 48;i 48;and 52;i 52;and 56;i 56;and 60;i 60;and 64;i 64;and 68;i 68;and 72;i 72;104 and 127 or the VH amino acid sequence encoded by the nucleotide sequence of the insert present on the clone deposited in ATCC under accession number PTA-6864 and the VL amino acid sequence encoded by the nucleotide sequence of the insert present on the clone deposited in ATCC under accession number PTA-6865. 104 i 127 lub sekwencję aminokwasową VH kodowaną przez sekwencję nukleotydową wstawki obecnej na klonie zdeponowanym w ATCC pod numerem dostępu PTA-6864 i sekwencję aminokwasową VL kodowaną przez sekwencję nukleotydową wstawki obecnej na klonie zdeponowanym w ATCC pod numerem dostępu PTA-6865. Anti-ALK-1 monoclonal antibody comprising the heavy chain amino acid sequence of SEQ ID NO: 2 and the light chain amino acid sequence of SEQ ID NO: 4. Przeciwciało monoklonalne przeciw ALK-1 zawierające sekwencję aminokwasową łańcucha ciężkiego SEQ ID NO: 2 i sekwencję aminokwasową łańcucha lekkiego SEQ ID NO: 4. Anti-ALK-1 monoclonal antibody comprising the heavy chain amino acid sequence of SEQ ID NO: 100 and the light chain amino acid sequence of SEQ ID NO: 102. Przeciwciało monoklonalne przeciw ALK-1 zawierające sekwencję aminokwasową łańcucha ciężkiego SEQ ID NO: 100 i sekwencję aminokwasową łańcucha lekkiego SEQ ID NO: 102. Przeciwciało lub część wiążąca antygen według zastrzeżenia 2, zawierające domenę zmienną ciężkiego łańcucha SEQ ID NO: 6 i domenę zmienną lekkiego łańcucha SEQ ID NO: 8. The antibody or antigen binding portion according to claim 2, comprising the heavy chain variable domain of SEQ ID NO: 6 and the light domain variable domain of SEQ ID NO: 8. Przeciwciało monoklonalne według zastrzeżenia 1 albo 2, przy czym to przeciwciało monoklonalne jest cząsteczką IgG1 lub IgG2. The monoclonal antibody according to claim 1 or 2, wherein said monoclonal antibody is an IgG1 or IgG2 molecule. 155 155 7. The antibody or antigen binding portion according to claim 1, comprising a VH domain that is at least 90% identical in amino acid sequence to any of SEQ ID NO: 6;14;18;26;thirty;38;46;50;54;58;62;66;70 and 104. 7. Przeciwciało lub część wiążąca antygen według zastrzeżenia 1, zawierające domenę VH, która jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z którąkolwiek z SEQ ID NO: 6;14;18;26;30;38;46;50;54;58;62;66;70 i 104. 8. The antibody or antigen binding portion according to claim 1, comprising a VL domain that is at least 90% identical in amino acid sequence to any of SEQ ID NO: 8;16;twenty;28;32;40;48;52;56;60;64;68;72 and 127. 8. Przeciwciało lub część wiążąca antygen według zastrzeżenia 1, zawierające domenę VL, która jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z którąkolwiek z SEQ ID NO: 8;16;20;28;32;40;48;52;56;60;64;68;72 i 127. 9. The antibody or antigen binding portion according to claim 1, wherein said antibody comprises the amino acid sequences CDR1, CDR2 and CDR3 of the heavy and light chain variable domains of SEQ ID NOs: 6 and 8, respectively. 9. Przeciwciało lub część wiążąca antygen według zastrzeżenia 1, przy czym to przeciwciało zawiera sekwencje aminokwasowe CDR1, CDR2 i CDR3 domen zmiennych ciężkiego i lekkiego łańcucha odpowiednio z SEQ ID NO: 6 i 8. 10. The antibody or antigen binding portion according to claim 1 selected from the group consisting of: 10. Przeciwciało lub część wiążąca antygen według zastrzeżenia 1 wybrane z grupy obejmującej: a) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 6, lub różniącą się od SEQ ID NO: 6 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 8, lub różniącą się od SEQ ID NO: 8 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;a) the antibody or portion thereof that contains the VH domain as shown in SEQ ID NO: 6, or different from SEQ ID NO: 6 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 8, or different from SEQ ID NO: 8 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;b) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 14, or different from SEQ ID NO: 14 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 16, or different from SEQ ID NO: 16 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;b) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 14, lub różniącą się od SEQ ID NO: 14 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 16, lub różniącą się od SEQ ID NO: 16 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;c) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 18, lub różniącą się od SEQ ID NO: 18 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 20, lub różniącą się od SEQ ID NO: 20 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;c) the antibody or portion thereof that contains the VH domain as shown in SEQ ID NO: 18, or different from SEQ ID NO: 18 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 20, or different from SEQ ID NO: twenty at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;d) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 26, lub różniącą się od SEQ ID NO: 26 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 28, lub różniącą się od SEQ ID NO: 28 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna d) the antibody or portion thereof that contains the VH domain as shown in SEQ ID NO: 26, or different from SEQ ID NO: 26 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 28, or different from SEQ ID NO: 28 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical 156 in terms of amino acid sequence at least 90% with unsubstituted sequence;156 pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;e) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 30, lub różniącą się od SEQ ID NO: 30 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 32, lub różniącą się od SEQ ID NO: 32 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;e) the antibody or portion thereof that contains the VH domain as shown in SEQ ID NO: 30, or different from SEQ ID NO: 30 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 32, or different from SEQ ID NO: 32 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;f) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 38, or different from SEQ ID NO: 38 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 40, or different from SEQ ID NO: 40 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;f) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 38, lub różniącą się od SEQ ID NO: 38 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 40, lub różniącą się od SEQ ID NO: 40 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;g) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 46, or different from SEQ ID NO: 46 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 48, or different from SEQ ID NO: 48 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;g) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 46, lub różniącą się od SEQ ID NO: 46 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 48, lub różniącą się od SEQ ID NO: 48 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;h) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 50, or different from SEQ ID NO: 50 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 52, or different from SEQ ID NO: 52 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;h) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 50, lub różniącą się od SEQ ID NO: 50 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 52, lub różniącą się od SEQ ID NO: 52 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;i) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 54, lub różniącą się od SEQ ID NO: 54 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 56, lub różniącą się od SEQ ID NO: 56 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;i) the antibody or portion thereof that contains the VH domain as shown in SEQ ID NO: 54, or different from SEQ ID NO: 54 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 56, or different from SEQ ID NO: 56 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;157 157 j) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 58, lub różniącą się od SEQ ID NO: 58 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 60, lub różniącą się od SEQ ID NO: 60 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;j) the antibody or portion thereof that contains the VH domain as shown in SEQ ID NO: 58, or different from SEQ ID NO: 58 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 60, or different from SEQ ID NO: 60 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;k) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 62, or different from SEQ ID NO: 62 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 64, or different from SEQ ID NO: 64 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;k) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 62, lub różniącą się od SEQ ID NO: 62 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 64, lub różniącą się od SEQ ID NO: 64 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;l) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 66, or different from SEQ ID NO: 66 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 68, or different from SEQ ID NO: 68 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;l) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 66, lub różniącą się od SEQ ID NO: 66 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 68, lub różniącą się od SEQ ID NO: 68 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;m) przeciwciało lub jego część wiążąca antygen, które zawiera domenę VH jak pokazano w SEQ ID NO: 70, lub różniącą się od SEQ ID NO: 70 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 72, lub różniącą się od SEQ ID NO: 72 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;m) the antibody or antigen binding portion thereof which comprises the VH domain as shown in SEQ ID NO: 70, or differing from SEQ ID NO: 70 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical in amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 72, or different from SEQ ID NO: 72 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;n) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 104, or different from SEQ ID NO: 104 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 127, or different from SEQ ID NO: 127 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;n) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 104, lub różniącą się od SEQ ID NO: 104 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 127, lub różniącą się od SEQ ID NO: 127 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;o) an antibody or portion thereof that contains the VH domain as shown in SEQ ID NO: 6, or differing from SEQ ID NO: 6 by at least one conservative o) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 6, lub różniącą się od SEQ ID NO: 6 co najmniej jednym konserwatywnym 158 amino acid substitution, wherein the sequence with at least one conservative amino acid substitution is identical in amino acid sequence to at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 127, or different from SEQ ID NO: 127 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;and 158 podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 127, lub różniącą się od SEQ ID NO: 127 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;oraz p) an antibody or portion thereof that contains a VH domain as shown in SEQ ID NO: 104, or different from SEQ ID NO: 104 with at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being identical to relative to the amino acid sequence at least 90% with the unsubstituted sequence, and the VL domain as shown in SEQ ID NO: 8, or different from SEQ ID NO: 8 at least one conservative amino acid substitution, said sequence with at least one conservative amino acid substitution being at least 90% identical in amino acid sequence to the unsubstituted sequence;p) przeciwciało lub jego część, które zawiera domenę VH jak pokazano w SEQ ID NO: 104, lub różniącą się od SEQ ID NO: 104 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją, i domenę VL jak pokazano w SEQ ID NO: 8, lub różniącą się od SEQ ID NO: 8 co najmniej jednym konserwatywnym podstawieniem aminokwasu, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstawieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją;11. The antibody or antigen binding portion according to claim 1, wherein the antibody or antigen binding portion comprises a heavy chain that utilizes a human VH 4-31, VH 3-11, VH 4-61 or VH 4-59 human germline sequence or in which at least one conservative amino acid substitution occurs in the human VH 4-31, VH 3-11, VH 4-61 or VH 4-59 sequence germ line, wherein the sequence with at least one conservative amino acid substitution is identical in amino acid sequence to at least 90% with the unsubstituted sequence. 11. Przeciwciało lub część wiążąca antygen według zastrzeżenia 1, które to przeciwciało lub część wiążąca antygen zawiera ciężki łańcuch, który wykorzystuje ludzką sekwencję VH 4-31, VH 3-11, VH 4-61 lub VH 4-59 z linii zarodkowej lub w którym co najmniej jedno konserwatywne postawienie aminokwasu zachodzi w ludzkiej sekwencji VH 4-31, VH 3-11, VH 4-61 lub VH 4-59 z linii zarodkowej, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstwieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją. 12. The antibody or antigen binding portion according to claim 1, wherein the antibody or antigen binding portion thereof comprises a light chain that utilizes a human V sequenceK A27, VK A2, VK B3 or VK L2 from a germline or in which at least one conservative amino acid substitution occurs in the human V sequenceK A27, VK A2, VK B3 or VK Germline L2, said sequence with at least one conservative amino acid substitution is identical in amino acid sequence to at least 90% with the unsubstituted sequence. 12. Przeciwciało lub część wiążąca antygen według zastrzeżenia 1, które to to przeciwciało lub jego część wiążąca antygen zawiera lekki łańcuch, który wykorzystuje ludzką sekwencję VK A27, VK A2, VK B3 lub VK L2 z linii zarodkowej lub w którym co najmniej jedno konserwatywne postawienie aminokwasu zachodzi w ludzkiej sekwencji VK A27, VK A2, VK B3 lub VK L2 z linii zarodkowej, przy czym ta sekwencja z co najmniej jednym konserwatywnym podstwieniem aminokwasu jest identyczna pod względem sekwencji aminokwasowej co najmniej w 90% z niepodstawioną sekwencją. 13. An antibody according to claim 1 or 2 which is or is derived from an IgG, IgM, IgE, IgA or IgD molecule. 13. Przeciwciało według zastrzeżnia 1 lub 2, które jest cząsteczką IgG, IgM, IgE, IgA lub IgD lub jest z nich uzyskane. 14. The antibody or antigen binding portion according to any one of claims 1 to 13, wherein the antibody or antigen binding portion is derivatized or linked to another molecule. 14. Przeciwciało lub część wiążąca antygen według któregokolwiek z zastrzeżeń 1 do 13, które to przeciwciało lub część wiążąca antygen są derywatyzowane lub połączone z inną cząsteczką. 15. The antibody or antigen binding portion according to claim 14, wherein said molecule is a peptide or protein. 15. Przeciwciało lub część wiążąca antygen według zastrzeżenia 14, gdzie ta cząsteczka jest peptydem lub białkiem. 16. An isolated nucleic acid molecule comprising nucleotide sequences: 16. Izolowana cząsteczka kwasu nukleinowego obejmująca sekwencje nukleotydowe: SEQ ID NO: 5 and 7;SEQ ID NO: 5 i 7;SEQ ID NO: 1 and 3;SEQ ID NO: 1 i 3;SEQ ID NO: 95 and 101;SEQ ID NO: 95 i 101;SEQ ID NO: 128 and 101;SEQ ID NO: 128 i 101;SEQ ID NO: 103 and 126;SEQ ID NO: 103 i 126;SEQ ID NO: 129 and 126;SEQ ID NO: 129 i 126;SEQ ID NO: 13 and 15;SEQ ID NO: 13 i 15;SEQ ID NO: 17 and 19;SEQ ID NO: 17 i 19;SEQ ID NO: 25 and 27;SEQ ID NO: 25 i 27;SEQ ID NO: 29 and 31;SEQ ID NO: 29 i 31;159 159 SEQ ID NO: 37 and 39;SEQ ID NO: 37 i 39;SEQ ID NO 45 and 47;SEQ ID NO 45 i 47;SEQ ID NO: 49 and 51;SEQ ID NO: 49 i 51;SEQ ID NO: 53 and 55;SEQ ID NO: 53 i 55;SEQ ID NO: 57 and 59;SEQ ID NO: 57 i 59;SEQ ID NO: 61 and 63;SEQ ID NO: 61 i 63;SEQ ID NO: 65 and 67 or SEQ ID NO: 69 and 71. SEQ ID NO: 65 i 67 lub SEQ ID NO: 69 i 71. 17. A vector comprising a nucleic acid molecule according to claim 16, wherein the vector comprises an expression control sequence operably linked to the nucleic acid molecule. 17. Wektor zawierający cząsteczkę kwasu nukleinowego według zastrzeżenia 16, który to wektor zawiera sekwencję kontrolną ekspresji funkcjonalnie połączoną z cząsteczką kwasu nukleinowego. 18. Host cell containing 18. Komórka gospodarz zawierająca a) a nucleotide sequence that encodes a heavy chain and a nucleotide sequence that encodes a light chain of an antibody or antigen binding portion according to any one of claims 1 to 15;a) sekwencję nukleotydową, która koduje ciężki łańcuch i sekwencję nukleotydową, która koduje lekki łańcuch przeciwciała lub części wiążącej antygen według któregokolwiek z zastrzeżeń 1 do 15;b) a nucleotide sequence that encodes both the heavy and light chains of the antibody or antigen binding portion according to any one of claims 1 to 15;or b) sekwencję nukleotydową, która koduje zarówno ciężki, jak i lekki łańcuch przeciwciała lub części wiążącej antygen według któregokolwiek z zastrzeżeń 1 do 15;lub c) a vector according to claim 17. c) wektor według zastrzeżenia 17. 19. Hybridoma deposited with ATCC under accession number PTA-6808. 19. Hybrydoma zdeponowana w ATCC pod numerem dostępu PTA-6808. 20. Przeciwciało wytworzone przez hybrydomę według zastrzeżenia 19 lub jego część wiążąca antygen. twenty. The antibody produced by the hybridoma of claim 19 or the antigen binding portion thereof. 21. A pharmaceutical composition comprising the antibody or antigen binding portion according to any one of claims 1 to 15 and a physiologically acceptable carrier. 21. Kompozycja farmaceutyczna zawierająca przeciwciało lub część wiążącą antygen według któregokolwiek z zastrzeżeń 1 do 15 i fizjologicznie dopuszczalny nośnik. 22. Use of the antibody or antigen binding portion according to any one of claims 1 to 15 or the pharmaceutical composition according to claim 21 for the manufacture of a medicament. 22. Zastosowanie przeciwciała lub części wiążącej antygen według któregokolwiek z zastrzeżeń 1 do 15 lub kompozycji farmaceutycznej według zastrzeżenia 21 do wytwarzania leku. 23. Use of the antibody or antigen binding portion according to any one of claims 1 to 15 or the pharmaceutical composition according to claim 21 for the manufacture of a medicament for the treatment of melanoma or cancer of the breast, head and neck, brain, cervix, prostate, pancreas or testicles in a mammal in need thereof. 23. Zastosowanie przeciwciała lub części wiążącej antygen według któregokolwiek z zastrzeżeń 1 do 15 lub kompozycji farmaceutycznej według zastrzeżenia 21 do wytwarzania leku do leczenia czerniaka lub raka piersi, głowy i szyi, mózgu, szyjki macicy, gruczołu krokowego, trzustki lub jąder u potrzebującego tego ssaka. 24. The antibody or antigen binding portion according to any one of claims 1 to 15 or the pharmaceutical composition according to claim 21 for use in the treatment of melanoma or cancer of the breast, head and neck, brain, cervix, prostate, pancreas or testicles in a mammal in need thereof. 24. Przeciwciało lub część wiążąca antygen według któregokolwiek z zastrzeżeń 1 do 15 lub kompozycja farmaceutyczna według zastrzeżenia 21 do stosowania w leczeniu czerniaka lub raka piersi, głowy i szyi, mózgu, szyjki macicy, gruczołu krokowego, trzustki lub jąder u potrzebującego tego ssaka. Authorized: Amgen Fremont Inc. Uprawnieni: Amgen Fremont Inc. Pfizer Inc. Pfizer Inc. Pełnomocnik: Proxy: MSc. Agnieszka Marszałek Patent Attorney mgr inż. Agnieszka Marszałek Rzecznik Patentowy 160 160 FIG. FIG. UJ UJ 161 161 FIG. 2 human MTLGSPRKGLLMLLMALVTGGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEG 60 FIG. 2 ludzka MTLGSPRKGLLMLLMALVTGGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEG 60 Cyno MTLGSPRRGLLMLLMALVTQGDPVKPSRGPLVTCTCESPKCRGPTCQGAWCTVVLVREEG 60 *******:*********************************:***#:************* ludzka RHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLA 120 Tin MTLGSPRRGLLMLLMALVTQGDPVKPSRGPLVTCTCESPKCRGPTCQGAWCTVVLVREEG 60 *******: ********************************** *** #: ************* Human RHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLA 120 Cyno RHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQLA 120 ***************************«********:**«*******.********.*** ludzka LILGPVLALLALVALGVLGLWHVRRRQEKQRGLHSELGESSLILKASEGGDTMLGDLLDS 180 Tin RHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQLA 120 *************************** «********: **« ******* . ********. *** human LILGPVLALLALVALGVLGLWHVRRRQEKQRGLHSELGESSLILKASEGGDTMLGDLLDS 180 Cyno LILGPVLALLALVALGVVGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDS 180 ***«*************:***************«*****************:******** ludzka DCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWF 240 Tin LILGPVLALLALVALGVVGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDS 180 *** «*************: ***************« ************* ****: ******** human DCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWF 240 Cyno DCTTGSGSGLPFLVGRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWF 240 o********************************************************** ludzka RETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLAL 300 Tin DCTTGSGSGLPFLVGRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWF 240 at *********************************************** ************ human RETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLAL 300 Cyno RETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLAL 300 ************************************************************ ludzka RLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLGLAVMHSQGSO 360 Tyn RETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLAL 300 *********************************************** ************* human RLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLGLAVMHSQGSO 360 Cyno RLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLGCCIADLGLAVMHSGGSD 360 ************************************************************ ludzka YLDIGNNPRVGTKRYMAPEVLDEOIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED 420 Tin RLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLGCCIADLGLAVMHSGGSD 360 *********************************************** ************* human YLDIGNNPRVGTKRYMAPEVLDEOIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED 420 Cyno YLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED 420 ************************************************************ ludzka YRPPFYDVVPNDPSFEDMKKVVCVDQGTPTIPNRLAADPVLSGLAGMMRECWYPNPSARL 480 Tin YLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED 420 *********************************************** ************* human YRPPFYDVVPNDPSFEDMKKVVCVDQGTPTIPNRLAADPVLSGLAGMMRECWYPNPSARL 480 Cyno YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAGMMRECWYPNPSARL 480 ************************************************************ ludzka TALRIKKTLQKISNSPEKPKVIQ 503 (SEO. ID NO.:130) Tin YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAGMMRECWYPNPSARL 480 ************************************************ ************* human TALRIKKTLQKISNSPEKPKVIQ 503 (SEO. ID NO.:130) Cyno TALRIKKTLQKISNSPEKPKVIQ 503 (SEQ. ID NO.:93) *********************** Tin TALRIKKTLQKISNSPEKPKVIQ 503 (SEQ. ID NO.:93) *********************** 162 162 163 163 164 164 165 165 166 166 FIG. 7Δ FIG. 7Δ 1.12.1 VH 1.12.1 VH Eksprymowana: 1 QVQLQESGPGLVKPSQTLSLTCTVSGGSMSSGEYYWWlRQHPGKGLEWIGYIYYSGSTY GO (SEQ ID NO: 104) Expressed: 1 QVQLQESGPGLVKPSQTLSLTCTVSGGSMSSGEYYWWlRQHPGKGLEWIGYIYYSGSTY GO (SEQ ID NO: 104) Germ line: 1 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTY GO (SEQ ID NO: 131) Linia zarodkowa: 1 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTY GO (SEQ ID NO: 131) Eksprymowana: 61 YNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARE-SVAG-FDYWGGGTLVTVSS 118 Expressed: 61 YNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARE-SVAG-FDYWGGGTLVTVSS 118 Germ line: G1 YNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGIAVAGYFDYWGQGTLVTVSS 120 Linia zarodkowa: G1 YNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGIAVAGYFDYWGQGTLVTVSS 120 1.12.1 VL 1.12.1 VL Eksprymowana: 1 EIVI_TQSPGTLSLSPGERDTLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSSRATGIP GO (SEQ ID NO: 127) Expressed: 1 EIVI_TQSPGTLSLSPGERDTLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGTSSRATGIP GO (SEQ ID NO: 127) Germ line: 1 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIP GO Linia zarodkowa: 1 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIP GO ISEO ID NO: 132) ' ISEO ID NO:132) ’ Eksprymowana: 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPITFGQGTRLEIK 108 Expressed: 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPITFGQGTRLEIK 108 Germ line: 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPITFGQGTRLEIK 108 Linia zarodkowa: 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPITFGQGTRLEIK 108 167 167 FIG. 7B ίο FIG. 7B ίο -L- -ł— -ι1.12.1 VL ISEO ID 127) -ι1.12.1 VL ISEO ID 127) 1.14.1 VL (SEQ ID 20) 1.14.1 VL (SEQ ID 20) 1.162.1 VL ISEG ID 28 » 1.162.1 VL ISEG ID 28» 1.31.1 VL ISEO ID 135) 1.31.1 VL ISEO ID 135) Ι EIVLTQSPGTLSLSPGERDTLSCRASQSVS 1 EIVLTQSPGTLSLSPGE RATLSCRASQSVS 1 EIVLTGSPGTLSLSPGERATLSCRASQSVS 1 EIVLTQSPGTLSLSPGERSLSQSSSLSLSLSQSSLSLSLSQS Ι EIVLTQSPGTLSLSPGERDTLSCRASQSVS 1 EIVLTQSPGTLSLSPGERATLSCRASQSVS 1 EIVLTGSPGTLSLSPGERATLSCRASQSVS 1 EIVLTQSPGTLSLSPGERATLSCRASQSVS 1 ESVLTQSPGTLSLSPGERATLSCRASQSVS 4.G2.1 VI ISED ID 60) EIVLTQSPGTLSLSPGERATLSCRASGSVS 4.72.1 VL (SEQ ID 68) EIVLTQSPGTLSLSPGERATLSCRASGSVS 4.72.1 VL (SEQ ID 68) EIVLTQSPGTLSLSPGERATLSC R A S Q S V S Linia zarodkowa IA27) ISEO ID NO: 133) EIVLTQSPGTLSLSPGERATLSC RASQSVS Germ line IA27) ISEO ID NO: 133) -431 SSYLAWY0QKPGQAPRLLIYGTSSRA7GIP 1.12.1 VL 31 STYLAWHGOKPGGAPRLLIYGVSSRASGVP 1.14.1 VL 31SSYLAWYQ0KPGQAPRLLIYGASSRATGIP 1.162.1 VL 31SSYLAWYQGKPGQAPRLLIYGASSRATGIP 1.31.1 VL 31 SSYLAWYQGKPGQAPRLLIYGVSSRAIGIP 4.62.1 VL 31SSYLAWYQRKPGGAPRLLIYGVSSRATGIP 4.72.1 VL 31 SSYLAWYQOKPGQAPRLLIY G A S S R A I G I P Linia zarodkowa IA27) -431 SSYLAWY0QKPGQAPRLLIYGTSSRA7GIP VL 31 STYLAWHGOKPGGAPRLLIYGVSSRASGVP 1.12.1 1.14.1 1.162.1 31SSYLAWYQ0KPGQAPRLLIYGASSRATGIP VL VL VL 31 31SSYLAWYQGKPGQAPRLLIYGASSRATGIP SSYLAWYQGKPGQAPRLLIYGVSSRAIGIP 1.31.1 4.62.1 4.72.1 31SSYLAWYQRKPGGAPRLLIYGVSSRATGIP VL VL 31 SSYLAWYQOKPGQAPRLLIY GASSRAIGIP Line embryonic IA27) -4-70 -4-70 61DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ 1.12.1 1.14.1 ORFSGSGSGTDFTLTISRLEPEDFAVYYCQ 61 VL VL VL 61 DRFSGSGSGTDFTLTIIRLDPEDFAVYYCQ 1.162.1 1.31.1 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ VL VL 4.62.1 4.72.1 61DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ germ line VL G1DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ IA27) 61DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ 1.12.1 VL 61 ORFSGSGSGTDFTLTISRLEPEDFAVYYCQ 1.14.1 VL 61 DRFSGSGSGTDFTLTIIRLDPEDFAVYYCQ 1.162.1 VL 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ 1.31.1 VL 61 DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ 4.62.1 VL 61DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ 4.72.1 VL G1DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ Linia zarodkowa IA27) 100 100 OYGSSPITFGDGTRLEIK 91 OYGSSPITFGDGTRLEIK 91 RYGSSPITFGGGTRLEIK 91 KFGSSPITFGGGTRLEIK 91 OYGSSPITFGOGTRLEIK 91 GYGSSMITFGOGTRLEIK 91 0 Y G S S P OYGSSPITFGDGTRLEIK 91 OYGSSPITFGDGTRLEIK 91 RYGSSPITFGGGTRLEIK 91 KFGSSPITFGGGTRLEIK 91 OYGSSPITFGOGTRLEIK 91 GYGSSMITFGOGTRLEIK 91 0 YGSSP 1.12.1 VL 1.12.1 VL 1.14.1 VL 1.14.1 VL 1.162.1 VL 1.162.1 VL 1.31.1 VL 1.31.1 VL 4.62.1 VL 4.62.1 VL 4.72.1 VL 4.72.1 VL Germ line IA27) Linia zarodkowa IA27) 168 168 FIG. 7C and FIG. 7C i 20 30 20 30 QVQLGESGPGLVKPSQTLSLTCTVSGGSMS QVQLOESGPGLVKPSGTLSLTCTVSGGSIS QVQLGESGPGLVKPSQTLSLICTVSGGSIS QMQLGESGPGLVKPSQTLSLTCTVSGGSIS aVQLQESGPGLVKPSQTLSLTCTVSGGSIS QVOLQESGPGLVKPSQTLSLTCTVSGGSIS QVQLQESGPGLVKPSQTLSLTCTVSGGSIS GVQLQESGPGLVKPSQTLSLTCTVSGGSIS OVQLOESGPGLVKPSGTLSLTCTVSGGSIS QVQLGESGPGLVKPSQTLSLTCTVSGGSIS QVQLQES6PGLVKPSQTLSLTCTVSGGSIS QVQLGES6PGLVKPSQTLSLTCTVSGGSIS QVGL0ESGPGLVKPSQTLSLTCTVSGGSIS QVQLGESGPGLVKPSQTLSLTCTVSGGSMS QVQLOESGPGLVKPSGTLSLTCTVSGGSIS QVQLGESGPGLVKPSQTLSLICTVSGGSIS QMQLGESGPGLVKPSQTLSLTCTVSGGSIS aVQLQESGPGLVKPSQTLSLTCTVSGGSIS QVOLQESGPGLVKPSQTLSLTCTVSGGSIS QVQLQESGPGLVKPSQTLSLTCTVSGGSIS GVQLQESGPGLVKPSQTLSLTCTVSGGSIS OVQLOESGPGLVKPSGTLSLTCTVSGGSIS QVQLGESGPGLVKPSQTLSLTCTVSGGSIS QVQLQES6PGLVKPSQTLSLTCTVSGGSIS QVQLGES6PGLVKPSQTLSLTCTVSGGSIS QVGL0ESGPGLVKPSQTLSLTCTVSGGSIS -................. + + ................... ........... . -... ... t40 50 GO -.................+...................+............-......t40 50 GO SGEYYWNWIROHPGKGLEWIGYIYYSGSTY SGGHYWSWIRGHPGKGLEWIGYIYYSGSTY SGEYYWSWIROHPGKGLEWIGYIYYSGSTY SGGHYWSWIROHPGKGLEWIGYIYYSGSAY SNDYYWNWIRQHPGKGLEWIGYIYYSGSTY SGDYYWSWIRGKPGKGLEWIGYIYYSGSTY SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGDYYWNWIRGHPGKGLEWIGYIYYSGSTY SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGEYYWSWIRGHPGKGLEWIGYIFYSGSI Y SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGGYYWSWIROHPGKGLEWIGYIYYSGSTY SGEYYWNWIROHPGKGLEWIGYIYYSGSTY SGGHYWSWIRGHPGKGLEWIGYIYYSGSTY SGEYYWSWIROHPGKGLEWIGYIYYSGSTY SGGHYWSWIROHPGKGLEWIGYIYYSGSAY SNDYYWNWIRQHPGKGLEWIGYIYYSGSTY SGDYYWSWIRGKPGKGLEWIGYIYYSGSTY SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGDYYWNWIRGHPGKGLEWIGYIYYSGSTY SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGEYYWSWIRGHPGKGLEWIGYIFYSGSI Y SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGDYYWNWIROHPGKGLEWIGYIYYSGSTY SGGYYWSWIROHPGKGLEWIGYIYYSGSTY 1.12.1 VH (SEQ ID 104) 1.12.1 VH (SEQ ID 104) 1.151.1 VH (SEG ID 22) 1.151.1 VH (SEG ID 22) 1.162.1 VH (SEG ID 2G) 1.162.1 VH (SEG ID 2G) 1.8.1 VH (SEO ID 34) 1.8.1 VH (SEO ID 34) 4.24.1 VH (SEO ID 4G) 4.24.1 VH (SEO ID 4G) 4.38.1 VH (SEO ID 50) 4.38.1 VH (SEO ID 50) 4.58.1 VH (SEO ID 54) 4.58.1 VH (SEO ID 54) 4.G2.1 VH (SEG 10 58) 4.G2.1 VH (SEG 10 58) 4.68.1 VH (SEO ID G2) 4.68.1 VH (SEO ID G2) 4.72.1 VH (SEO ID GG) 4.72.1 VH (SEO ID GG) 5.13.1 VH (SEG ID 70) 5.13.1 VH (SEG ID 70) 5.34.1 VH (SEO ID 74) 5.34.1 VH (SEO ID 74) 4-31 Germ line (SEQ ID NO: 134) 4-31 Linia zarodkowa (SEQ ID NO: 134) 1.12.1 VH 1.12.1 VH 1.151.1 VH 1.151.1 VH 1.162.1 VH 1.162.1 VH 1.8.1 VH 1.8.1 VH 4.24.1 VH 4.24.1 VH 4.38.1 VH 4.38.1 VH 4.58.1 VH 4.G2.1 VH 4.G8.1 VH 4.58.1 VH 4.G2.1 VH 4.G8.1 VH 4.72.1 VH 4.72.1 VH 5.13.1 VH 5.13.1 VH 5.34.1 VH 5.34.1 VH 4-31 Germ line 4-31 Linia zarodkowa 169 169 FIG. 7D FIG. 7D -+-70 -+-70 Gl Y N P S L K S R V T I S VDT S K N Q F S L K l S S V T A A Gi Y N P S L K S R V TIS VDT S K N Q F S L K L S S V T A A Gl YNPSLKSRLTISVDTSKNQFSLKLSSVTAA Gl YNPSLKSRVTISVDTSKNQFSLKLSSVTAA •61 YNPSLKSRVTISVDTSKNQFSLKLSSVTAA 61 Y N P S L K S R V ΐ I S I O T S K N Q F S L K L S S V T A A Gl YNPSLKSRVTISVATSKNQFSLKLSSVTAA Gl YNPSLKSRVTISVOTSKNQFSLKLSSVTAA Gl Y N P $ L K S R V T I S V 0 T $ K N O F S L K L S S V T A A Gl Y N P S L K S R V TI S L D T S K N Q F S L K L S S V T A A Gl Y N P S L K S R V TI S V O T S K N Q F S L K L S S V T A A Gl Y N S S L K S R V T I S V O T S K N Q F S L K L S S V T A A Gl Y N P S L K S R V TI S V O T S K N Q F S L K L S S V T A A Gl YNPSLKSRVTIS VDT SKNQFSLK l SSVTAA Gi YNPSLKSRV TIS VDT SKNQFSLKLSSVTAA Gl Gl YNPSLKSRLTISVDTSKNQFSLKLSSVTAA YNPSLKSRVTISVDTSKNQFSLKLSSVTAA • 61 61 YNPSLKSRVTISVDTSKNQFSLKLSSVTAA YNPSLKSRV ΐ ISIOTSKNQFSLKLSSVTAA YNPSLKSRVTISVATSKNQFSLKLSSVTAA Gl Gl Gl YNPSLKSRVTISVOTSKNQFSLKLSSVTAA YNP LKSRVTISV 0 $ T $ KNOFSLKLSSVTAA YNPSLKSRV gl gl TI SLDTSKNQFSLKLSSVTAA YNPSLKSRV TI SVOTSKNQFSLKLSSVTAA Gl YNSSLKSRVTISVOTSKNQFS LKLSSVTAA Gl YNPSLKSRV TI SVOTSKNQFSLKLSSVTAA 1.12.1 VH 1.12.1 VH 1.151.1 VH 1.151.1 VH 1.162.1 VH 1.0.1 VH 1.162.1 VH 1.0.1 VH 4.24.1 VH 4.24.1 VH 4.38.1 VH 4.38.1 VH 4.58.1 VH 4.58.1 VH 4.62.1 VH 4.G8.1 VH 4.62.1 VH 4.G8.1 VH 4.72.1 VH 4.72.1 VH 5.13.1 VH 5.13.1 VH 5.34.1 VH 5.34.1 VH 4-31 Germ line 4-31 Linia zarodkowa 170 170 FIG. θ FIG. θ FIG. 9A FIG. 9B FIG. 9A FIG. 9B 171 171 FIG. 10 FIG. 10 172 172 FIG. 12 FIG. 12 X co X co C \ J co C\J co Ι_ι_Τ Ι_ι_Τ ABOUT O Q_ o Q_ o § g § g £ CJ> rU CJ> rU I I to r^j II is r ^ j Q hxj - * O o> Q hxj —* O o> L cn cn ł cn cn CU CU ABOUT O Q ± Q± 173 173 FIG. 13 FIG. 13 FIG. 14 FIG. 14 174 174 175 175 DOCUMENTS CITED IN THE DESCRIPTION DOKUMENTY CYTOWANE W OPISIE Ta lista dokumentów cytowanych przez Zgłaszającego została przyjęta jedynie dla informacji czytającego i nie jest częścią europejskiego opisu patentowego. Została ona utworzona z dużą starannością;Europejski Urząd Patentowy nie ponosi jednak żadnej odpowiedzialności za ewentualne błędy i braki. This list of documents cited by the Applicant was accepted only for the information of the reader and is not part of the European patent specification. It was created with great care;However, the European Patent Office shall not be liable for any errors or omissions. Dokumenty patentowe cytowane w opisie • US 6316217 B [0002] • US 8318217 B [0002] • US 6692925 B [0008] • WO 0348731 A [0116] • US 5151510 A [0121] • US 5916771 A [0177] • US 5939598 A [0177] • US 5985615 A [0177] • US 5998209 A [0177] • US 6075181 A [0177] • US 6091001 A [0177] • US 6114598 A [0177] • US 6130364 A [0177] • US 6162963 A [0177] • US 6150584 A [0177] • WO 9110741 A [0177] • WO 9402602 A [0177] • WO 9634096 A [0177] • WO 9633735 A [0177] • WO 9816654 A [0177] • WO 9824893 A [0177] [0179] • WO 9850433 A [0177] • WO 9945031 A [0177] • WO 9953049 A [0177] • WO 0009560 A [0177] [0230] • WO 00037504 A [0177] • US 5994619 A [0178] [0182] • US 5545807 A [0180] • US 5545806 A [0180] • US 5589825 A [0180] • US 5625126 A [0180] • US 5633425 A [0180] • US 5661016 A [0180] • US 5770429 A [0180] • US 5789650 A [0180] • US 5814318 A [0180] • US 5591669 A [0180] • US 5612205 A [0180] • US 5721367 A [0180] • US 5789215 A [0180] • US 5643763 A [0180] • WO 0037504 A [0184] • US 5168062 A [0215] • US 4510245 A [0215] • US 4968615 A [0215] • US 6517529 B [0215] • US 4399216 A [0216] [0217] • US 4634665 A [0216] • US 5179017 A [0216] • US 4912040 A [0217] • US 4740461 A [0217] • US 4959455 A [0217] • EP 0216846 A [0219] • EP 0256055 A [0219] • EP 0323997 A [0219] • EP 0338841 A [0219] • US 5827690 A [0221] • US 6756687 B [0221] • US 5750172 A [0221] • US 5741957 A [0221] • US 6046037 A [0221] • US 5959177 A [0221] • US 6417429 B [0222] • US 5223409 A [0224] • WO 9218619 A [0224] • WO 9117271 A [0224] • WO 9220791 A [0224] • WO 925679 A [0224] • WO 9301288 A [0224] • WO 9201047 A [0224] [0225] • WO 9209690 A [0224] • WO 93108213 A [0225] • WO 9852976 A [0228] • WO 0034317 A [0228] • US 6573293 B [0277] • US 6534524 B [0279] [0280] • US 6235764 B [0279] • WO 9924440 A [0280] • WO 1999062890 A [0280] • WO 9521813 A [0280] • WO 9961422 A [0280] • US 5834504 A [0280] • WO 9850358 A [0280] • US 5883113 A [0280] • US 5886020 A [0280] • US 5792783 A [0280] • US 6653308 B [0280] • WO 9910349 A [0280] • WO 9732856 A [0280] • WO 9722596 A [0280] • WO 9854093 A [0280] • WO 9802438 A [0280] • WO 9916755 A [0280] • WO 9802437 A [0280] [0304] • US 6080769 A [0281] • US 6194438 B [0281] • US 6495564 B [0281] • US 6586447 B [0281] Patent documents cited in the description • US 6316217 B [0002] • US 8318217 B [0002] • US 6692925 B [0008] • WO 0348731 A [0116] • US 5151510 A [0121] • US 5916771 A [0177] • US 5939598 A [0177] • US 5985615 A ​​[0177] • US 5998209 A [0177] • US 6075181 A [0177] • US 6091001 A [0177] • US 6114598 A [0177] • US 6130364 A [0177] • US 6162963 A [0177] • US 6150584 A [0177] • WO 9110741 A [0177] • WO 9402602 A [0177] • WO 9634096 A [0177] • WO 9633735 A [0177] • WO 9816654 A [0177] • WO 9824893 A [ 0177] [0179] • WO 9850433 A [0177] • WO 9945031 A [0177] • WO 9953049 A [0177] • WO 0009560 A [0177] [0230] • WO 00037504 A [0177] • US 5994619 A [0178] ] • US 5545807 A [0180] • US 5545806 A [0180] • US 5589825 A [0180] • US 5625126 A [0180] • US 5633425 A [0180] • US 5661016 A [0180] • US 5770429 A [0180] • US 5789650 A [0180] • US 5814318 A [0180] • US 5591669 A [0180] • US 5612205 A [0180] • US 5721367 A [0180] • US 5789215 A [0180] • US 5643763 A [0180] • WO 0037504 A [0184] • US 5168062 A [0215] • US 4510245 A [0215] • US 4968615 A ​​[0215] • US 6517529 B [0215] • US 4399216 A [0216] [0217] • US 4634665 A [0216] • US 5179017 A [0216] • US 4912040 A [0217] • US 4740461 A [0217] • US 4959455 A [0217] • EP 0216846 A [0219] • EP 0256055 A [0219] • EP 0323997 A [0219] • EP 0338841 A [0219] • US 5827690 A [0221] • US 6756687 B [0221] • US 5750172 A [0221] • US 5741957 A [0221] • US 6046037 A [0221] • US 5959177 A [0221] • US 6417429 B [0222] • US 5223409 A [0224] • WO 9218619 A [0224] • WO 9117271 A [0224] • WO 9220791 A [0224] • WO 925679 A [0224] • WO 9301288 A [0224] • WO 9201047 A [0224] [0225] • WO 9209690 A [0224] • WO 93108213 A [0225] ] • WO 9852976 A [0228] • WO 0034317 A [0228] • US 6573293 B [0277] • US 6534524 B [0279] [0280] • US 6235764 B [0279] • WO 9924440 A [0280] • WO 1999062890 A [0280] • WO 9521813 A [0280] • WO 9961422 A [0280] • US 5834504 A [0280] • WO 9850358 A [0280] • US 5883113 A [0280] • US 5886020 A [0280] • US 5792783 A [ 0280] • US 6653308 B [0280] • WO 9910349 A [0280] • WO 9732856 A [0280] • WO 9722596 A [0280] • WO 9854093 A [0280] • WO 9802438 A [0280] • WO 9916755 A [0280] • WO 9802437 A [0280] [ 0304] • US 6080769 A [0281] • US 6194438 B [0281] • US 6495564 B [0281] • US 6586447 B [0281] 176 • US 6074935 A [0281] • US 6150477 A [0281] • WO 0140217 A [0282] • WO 2004020431 A [0282] • US 5608082 A [0283] • US 20050148627 A [0284] • US 20050148777 A [0284] • US 5466823 A [0285] • US 5633272 A [0286] • US 5932598 A [0287] • US 5521207 A [0288] • US 6034256 A [0289] • WO 200224719 A [0290] • WO 199803484 A [0292] • WO 199911605 A [0293] • US 6180651 B [0294] • WO 9802434 A [0304] • WO 9935146 A [0304] • WO 9935132 A [0304] • WO 9713760 A [0304] • WO 9519970 A [0304] • US 5587458 AND [0304] • US 5877305 A [0304] • US 6465449 B [0304] • US 8284764 B [0304] • WO 200198277 A [0304] • EP 239362 A [0317] • US 6682736 B [0329] • US 601113647 B [ 0329] • WO 2002053596 A [0330] • WO 2003040170 A [0331] • US 5679666 A [0338] • US 5770592 A [0338] • US 60715292 B [0428] 176 • US 6074935 A [0281] • US 6150477 A [0281] • WO 0140217 A [0282] • WO 2004020431 A [0282] • US 5608082 A [0283] • US 20050148627 A [0284] • US 20050148777 A [0284] • US 5466823 A [0285] • US 5633272 A [0286] • US 5932598 A [0287] • US 5521207 A [0288] • US 6034256 A [0289] • WO 200224719 A [0290] • WO 199803484 A [0292] • WO 199911605 A [0293] • US 6180651 B [0294] • WO 9802434 A [0304] • WO 9935146 A [0304] • WO 9935132 A [0304] • WO 9713760 A [0304] • WO 9519970 A [0304] • US 5587458 A [0304] • US 5877305 A [0304] • US 6465449 B [0304] • US 8284764 B [0304] • WO 200198277 A [0304] • EP 239362 A [0317] • US 6682736 B [0329] • US 601113647 B [0329] • WO 2002053596 A [0330] • WO 2003040170 A [0331] • US 5679666 A [0338] • US 5770592 A [0338] • US 60715292 B [0428] Dokumenty niepatentowe cytowane w opisie • ATTISANO i in. Cell, 1993, tom. 75, 671-680 [0002] • TEN DIJKE i in. Oncogene, 1993, tom. 8, 28792887 [0002] • HELDIN i in. Nature, 1997, tom. 390, 485-471 [0003] • ABDALLA i in. J. Med. Genet, 2003, tom. 40, 494-502 [0004] • SADICK i in. Hematologica/The Hematology J., 2005, tom. 90, 818-828 [0004] • OH i in. Proc NatI Acad Sci U S A, 2000, tom. 97, 2626-2631 [0004] • URNESS i in. Nature Genetics, 2000, tom. 26, 328-331 [0004] • HANAHAN;FOLKMAN. Patterns and Emerging Mechanisms of the Angiogenic Switch During Tumorigenesis. Cell, 1996, tom. 86 (3), 353-364 [0005] • CARMELIET. Angiogenesis in Health and Disease. Nature Medicine, 2003, tom. 9 (6), 653-660 [0005] • BERGERS;BENJAMIN. Tumoreigenesis and the Angiogenic Switch. Nature Reviews, 2003, tom. 3, 401-410 [0005] • BONNET i in. Osteoarthritis, Angiogenesis and Inflammation. Rheumatology, 2005, tom. 44, 7-16 [0006] • CREAMER i in. Angiogenesis in psoriasis. Angiogenesis, 2002, tom. 5, 231-236 [0006] • CLAVEL i in. Recent data on the role for angiogenesis in rheumatoid arthritis. Joint Bone Spine, 2003, tom 70, 321-326 [0006] • ANANDARAJAH i in. Pathogenesis of psoriatic arthritis. Curr. Opin. Rheumatol., 2004, tom 16, 338-343 [0006] • NG i in. Targeting angiogenesis, the underlying disorder in neovascular age-related macular degeneration. Can. J. Ophthalmol., 2005, tom. 40, 352368 [0006] • WITMER i in. Vascular endothelial growth factors and angiogenesis in eye disease. Progress in Retinal & Eye Research, 2003, tom. 22, 1-29 [0006] • ADAMIS i in. Angiogenesis and ophthalmic disease. Angiogenesis, 1999, tom. 3, 9-14 [0006] • LUX i in. J. Biol. Chem., 1999, tom. 274, 99849992 [0008] • ABDALLA i in. Human Mol. Gen., 2000, tom. 9, 1227-1237 [0008] • SAMBROOK J.;RUSSELL D. Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, 2000 [0067] [0207] • AUSUBEL i in. Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology. Wiley, John Sons, Ina, 2002 [0067] • HARLOW;LANE. Using Antibodies: A Laboratory Manual. Cold Spring Harbor Laboratory Press, 1998 [0067] • COLIGAN i in. Short Protocols in Protein Science. Wiley, John & Sons, Inc, 2003 [0067] • FERNANDEZ-L i in. Cardiovascular Research, 5 lipca 2005, tom. 68 (2), 235-248 [0067] • TOMPERT, OLGA V. i in. Id1 regulates angiogenesis through transcriptional repression of thrombospondin-1. Cancer Cell, grudzień 2002, tom. 2, 473-483 [0076] • Immunology-A Synthesis. Sinauer Associates, 1991 [0083] • PEARSON. Methods Mol. Biol., 1994, tom. 243, 307-31 [0084] • GONNET i in. Science, 1992, tom. 258, 1443-45 [0086] • Proteins. Structures and Molecular Principles. W. H. Freeman and Company, 1984 [0087] • Introduction to Protein Structure. Garland Publishing, 1991 [0087] Non-patent documents cited in the description • ATTISANO et al. Cell, 1993, vol. 75, 671-680 [0002] • TEN DIJKE et al. Oncogene, 1993, vol. 8, 28792887 [0002] • HELDIN et al. Nature, 1997, vol. 390, 485-471 [0003] • ABDALLA et al. J. Med. Genet, 2003, vol. 40, 494-502 [0004] SADICK et al. Hematologica / The Hematology J., 2005, vol. 90, 818-828 [0004] • OH et al. Proc NatI Acad Sci USA, 2000, vol. 97, 2626-2631 [0004] • URNESS et al. Nature Genetics, 2000, vol. 26, 328-331 [0004] HANAHAN;Folkman. Patterns and Emerging Mechanisms of the Angiogenic Switch During Tumorigenesis. Cell, 1996, vol. 86 (3), 353-364 [0005] • CARMELIET. Angiogenesis in Health and Disease. Nature Medicine, 2003, vol. 9 (6), 653-660 [0005] BERGERS;BENJAMIN. Tumoreigenesis and the Angiogenic Switch. Nature Reviews, 2003, vol. 3, 401-410 [0005] • BONNET et al. Osteoarthritis, Angiogenesis and Inflammation. Rheumatology, 2005, vol. 44, 7-16 [0006] • CREAMER et al. Angiogenesis in psoriasis. Angiogenesis, 2002, vol. 5, 231-236 [0006] • CLAVEL et al. Recent data on the role for angiogenesis in rheumatoid arthritis. Joint Bone Spine, 2003, vol. 70, 321-326 [0006] • ANANDARAJAH et al. Pathogenesis of psoriatic arthritis. Curr. Opin. Rheumatol., 2004, vol. 16, 338-343 [0006] NG et al. Targeting angiogenesis, the underlying disorder in neovascular age-related macular degeneration. Can. J. Ophthalmol., 2005, vol. 40, 352368 [0006] • WITMER et al. Vascular endothelial growth factors and angiogenesis in eye disease. Progress in Retinal & Eye Research, 2003, vol. 22, 1-29 [0006] • ADAMIS et al. Angiogenesis and ophthalmic disease. Angiogenesis, 1999, vol. 3, 9-14 [0006] • LUX et al. J. Biol. Chem., 1999, vol. 274,99849992 [0008] • ABDALLA et al. Human mol. Gen., 2000, vol. 9, 1227-1237 [0008] • SAMBROOK J .;RUSSELL D. Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, 2000 [0067] [0207] • AUSUBEL et al. Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology. Wiley, John Sons, Ina, 2002 [0067] HARLOW;LANE. Using Antibodies: A Laboratory Manual. Cold Spring Harbor Laboratory Press, 1998 [0067] COLIGAN et al. Short Protocols in Protein Science. Wiley, John & Sons, Inc, 2003 [0067] • FERNANDEZ-L et al. Cardiovascular Research, July 5, 2005, vol. 68 (2), 235-248 [0067] • TOMPERT, OLGA V. et al. Id1 regulates angiogenesis through transcriptional repression of thrombospondin-1. Cancer Cell, December 2002, vol. 2,473-483 [0076] Immunology-A Synthesis. Sinauer Associates, 1991 [0083] • PEARSON. Methods Mol. Biol., 1994, vol. 243, 307-31 [0084] • GONNET et al. Science, 1992, vol. 258, 1443-45 [0086] • Proteins. Structures and Molecular Principles. WH Freeman and Company, 1984 [0087] Introduction to Protein Structure. Garland Publishing, 1991 [0087] 177 • SONGSIVILAI;Lachmann. Clin. Exp. Immunol., 1990, vol. 79, 315-321 [0235] • KOSTELNY et al. J. Immunol., 1992, volume 148, 177 • SONGSIVILAI;LACHMANN. Clin. Exp. Immunol., 1990, tom 79, 315-321 [0235] • KOSTELNY i in. J. Immunol., 1992, tom 148, 1547-1553 [0235] • Sustained and Controlled Release Drug Delivery 1547-1553 [0235] • Sustained and Controlled Release Drug Delivery Systems. Marcel Dekker, Inc, 1978 [0246] • Remington's Pharmaceutical Sciences. Williams & Systems. Marcel Dekker, Inc, 1978 [0246] • Remington's Pharmaceutical Sciences. Williams & Wilkins, 1995 [0351] • TOMLINSON et al. J. Mol. Biol., 1992, volume 227, Wilkins, 1995 [0351] • TOMLINSON i in. J. Mol. Biol., 1992, tom 227, 776-798 [0388] • Hum. Mol. Genet., 1994, tom 3, 853-860 [0388] • EMBO J., 1995, tom 14, 4628-4638 [0388] • H-C YAN i in. Human/Severe Combined Immunodeficient Mouse Chimeras, An Experimental In Vivo Model System to Study the Regulation of Human Endothelial Cell-Leukocyte Adhesion Molecules. J. Clin. Invest, 1993, tom 91, 986 [0417] • J. VAMER. Regulation of Angiogenesis in Vivo by Ligation of Integrin a5b1 with the Central Cell-Binding Domain of Fibronectin. Amer. J. Path., 2000, tom 156 (4), 1345 [0417] • K. TAHTIS i in. Expression and Targeting of 776-798 [0388] • Hum. Moth. Genet., 1994, volume 3, 853-860 [0388] • EMBO J., 1995, volume 14, 4628-4638 [0388] • HC YAN et al. Human / Severe Combined Immunodeficient Mouse Chimeras, An Experimental In Vivo Model System to Study the Regulation of Human Endothelial Cell-Leukocyte Adhesion Molecules. J. Clin. Invest, 1993, vol. 91, 986 [0417] • J. VAMER. Regulation of Angiogenesis in Vivo by Ligation of Integrin a5b1 with the Central Cell-Binding Domain of Fibronectin. Amer. J. Path., 2000, vol. 156 (4), 1345 [0417] • K. TAHTIS et al. Expression and Targeting of Human Fibroblast Activation Protein in a Human Skin / Severe Combined Immunodeficient Mouse Breast Cancer Xenograft Model. Moth. Cancer. Ther., 2003, volume 2 (8), 729 [0417] • TAHTIS et al. Expression and Targeting of Human Fibroblast Activation Protein in a Human Skin / Severe Combined Immunodeficient Mouse Breast Cancer Xenograft Model. Moth. Cancer. Ther., 2003, volume 2 (8), 729 [0417] • MUELLER. Tissue factor-initiated thrombin generation activates the signaling thrombin receptor on malignant melanoma cells. Cancer Research, 1995, vol. 55 (8), 1629-32 [0419] Human Fibroblast Activation Protein in a Human Skin/Severe Combined Immunodeficient Mouse Breast Cancer Xenograft Model. Mol. Cancer. Ther., 2003, tom 2 (8), 729 [0417] • TAHTIS i in. Expression and Targeting of Human Fibroblast Activation Protein in a Human Skin/Severe Combined Immunodeficient Mouse Breast Cancer Xenograft Model. Mol. Cancer. Ther., 2003, tom 2 (8), 729 [0417] • MUELLER. Tissue factor-initiated thrombin generation activates the signaling thrombin receptor on malignant melanoma cells. Cancer Research, 1995, tom. 55 (8), 1629-32 [0419]