Nova Patents
IL293286A

Vegf mini-traps and method of use thereof

Abstract

This record has no abstract on file.

IL293286A, drawing sheet 1
Sheet 1 of 52

Term

No projected expiry on record.

  1. Priority
  2. Filed
  3. Published
  4. Today

6 claims: 4 independent, 2 dependent

  1. 1
    An isolated VEGF mini-trap comprising the following domain structure:((R1D2)-(R2D3))a־(MC)c;wherein one or more histidines of said VEGF mini-trap are oxidized to 2-oxohistidine, and/or one or more tryptophans are dioxidated, and/or one or more asparagines thereof are glycosylated, or, ((R1 D2)-(R2D3)-(R2D4))a-(MC)b, ((R1 D2)-(R2D3))c-linker-((R1 D2)-(R2D3))d;or ((R1 D2)-(R2D3)-(R2D4))e-linker-((R1 D2)-(R2D3)-(R2D4))f;wherein, R1D2 is the VEGFR1 Ig domain 2;R2D3 is the VEGFR2 Ig domain 3;R2D4 is the VEGFR2 Ig domain 4;MG is a multimerizing component which is a fragment of an immunoglobulin hinge region or a polypeptide consisting of the amino acid sequence: DKTHTCPPC (SEQ ID NO: 22), DKTHTCPPCPPC (SEQ ID NO: 23), DKTHTCPPCPPCPPC (SEQ ID NO: 24), DKTHTC(PPC)h (SEQ ID NO: 25), wherein h is 1, 2, 3, 4, or 5, DKTHTCPPCPAPELLG (SEQ ID NO: 6), DKTHTCPLCPAPELLG (SEQ ID NO: 7), DKTHTC (SEQ ID NO: 8) or DKTHTCPLCPAP (SEQ ID NO: 9) and linker is a peptide comprising about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 amino acids;and, independently, a= 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15;b=1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15;c=1, 2, 3, 4, 5, 6, 7, 8,9, 10, 11, 12, 13, 14 or 15;d=1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15;e=1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15;and f=1,2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15;or a composition thereof. 160 2. The VEGF mini-trap or composition thereof of claim 1 selected from (i) (R1D2)1-(R2D3)1-(MC)1;and (ii) (R1 D2)1-(R2D3)1-(R2D4)1-(MC)1. 3. A VEGF mini-trap or composition thereof comprising an amino acid sequence set forth in a member selected from the group consisting of: SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDK THTCPPCPAPELLG (SEQ ID NO: 12);GRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYK EIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYP SSKHQHKKLVNRDLKT QSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHENLSVAFGSGMESLVEATVGERV RIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVV YVPPGPGDKTHTCPLCPAPELLG (SEQ ID NO: 13);SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDK THTCPPC (SEQ ID NO: 26);SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDK THTCPPCPPC (SEQ ID NO: 27);SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDK THTCPPCPPCPPC (SEQ ID NO: 28);SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDK THTC-(PPC)x (SEQ ID NO: 29;wherein x is 1,2, 3, 4 or 5);161 SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKGG GGS GGGGS GGGGS GGGGS GGGGS GGGGS S DT GR P FVEMY S EIPE11HMTE GRE LVIPCRVT S PNITVT L KKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSH GIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSD QGLYTCAASSGLMTKKNSTFVRVHEK (SEQ ID NO: 10);SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKGG GGSGGGGSGGGGSSDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRI IWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCT ARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTK KNSTFVRVHEK (SEQ ID NO: 11);SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKGG GGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS S DT GR P FVEMY S EIPE11HMTE GRE L VIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTH RQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMK KFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK (SEQ ID NO: 32);SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKGG GGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS GGGGS S DT GR P FVEMY SEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCE ATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKK LVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK (SEQ ID NO: 33);and SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK(GGGGS)y SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTS PNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNA TYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNW EYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK (SEQ ID NO: 30;wherein y is 1,2, 3, 4, 5, 6, 7,8, 9, 10, 11, 12, 13, 140r15). 162 4. The VEGF mini-trap or composition thereof of any one of claims 1-3 wherein said mini-trap comprises the domain structure: (i) (R1D2)a-(R2D3)b-linker-(R1D2)c-(R2D3)d;or (ii) (R1 D2)a-(R2D3)b־(R2D4)c-linker-(R1 D2)d-(R2D3)e-(R2D4)f;and having a secondary structure wherein: (i) said R1D2 domains coordinate;(ii) said R2D3 domains coordinate;and/or (iii) said R2D4 domains coordinate, to form a VEGF binding domain. 5. The VEGF mini-trap or composition thereof of any one of claims 1,3 or 4, wherein linker is (Gly4Ser)n wherein n is 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15;or wherein the MC is a fragment of an immunoglobulin hinge region that forms 2, 3 or 4 cysteine bridges with another MC. 6. The VEGF mini-trap or composition thereof of any one of claims 1-5 wherein said polypeptides are homodimerized. 7. The VEGF mini-trap or composition thereof of any one of claims 1-6, wherein one or more histidines of said VEGF mini-trap are oxidized to 2-oxo-histidine, and/or one or more tryptophans of said VEGF mini-trap are dioxidated, and/or one or more asparagines of said VEGF mini-trap thereof are glycosylated. 8. The VEGF mini-trap or composition thereof of any one of claims 1-7 which is a composition comprising said VEGF mini-trap wherein between 0.1% and 2% of histidines in the VEGF mini-trap are 2-oxo-histidine. 9. The VEGF mini-trap or composition thereof of any one of claims 1-8 which is a composition comprising said VEGF mini-trap polypeptide wherein oligopeptide products of digestion of said VEGF mini-trap, which comprises one or more carboxymethylated cysteines and 2-oxo-histidines, with Lys-C and trypsin proteases are: eiglltc*eatvngh*lyk (amino acids 73-89 of SEQ ID NO: 12) which comprises about 0.006-0.013% 2-oxo-histidines, 163 QTNTIIDVVLSPSH*GIELSVGEK (amino acids 97-119 of SEQ ID NO: 12) which comprises about 0.019-0.028% 2-oxo-histidines, TELNVGIDFNWEYPSSKH*QHK (amino acids 128-148 of SEQ ID NO: 12) which comprises about 0.049-0.085% 2-oxo-histidines, dkth*tc*ppg*papellg (amino acids 206-221 of SEQ ID NO: 12) which comprises about 0.057-0.092% 2-oxo-histidines, and/or tnylth*r (amino acids 90-96 of SEQ ID NO: 12) which comprises about 0.0100.022% 2-oxo-histidines, and optionally, iiw*dsr (amino acids 56-61 of SEQ ID NO: 12) which comprises about 0.198-0.298% 2-oxo-histidines, wherein H* is a histidine that may be oxidized to 2-oxo-histidine, W* is tryptophan that may be dioxidated and wherein C* is a cysteine that may be carboxymethylated. 10. The VEGF mini-trap or composition thereof of any one of claims 1-9 which is a composition comprising said VEGF mini-trap wherein oligopeptide products of digestion of said VEGF mini-trap, which comprises one or more carboxymethylated cysteines and 2-oxo-histidines, with Lys-C and trypsin proteases are: eiglltc*eatvngh*lyk (amino acids 73-89 of SEQ ID NO: 12) which comprises about 0.0095% 2-oxo-histidines, QTNTIIDVVLSPSH*GIELSVGEK (amino acids 97-119 of SEQ ID NO: 12) which comprises about 0.0235% 2-oxo-histidines, TELNVGIDFNWEYPSSKH*QHK (amino acids 128-148 of SEQ ID NO: 12) which comprises about 0.067% 2-oxo-histidines, dkth*tc*ppg*papellg (amino acids 206-221 of SEQ ID NO: 12) which comprises about 0.0745% 2-oxo-histidines, and/or tnylth*r (amino acids 90-96 of SEQ ID NO: 12) which comprises about 0.016% 2-oxo-histidines, and optionally, iiw*dsr (amino acids 56-61 of SEQ ID NO: 12) which comprises about 0.248% 2-oxo-histidines, wherein H* is a histidine that may be oxidized to 2-oxo-histidine, W* is tryptophan that may be dioxidated and wherein C* is a cysteine that may be carboxymethylated. 164 11. The VEGF mini-trap or composition thereof of any one of claims 1 -10 which is a composition wherein one or more tryptophans are dioxidized. 12. The VEGF mini-trap or composition thereof of any one of claims 1-11 which is a composition wherein the 2-oxo-histidine is characterized by the chemical Γ w.'*X־?' formula: 13. The VEGF mini-trap or composition thereof of any one of claims 1 -12 which is a composition characterized by a color: (i) which is no more brown-yellow than European Color Standard BY2;(ii) which is no more brown-yellow than European Color Standard BY3;(iii) which is no more brown-yellow than European Color Standard BY4;(iv) which is no more brown-yellow than European Color Standard BY5;(v) which is no more brown-yellow than European Color Standard BY6;(vi) which is no more brown-yellow than European Color Standard BY7;(vi) which is between European Color Standard BY2 and BY3;(vii) which is between European Color Standard BY2 and BY4;(vii) wherein, in the CIEL*a*b* color space, L* is about 70-99, a* is about 0 and b* is about 20 or less;and/or (viii) wherein, in the CIEL*a*b* color space, L* is about 98-99, a* is about -TO and b* is about 5-10 and the mini-trap concentration is between 75 and 100 mg/ml;optionally, wherein the concentration of VEGF mini-trap is about 70-200 mg/ml or optionally, wherein the concentration of VEGF mini-trap is about 70-200 mg/ml, but is characterized by said color when diluted to about 10, 11, 10-11,80 or 90 mg/ml. 14. The VEGF mini-trap or composition thereof of any one of claims 1-12 which is a composition wherein the color of the composition is characterized by the following formula: 165 0.046 + (0.066 X concentration of mini-trap (mg/ml))=b* or b*=(0.11 X concentration of mini-trap (mg/ml) - 0.56), wherein L*= about 97-99 and a= about -0.085-0.06. 15. The VEGF mini-trap or composition thereof of any one of claims 1-14 which is a composition that is the product of a process comprising: (i) expressing aflibercept or said VEGF mini-trap in a host cell in a chemicallydefined liquid medium wherein said aflibercept or VEGF mini-trap is secreted from the host cell into the medium;and (ii) if aflibercept is expressed, further comprising proteolytic cleavage of the aflibercept to produce peptides comprising the Fc domain, or a fragment thereof, and said VEGF mini-trap, and removal of the Fc domain or fragment thereof from the VEGF mini-trap;(iii) applying the VEGF mini-trap to an anion-exchange chromatography resin;and (iv) retaining said VEGF mini-trap polypeptide in the chromatographic flowthrough thereof. 16. The VEGF mini-trap or composition thereof of claim 15, which is a composition, wherein if said aflibercept is expressed, the process further comprises, prior to said proteolytic cleavage, protein-A purification of the aflibercept. 17. The VEGF mini-trap or composition of any one of claims 15-16, which is a composition, wherein the anion exchange resin comprises: a strong anion exchange resin;a quaternary amine functional group;a-O-CH2CHOHCH2OCH2CHOHCH2N+(CH3)3 functional group;or a quaternized polyethyleneimine functional group. 18. The VEGF mini-trap or composition of any one of claims 15-17, which is a composition, wherein the proteolytic cleavage is performed by incubating the aflibercept with Streptococcus pyogenes IdeS protease or a variant thereof comprising one or more point mutations. 166 19. The VEGF mini-trap or composition of any one of claims 15-18, which is a composition, wherein said VEGF mini-trap, is applied to the anion-exchange (AEX) chromatography resin under a condition selected from the group consisting of: (1) the AEX resin comprises a quaternized polyethyleneimine functional group and is equilibrated with a buffer at pH 8.30 - 8.50 having a conductivity of 1.90 2.10 mS/cm;
  2. 2
    (2) the AEX resin comprises a -O-CH2CHOHCH2OCH2CHOHCH2N+(CH3)3 or -N+(CH3)3 or a quaternary amine functional group and is equilibrated with a buffer at pH 7.90 - 8.10 having a conductivity of 2.40 - 2.60 mS/cm;
  3. 3
    (3) the AEX resin comprises a quaternized polyethyleneimine functional group and is equilibrated with a buffer at pH 7.90 - 8.10 having a conductivity of 2.40 2.60 mS/cm;
  4. 4
    (4) the AEX resin comprises a -O-CH2CHOHCH2OCH2CHOHCH2N+(CH3)3 or -N+(CH3)3 or a quaternary amine functional group and is equilibrated with a buffer at pH 7.70 - 7.90 having a conductivity of 3.90 - 4.10 mS/cm;
  5. 5
    (5) the AEX resin comprises a quaternized polyethyleneimine functional group and is equilibrated with a buffer at pH 7.70 - 7.90 having a conductivity of 3.90 4.10 mS/cm;
  6. 6
    (6) the AEX resin comprises a -O-CH2CHOHCH2OCH2CHOHCH2N+(CH3)3 or -N+(CH3)3 or a quaternary amine functional group and is equilibrated with a buffer at pH 7.70+0.1 having a conductivity of 9.0 + 0.1 mS/cm; and (7) the AEX resin comprises a quaternized polyethyleneimine functional group and is equilibrated with a buffer at pH 8.4+0.1 having a conductivity of 2.0 + 0.1 mS/cm; optionally wherein:the buffer under condition (1) comprises: 50 mM Tris, pH 8.4 and 2.0 mS/cm;the buffer under conditions (2)-(3) comprises: 50 mM Tris, 10 mM acetate, pH 8.0 and 2.5 mS/cm;the buffer under conditions (4)-(5) comprises: 50 mM Tris, 10 mM Acetate, 10 mM NaCI, pH 7.8 and 4.0 mS/cm;the buffer under condition (6) comprises: 50 mM Tris, 60 mM NaCI, pH7.7+0.1;and/or the buffer under condition (7) comprises: 50 mM Tris, pH 8.4+0.1;167 the VEGF mini-trap is in a loading buffer before application to the resin which is the equilibration buffer;and/or following application of the VEGF mini-trap to the resin, said resin is washed with said aqueous buffer. 20. The VEGF mini-trap or composition of any one of claims 15-19, which is a composition, wherein the Fc domain or fragment thereof is chromatographically removed from the VEGF mini-trap, following proteolytic cleavage, by applying the composition comprising Fc domain or fragment and VEGF mini-trap to a proteinA chromatography resin and retaining the VEGF mini-trap in the flow-through fraction. 21. The VEGF mini-trap or composition of any one of claims 15-20, which is a composition, wherein the process further comprises adjustment of the pH to about 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1 or 6.2, filtration, diafiltration, viral inactivation, protein-A chromatographic purification and/or hydrophobic interaction chromatographic purification. 22. The VEGF mini-trap or composition of any one of claims 15-20, which is a composition, wherein the process further comprises hydrophobic interaction chromatographic purification on a resin the comprises a phenyl functional group. 23. The VEGF mini-trap or composition of any one of claims 15-22, which is a composition, wherein the hydrophobic interaction chromatographic purification is done in bind-and-elute mode or flow-through mode. 24. The VEGF mini-trap or composition of any one of claims 15-20, which is a composition, wherein: said mini-trap was expressed in a host cell which is in a chemically defined medium (CDM) or wherein said mini-trap is the product of a process comprising proteolytic cleavage of aflibercept, with IdeS enzyme, wherein said aflibercept was expressed in a host cell which is in a liquid chemically defined medium wherein said host cell was cultured in a process comprising the steps: o (i) introducing the host cell to a CDM comprising: 168 about 68 micromoles Fe per liter of culture, about 6 micromoles Zn per liter of culture, about 0.1 micromoles Cu per liter of culture, about 76 micromoles EDTA per liter of culture, about 45 micromoles citrate per liter of culture, and about 0.5 micromoles Ni per liter of culture and, optionally about 1.2 millimoles cysteine per liter of culture;o adding, to the culture, every two days: about 1.2 millimoles cysteine per liter of culture, about 1 micromole Fe per liter of culture, about 6 micromoles Zn per liter of culture, about 0.1 micromoles Cu per liter of culture, about 8 micromoles EDTA per liter of culture, and about 1 micromoles citrate per liter of culture;optionally, wherein the CDM includes thioctic acid, vitamin C and/or a mixture of hypotaurine, taurine and glycine optionally wherein the CDM includes uridine, manganese, galactose and/or dexamethasone. 25. The VEGF mini-trap or composition of any one of claims 1-24, wherein: • one or more asparagines of the VEGF mini-trap are N-glycosylated;• one more more serines or threonines of the VEGF mini-trap are Oglycosylated;• one or more asparagines of the VEGF mini-trap are deamidated;• one or more Aspartate-Glycine motifs of the VEGF mini-trap are converted to iso-aspartate-glycine and/or Asn-Gly;• one or more methionines of the VEGF mini-trap are oxidized;• one or more tryptophans of the VEGF mini-trap are converted to Nformylkynurenin;• one or more arginines of the VEGF mini-trap are converted to Arg 3deoxyglucosone;• the C-terminal Glycine of the VEGF mini-trap is not present;• there are one or more non-glycosylated glycosites in the VEGF mini-trap;• the VEGF mini-trap comprises about 40 % to about 50% total fucosylated glycans;169 • the VEGF mini-trap comprises about 30% to about 55% total sialylated glycans;• the VEGF mini-trap comprises about 6% to about 15% mannose-5;• the VEGF mini-trap comprises about 60% to about 79% galactosylated glycans;• the VEGF mini-trap is xylosylated;• the VEGF mini-trap is glycated at a lysine;• the VEGF mini-trap comprises a cystine with a free-thiol group;• the VEGF mini-trap comprises a trisulfide bridge;• the VEGF mini-trap comprises an intrachain disulfide bridge;• the VEGF mini-trap comprises disulfide bridges in parallel orientation;and/or • the VEGF mini-trap comprises a lysine or arginine which is carboxymethylated. 26. The VEGF mini-trap or composition of any one of claims 1-25, wherein one or more asparagines of the VEGF mini-trap comprise: • GO-GIcNAc glycosylation;• G1-GlcNAc glycosylation;• G1S-GlcNAc glycosylation;• GO glycosylation;• G1 glycosylation;• G1S glycosylation;• G2 glycosylation;• G2S glycosylation;• G2S2 glycosylation;• GOF glycosylation;• G2F2S glycosylation;• G2F2S2 glycosylation;• G1F glycosylation;• G1FS glycosylation;• G2F glycosylation;• G2FS glycosylation;• G2FS2 glycosylation;170 • G3FS glycosylation;• G3FS3 glycosylation;• G0-2GlcNAc glycosylation;• Man4 glycosylation;• Man4_A1G1 glycosylation;• Man4_A1G1S1 glycosylation;• Man5 glycosylation;• Man5_A1G1 glycosylation;• Man5_A1G1S1 glycosylation;• Man6 glycosylation;• Man6_G0+Phosphate glycosylation;• Man6+Phosphate glycosylation;and/or • Man7 glycosylation. 27. The VEGF mini-trap or composition of any one of claims 1 -26, wherein the VEGF mini-trap comprises: • Man5 glycosylation at about 30-35% of asparagine 123 residues;• Man5 glycosylation at about 25-30% of asparagine 196 residues;• Man6-phosphate glycosylation at about 6-8% of asparagine 36 residues;• Man7 glycosylation at about 3-4% of asparagine 123 residues;• High mannose glycosylation at about 38% of asparagine 123 residues;and/or • High mannose glycosylation at about 29% of asparagine 196 residues. 28. The VEGF mini-trap or composition of any one of claims 1 -27, which is a composition that comprises the VEGF mini-trap at a concentration of about 80, 85, 90, 80-90, 100, 105, 110, 115, 120, 125, 130 or 90-120 mg/ml. 29. The VEGF mini-trap or composition of any one of claims 1-28, wherein • the composition is aqueous;• the mini-trap was expressed in a Chinese hamster ovary cell;• the pH of the composition is about 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1 or 6.2;and/or 171 • the mini-trap has not been exposed to any greater than about 0.24, 0.6, 0.96, 1.2 or 2.4 million lux*hr white light;and/or any greater than about 40, 100, 160, 200 or 400 W*h/m2 ultra-violet A (UVA) light. 30. The VEGF mini-trap or composition of any one of claims 1-29, wherein the VEGF mini-trap is a monomer, homodimer or multimer. 31. A pharmaceutical formulation comprising the VEGF mini-trap or composition of any one of claims 1-30 and a pharmaceutically acceptable carrier. 32. An injection device comprising the VEGF mini-trap polypeptide, composition or formulation of any one of claims 1 -31. 33. The injection device of claim 32 which is a sterile pre-filled syringe. 34. The VEGF mini-trap polypeptide, composition or formulation of any one of claims 1-31 in association with a further therapeutic agent. 35. An isolated polynucleotide encoding a VEGF mini-trap of any one of claims 17. 36. A vector comprising the polynucleotide of claim 35. 37. A host cell comprising the VEGF mini-trap, polynucleotide and/or vector of any one of claims 1-7, 35 or 36. 38. The host cell of claim 37 which is a Chinese hamster ovary cell. 39. A method for making a VEGF mini-trap of any one of claims 1-7 comprising introducing a polynucleotide encoding said polypeptide into a host cell, culturing the host cell in a medium under conditions wherein the polypeptide is expressed and, optionally, isolating the polypeptide from the host cell and/or medium. 40. The method of claim 39 wherein the host cell is a Chinese hamster ovary cell. 172 41. A VEGF mini-trap which is the product of any one of claims 39-40. 42. A method for making a VEGF mini-trap of any one of claims 1-7 consisting essentially of proteolyzing a VEGF Trap with an enzyme that cleaves an immunoglobulin Fc polypeptide after the following sequence: dkthtcppcpapellg (SEQ ID NO: 20). 43. The method of claim 42 wherein the VEGF Trap is aflibercept or conbercept. 44. The method of any one of claims 42-43 wherein the enzyme is S.pyogenes IdeS or Streptococcus equi subspecies zooepidemicus IdeZ. 45. The VEGF mini-trap or composition or a pharmaceutical formulation of any one of claims 1-31 and 34 to a subject or use in a method of introducing the VEGF mini-trap, composition or formulation, and optionally a further therapeutic agent, into the body of the subject. 46. The VEGF mini-trap or composition or formulation for use of claim 45 wherein said VEGF mini-trap is administered to the body of the subject by intraocular injection. 47. The VEGF mini-trap or composition or formulation for use of any one of claims 45-46 wherein said VEGF mini-trap is administered intraocularly to the body of the subject by intravitreal injection. 48. The VEGF mini-trap or composition or pharmaceutical formulation thereof of any one of claims 1 -31,34 or 41 for use in a method of treating an angiogenic eye disorder in a subject in need thereof, the method comprising intraocularly injecting a therapeutically effective amount of the VEGF mini-trap or composition or pharmaceutical formulation thereof, and optionally a further therapeutic agent, into an eye of the subject. 49. The VEGF mini-trap or composition or formulation for use of any one of claims 45-48, wherein about 0.5 mg, 2 mg, 4 mg, 6 mg, 8 mg or 10 mg of the VEGF mini-trap is intravitreally injected into the eye of the subject. 173 50. The VEGF mini-trap or composition or formulation for use of any one of claims 48-49, wherein the angiogenic eye disorder is * age-related macular degeneration (wet), • age-related macular degeneration (dry), * macular edema, * macular edema following retinal vein occlusion, * retinal vein occlusion (RVO), * central retinal vein occlusion (CRVO), * branch retinal vein occlusion (BRVO), * diabetic macular edema (DME), * choroidal neovascularization (CNV), * iris neovascularization, * neovascular glaucoma, * post-surgical fibrosis in glaucoma, * proliferative vitreoretinopathy (PVR), * optic disc neovascularization, * corneal neovascularization, * retinal neovascularization, * vitreal neovascularization, * pannus, * pterygium, * vascular retinopathy, * diabetic retinopathy, wherein the subject also has diabetic macular edema;and * diabetic retinopathy. 51. The VEGF mini-trap or composition or formulation for use of any one of claims 45-50 wherein the VEGF mini-trap is administered in about 100 microliters or less.