Phenylaminopyrimidine amide autophagy inhibitors and methods of use thereof
101 claims: 52 independent, 49 dependent
- 1What is claimed is:1. A compound represented by: m Formula I or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: W is CH or N;X is CH or N;Y is C(R3) or N;R1 is selected from the group consisting of halogen, cyano, C1-C5alkyl, and C3C5cycloalkyl, wherein each C!-C5alkyl and C3-C5cycloalkyl may be optionally substituted by one, two or three independent occurrences of fluorine;R2 is selected from the group consisting of H, halogen, cyano, C!-C5alkyl, C3C6cycloalkyl, C2-C5alkenyl, C2-C5alkynyl, C!-C5alkoxy, and C1-C5alkoxy-C2-C5alkyl, wherein each C!-C5alkyl, C3-C6cycloalkyl, C2-C5alkenyl, C2-C5alkynyl, and C!-C5alkoxy may be optionally substituted by one, two, or three independent occurrences of fluorine or cyano;each occurrence of R3 and R33 is independently selected from the group consisting of H, halogen, C!.C6alkyl, and C!.C6alkoxy, wherein each C!-C6alkyl and C!-C6alkoxy may be optionally substituted by one or more independent occurrences of fluorine;R4 is selected from the group consisting of B, D, NR6R9, NR6-(C(R10)2)P-NR9R9, C(O)-NR6R9;C(O)-B;C(O)-D , and CN;B is selected from an N-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein B may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9;D is selected from a C-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein D may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9;each occurrence of R5 is independently selected from the group consisting of H, CiC6alkyl, C3-C6cycloalkyl, and heterocyclyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine;each occurrence of R7 is independently selected from the group consisting of H, CiC6alkyl, C3-C6cycloalkyl, cyano, and (C(R10)2)h-NR9R9, wherein each C!-C6alkyl and C3C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R7 are joined together with the atom to which they are attached to form oxo;each occurrence of R6 and R9 is independently selected from the group consisting of H, C1-C6alkyl, C3-C6cycloalkyl, C1-C5alkoxy-C2-C5alkyl, C(=0)R5, SO2R5, and D, wherein each C1-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine;each occurrence of R10is independently selected from the group consisting of H, CiC3alkyl, and C3-C5cycloalkyl, wherein each C!-C3alkyl and C3-C5cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R10 are joined together with the carbon to which they are attached to form a C3-C5cycloalkyl;Z is selected from the group consisting of a 4 membered lactam ring bound through the nitrogen atom or a 6-10 membered lactam ring bound through the nitrogen atom, wherein a lactam ring atom may optionally be oxygen or NR6 when the lactam ring is a 6-10 membered ring and an available carbon atom on 4 membered lactam ring or a 6-10 membered lactam is optionally substituted by R36;each occurrence of R36 is independently selected from C1-C6alkyl and C3C6cycloalkyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl;h is 1, 2, or 3;m is 0, 1, 2, or 3;n is 2, 3, or 4;and p is 2 or 3;provided that both X and Y are not N.
- 5The compound of any one of claims 1-4, wherein Z is selected from:wherein V is selected from the group consisting of oxygen, C(R34)2, and NR6;each occurrence of R34 is independently selected from H and R36, wherein each occurrence of R36 is independently selected from C!-C6alkyl and C3-C6cycloalkyl, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl;q is 0, 1, 2, or 3;and r is 2 or 4;provided that, if q is 0, then r is not 2.
- 6The compound of any one of claims 1-5, wherein Z is selected from:wherein V is selected from the group consisting of oxygen, C(R34)2, and NR6;each occurrence of R34 is independently selected from H and R36, wherein each occurrence of R36 is independently selected from C!-C6alkyl and C3-C6cycloalkyl, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl;q is 0, 1, 2, or 3;and r is 2 or 3;provided that, if q is 0, then r is not 2.
- 32A compound represented by:R4 Formula II or a pharmaceutically acceptable salt thereof, wherein: n is 2, 3, or 4;R1 is selected from the group consisting of halogen, cyano, C1-C5alkyl, and C3C5cycloalkyl, wherein each C1-C5alkyl and C3-C5cycloalkyl may be optionally substituted by one, two or three independent occurrences of fluorine;R2 is selected from the group consisting of halogen, C1-C2alkyl and C3-C4cycloalkyl;R4 is selected from the group consisting of: each occurrence of R6 and R9 is independently selected from the group consisting of H, C1-C6alkyl, C3-C6cycloalkyl, C(=O)R5, SO2R5, and D, wherein each C1-C6alkyl and C3C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine;each occurrence of R5 is independently selected from the group consisting of H, CiC6alkyl, C3-C6cycloalkyl, and heterocyclyl, wherein each C1-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine;each occurrence of R7 is independently selected from the group consisting of H, C1-C6 alkyl, and C3-C6cycloalkyl, wherein each C1-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R7 are joined together with the atom to which they are attached to form oxo;D is selected from a C-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein D may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9;Z is selected from the group consisting of: each occurrence of R34 is independently selected from H and R36, wherein each occurrence of R36 is independently selected from C1-C6alkyl and C3-C6cycloalkyl, wherein each C1-C5alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl.
- 50A compound represented by:Formula IIA.2-A wherein R1 is selected from the group consisting of CF3, CF2H, bromo, chloro, and cyclopropyl;R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen;and R9 is selected from the group consisting of C!-C3alkyl, H, and C3-C5cycloalkyl.
- 53A compound represented by:I R9 Formula IIA.7-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl;R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen;and R9 is selected from the group consisting of C!-C3alkyl, H, or C3-C5cycloalkyl.
- 57A compound represented by:c I R9 Formula IIA.8-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl;R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen;and R9 is C!-C3alkyl, H, or C3-C5cycloalkyl.
- 61A compound represented by:Formula IIA.ll-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl;R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen;and R9 is selected from the group consisting of C!-C3alkyl, H, and C3-C5cycloalkyl.
- 65A compound represented by:Formula IIA.14-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl;R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen;and R9 is C!-C3alkyl, H, or C3-C5cycloalkyl.
- 69A compound represented by:wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl;and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen.
- 73A compound represented by:Formula IIA.44-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl;and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen.
- 7778. A pharmaceutical composition comprising a compound of any one of claims 1-77 and a pharmaceutically acceptable excipient.
- 7980. The pharmaceutical composition of claim 79, wherein the composition comprises one additional therapeutic agent.
- 8182. Hie pharmaceutical composition of claim 81, wherein the MAPKAP pathway inhibitor is selected from the group consisting of a MEK inhibitor, an ERK inhibitor, a RAF inhibitor, and a Ras inhibitor.
- 8283. Hie pharmaceutical composition of claim 82, wherein the MEK inhibitor is selected from the group consisting of trametinib, selumetinib, cobimetinib, binimetinib, and pharmaceutically acceptable salts thereof.
- 8788. The pharmaceutical composition of claim 87, wherein the chemotherapeutic agent is a selected from the group consisting of anti-tubulin agents, vinorelbine, DNA-alkylating agents, DNA intercalating agents, 5-fluorouracil, capecitabine, cytarabine, decitabine, 5-aza cytadine, gemcitabine, and methotrexate.
- 9091. The method of claim 90, wherein the cancer is selected from the group consisting of gastrointestinal stromal tumors, esophageal cancer, gastric cancer, melanomas, gliomas, glioblastomas, ovarian cancer, bladder cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, renal cancers, hepatic cancers, osteosarcomas, multiple myelomas, cervical carcinomas, cancers that are metastatic to bone, papillary thyroid carcinoma, nonsmall cell lung cancer, and colorectal cancers.
- 9293. A method of treating a disorder selected from the group consisting of melanomas, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, renal cancers, hepatic cancers, osteosarcomas, multiple myelomas, cervical carcinomas, cancers that are metastatic to bone, papillary thyroid carcinoma, non-small cell lung cancer, and colonic cancers in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of any one of claims 1-77.
- 9394. Ilie method of any one of claims 89-93, further comprising administering to the patient one or more additional therapeutic agents.
- 9495. The method of claim 94, wherein the additional therapeutic agent is a MAPKAP pathway inhibitor.
- 9596. Ilie method of claim 95, wherein the MAPKAP pathway inhibitor is selected from the group consisting of a MEK inhibitor, an ERK inhibitor, a RAF inhibitor, and a Ras inhibitor.
- 101102. The method of claim 101, wherein the chemotherapeutic agent is a selected from the group consisting of anti-tubulin agents, vinorelbine, DNA-alkylating agents, DNA intercalating agents, 5-fluorouracil, capecitabine, cytarabine, decitabine, 5-aza cytadine, gemcitabine, and methotrexate.
Independent claims60
1,371 paragraphs in 41 sections, as filed
PHENYLAMINOPYRIMIDINE AMIDE AUTOPHAGY INHIBITORS AND METHODS OF USE THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S.S.N. 62/846,251 filed May 10, 2019, U.S.S.N. 62/846,258 filed May 10, 2019, U.S.S.N. 62/911,728 filed October 7, 2019, and U.S.S.N. 62/911,730 filed October 7, 2019, the contents of each of which are incorporated herein by reference in their entireties.
SEQUENCE LISTING
[0001.1] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 5, 2020, is named DCP-079WO_SL.txt and is 27,196 bytes in size.
BACKGROUND
[0002] Autophagy (literally meaning “self eating”) is a process that enables cells to recycle cellular organelles, proteins, stored lipids, glucagon, and other materials for the purpose of generating nutrients under periods of stress. These cellular contents are recycled by engulfment in vesicles called autophagosomes. Autophagosomes subsequently merge with lysosomes that degrade the autophagosomal contents for recycling of nutrients to the cell. Tumor cells are prone to activate autophagy, as these cells have a high metabolic demand, experience cellular stress, and frequently are in hypoxic environments with limited blood flow and nutrient supply. Moreover, chemotherapy and targeted therapies have been shown to induce autophagy as a treatment resistance mechanism, and combination of autophagy inhibition (by genetic loss of function mutations in autophagy genes or by pharmacologic means) with chemotherapeutic regimens has been shown to suppress tumor growth and trigger tumor cell apoptosis to a greater extent than single agent chemotherapy. [0003] Mutant Ras proteins drive approximately 30 percent of all human cancers including 95 percent of pancreatic cancers and 45 percent of colorectal cancers, and treatment of these mutant Ras cancers is currently an area of high unmet medical need. Mutant Ras cancers are highly proliferative and depend on basal levels of autophagy for survival, suggesting that inhibition of autophagy in these “autophagy addicted” cancers is a viable therapeutic approach.
[0004] Currently, the most widely used autophagy inhibitors are chloroquine and hydroxychloroquine, which are well-known anti-malarial agents. These anti-malarials have been thought to block autophagy by being sequestered in the lysosomal compartment, raising the pH of these lysomes and thereby inactivating proteases that degrade and recycle nutrients. These anti-malarial agents have multiple mechanisms of action beyond inhibiting lysosomes and are known to induce retinopathies in patients. Hence there is a need for more targeted agents which selectively block autophagy and do not exhibit the toxicides of these antimalarial agents. ULK1 kinase is the initiating protein of autophagy and is a serine/threonine kinase. The ULK1 kinase complex is activated in response to cellular stress including nutrient deprivation and energy depletion. Nutrient deprivation activates ULK kinase activity through inhibition of mTORCl, and energy depletion activates ULK kinase activity through activation by AMP-activated protein kinase AMPK. Importantly, kinase dead mutants of ULK kinase block initiation of canonical autophagy, suggesting that small molecule inhibitors of ULK kinase activity would be able to block autophagy.
[0005] Further mechanistic studies have shown that genetic deletion of ULK1 inhibits autophagy in cancer cells, relieving FOX3A tum-over and upregulation of the pro-apoptotic protein PUMA. In addition to classical activation of canonical autophagy, ULK1 kinase activity has been shown to be required for Bcl L-13 mediated mitophagy (autophagy of damaged mitochondria). ULK1 and ULK2 kinases have also been demonstrated to rewire cancer cell glucose metabolism. ULK inhibitors may also find utility in blocking these noncanonical protumoral activities of ULK.
[0006] Autophagy is also upregulated in host cells and tissues in cancer. Autophagy in pancreatic tissue stellate cells was demonstrated to support tumor growth. Pancreatic stellate cells were shown to support pancreatic cancer tumor metabolism through autophagic alanine secretion. Inhibition of host tissue autophagy was demonstrated to lead to a depletion in circulating arginine (a required amino acid for tumor metabolism and growth) through liver -mediated increases in arginase secretion. Activation of ULK1 kinase was also shown to inactivate the STING pathway in immune cells through inhibitory phosphorylation of STING, mediating a negative feedback mechanism for limiting an innate immune cell response mediated by interferons. Thus, not only is autophagy activated in tumor cells (cancer cell autonomous), but also in other cells in the tumor microenvironment or host tissues (cancer call nonautonomous) to support tumor survival and growth.
[0007] Mutant Ras cancers are addicted to autophagy. In pancreatic cancer, mutant Ras signals predominantly through the MAPKAP pathway. Mutant Ras activates RAF kinases, which in turn activate MEK kinases, which finally activate ERK kinases: mutant Ras -> RAF -> MEK -> ERK. Despite mutant Ras signaling through the MAPKAP pathway, inhibitors of this pathway have provided no or little clinical benefit in clinical trials when used as single agents. It has been recently reported that inhibition of the MAPKAP pathway induces autophagy as a compensatory survival mechanism. When MEK inhibitors were combined with the autophagy inhibitor hydroxychloroquine, there was synergistic activity leading to regression of a number of mutant Ras or mutant BRAF cancers. Similarly, when ERK inhibitors were combined with the autophagy inhibitor hydroxychloroquine or chloroquine, there was synergistic activity leading to inhibition of mutant Ras pancreatic cancers. It has been demonstrated that genetic depletion of RAF kinases (CRAF and BRAF) led to synergistic anti-tumor activity in mutant Ras cancer cell lines when autophagy was also genetically depleted. In composite, recent publications highlight that dual inhibition of the MAPKAP pathway and the autophagy pathway in mutant Ras cancers is a promising treatment regimen for patients with mutant Ras cancers. It has also been demonstrated that other targeted therapies and chemotherapeutic agents activate tumor autophagy as a resistance mechanism; hence there is rationale for combining such targeted therapeutics or chemotherapeutic agents with inhibitors of autophagy.
[0008] Mutations in the gene encoding LRRK2 kinase are causative of Parkinson’s disease. LRRK2 point mutations are found in both familial (inherited) as well as sporadic Parkinson’s disease patients. The most common mutation of LRRK2 in Parkinson’s disease is LRRK2 G2019S. These mutations in LRRK2 are gain-of-function mutations that cause overactivation of LRRK2 signaling. Ongoing autophagy is a process that is used by brain neuronal cells to maintain health and homeostasis. Autophagy is a process by which cells identify, localize, and destroy aged organelles and structural elements within cells, and particularly in the case of proteins known to aggregate in neurons, autophagy eliminates such toxic protein aggregates to maintain neuronal health. LRRK2 activity suppresses autophagy, and the LRRK2 G2019S gain-of-function mutant even moreso suppresses autophagy and has been linked to aggressive forms of Parkinson’s disease.
[0009] Increased LRRK2 kinase activity has also been linked to immunoinflammatory diseases including colitis and Crohn’s disease and inflammatory bowel disease. In the gastrointestinal tract, LRRK2 is present in antigen-presenting cells including dendritic cells. LRRK2 activity has been shown to be important in Dectin-1 mediated innate immune responses, including an activation of the NFkB pathway and increased TNF-alpha production in dendritic cells of patients with Crohn’s disease.
[00010] Inhibitors of LRRK2 are sought for the treatment of neurodegenerative diseases including Parkinson’s disease, and also are sought for the treatment of gastrointestinal diseases including Crohn’s disease, ulcerative colitis, and inflammatory bowel disease.
[00011] There is a need for new targeted therapies which inhibit autophagy and can be used in combination with MAPKAP pathway inhibitors, chemotherapeutic agents, and/or other targeted therapeutics.
SUMMARY
[00012] Described herein are compounds that are inhibitors of autophagy, pharmaceutical compositions, and their use as agents in the treatment of disorders such as cancer, processes for their preparation, and pharmaceutical compositions containing them as an active ingredient. Such pharmaceutical compositions may comprise the compound as the sole active agent or in combination with other active agents in the presence of a pharmaceutically acceptable excipient. In an embodiment, the described compounds are inhibitors of ULK kinase activity, including ULK1 and ULK2 activity.
[00013] For example, compounds provided herein may be described as represented by Formula (I)
<img file="IL287787A_D0001.tif" />
Formula I or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: W is CH or N; X is CH or N; Y is C(R3) or N; R1 is selected from the group consisting of halogen, cyano, C!-C5alkyl, and C3-C5cycloalkyl, wherein each C!-C5alkyl and C3C5cycloalkyl may be optionally substituted by one, two or three independent occurrences of fluorine; R2 is selected from the group consisting of H, halogen, cyano, C!-C5alkyl, C3C6cycloalkyl, C2-C5alkenyl, C2-C5alkynyl, C!-C5alkoxy, and C1-C5alkoxy-C2-C5alkyl, wherein each C!-C5alkyl, C3-C6cycloalkyl, C2-C5alkenyl, C2-C5alkynyl, and C!-C5alkoxy may be optionally substituted by one, two, or three independent occurrences of fluorine or cyano; each occurrence of R3 and R33 is independently selected from the group consisting of H, halogen, C!.C6alkyl, and C!.C6alkoxy, wherein each C!-C6alkyl and C!-C6alkoxy may be optionally substituted by one or more independent occurrences of fluorine; R4 is selected from the group consisting of B, D, NR6R9, NR6-(C(R10)2)P-NR9R9, C(O)-NR6R9; C(O)-B; C(O)-D , and CN; B is selected from an N-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein B may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9; D is selected from a C-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein D may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9; each occurrence of R5 is independently selected from the group consisting of H, C1-C6alkyl, C3-C6cycloalkyl, and heterocyclyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R7 is independently selected from the group consisting of H, C!-C6alkyl, C3-C6cycloalkyl, cyano, and (C(R10)2)hNR9R9wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R7 are joined together with the atom to which they are attached to form oxo; each occurrence of R6 and R9 is independently selected from the group consisting of H, C!-C6alkyl, C3-C6cycloalkyl, C1-C5alkoxy-C2-C5alkyl, C(=0)R5, SO2R5, and D, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R10 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl, wherein each C1-C3alkyl and C3-C5cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R10 are joined together with the carbon to which they are attached to form a C3-C5cycloalkyl; Z is selected from the group consisting of a 4 membered lactam ring bound through the nitrogen atom or a 6-10 membered lactam ring bound through the nitrogen atom, wherein a lactam ring atom may optionally be oxygen or NR6 when the lactam ring is a 6-10 membered ring and an available carbon atom on 4 membered lactam ring or a 6-10 membered lactam is optionally substituted by R36; each occurrence of R36 is independently selected from C!-C6alkyl and C3-C6cycloalkyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl; h is 1, 2, or 3; m is 0, 1, 2, or 3; n is 2, 3, or 4; and p is 2 or 3;; provided that both X and Y are not N.
DETAILED DESCRIPTION
[00014] The features and other details of the disclosure will now be more particularly described. Certain terms employed in the specification, examples and appended claims are collected here. These definitions should be read in light of the remainder of the disclosure and as understood by a person of skill in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by a person of ordinary skill in the art.
Definitions
[00015] The term “alkyl” as used herein refers to a saturated straight or branched hydrocarbon. Exemplary alkyl groups include, but are not limited to, straight or branched hydrocarbons of 1-6, 1-5, 1-4, 1-3, or 1-2 carbon atoms, referred to herein as C1-C6alkyl, CiCsalkyl, C1-C4alkyl, C1-C3alkyl, and C!-C2alkyl, respectively. Exemplary alkyl groups include, but are not limited to, methyl, ethyl, propyl, isopropyl, 2-methyl-l-butyl, 3-methyl-2butyl, 2-methyl-l-pentyl, 3-methyl pentyl, 4-methyl-l-pentyl, 2-methyl pentyl, 3-methyl2-pentyl, 4-methyl pentyl, 2,2-dimethyl-l-butyl, 3,3-dimethyl butyl, 2-ethyl-l-butyl, butyl, isobutyl, t-butyl, pentyl, isopentyl, neopentyl, hexyl, etc.
[00016] The term “alkenyl” as used herein refers to an unsaturated straight or branched hydrocarbon having at least one carbon-carbon double bond. Exemplary alkenyl groups include, but are not limited to, a straight or branched group of 2-6 or 3-4 carbon atoms, referred to herein as C2-C6alkenyl, and C3-C4alkenyl, respectively. Exemplary alkenyl groups include, but are not limited to, vinyl, allyl, butenyl, pentenyl, etc.
[00017] The term “alkoxy” as used herein refers to a straight or branched alkyl group attached to oxygen (alkyl-O-). Exemplary alkoxy groups include, but are not limited to, alkoxy groups of 1-6 or 2-6 carbon atoms, referred to herein as C!-C6alkoxy, and C2C6alkoxy, respectively. Exemplary alkoxy groups include, but are not limited to methoxy, ethoxy, isopropoxy, etc.
[00018] The term “alkoxyalkyl” as used herein refers to a straight or branched alkyl group attached to oxygen, attached to a second straight or branched alkyl group (alkyl-Oalkyl-). Exemplary alkoxy alkyl groups include, but are not limited to, alkoxy alkyl groups in which each of the alkyl groups independently contains 1-6 carbon atoms, referred to herein as C1-C6alkoxy-C1-C6alkyl. Exemplary alkoxyalkyl groups include, but are not limited to methoxymethyl, 2-methoxyethyl, 1 -methoxyethyl, 2-methoxypropyl, ethoxymethyl, 2isopropoxyethyl etc.
[00019] The term “alkynyl” as used herein refers to an unsaturated straight or branched hydrocarbon having at least one carbon-carbon triple bond. Exemplary alkynyl groups include, but are not limited to, straight or branched groups of 2-6, or 3-6 carbon atoms, referred to herein as C2-C6alkynyl, and C3-C6alkynyl, respectively. Exemplary alkynyl groups include, but are not limited to, ethynyl, propynyl, butynyl, pentynyl, hexynyl, methylpropynyl, etc.
[00020] The term “cyano” as used herein refers to the radical -CN.
[00021] The terms “cycloalkyl” or a “carbocyclic group” as used herein refers to a saturated or partially unsaturated hydrocarbon group of, for example, 3-6, or 4-6 carbons, referred to herein as C3-C6cycloalkyl or C4-C6cycloalkyl, respectively. Exemplary cycloalkyl groups include, but are not limited to, cyclohexyl, cyclopentyl, cyclopentenyl, cyclobutyl or cyclopropyl.
[00022] The term “cycloalkoxy” as used herein refers to a cycloalkyl group attached to oxygen (cycloalkyl-O-). Exemplary cycloalkoxy groups include, but are not limited to, cycloalkoxy groups of 3-6 carbon atoms, referred to herein as C3-C6cycloalkoxy groups.
Exemplary cycloalkoxy groups include, but are not limited to, cyclopropoxy, cyclobutoxy, cyclopentoxy, cyclohexyloxy, etc.
[00023] The terms “halo” or “halogen” as used herein refer to F, Cl, Br, or I.
[00024] The term “heteroaryl” as used herein refers to a monocyclic aromatic 5 or 6 membered ring system containing one or more heteroatoms, for example one to three heteroatoms, such as nitrogen, oxygen, and sulfur. Where possible, said heteroaryl ring may be linked to the adjacent radical though carbon or nitrogen. Examples of heteroaryl rings include but are not limited to furan, thiophene, pyrrole, thiazole, oxazole, isothiazole, isoxazole, imidazole, pyrazole, triazole, pyridine or pyrimidine etc.
[00025] The terms “heterocyclyl” or “heterocyclic group” are art-recognized and refer to saturated or partially unsaturated, 4-10 membered ring structures, including monocyclic, bridged or fused rings, and whose ring structures include one to three heteroatoms, such as nitrogen, oxygen, and sulfur. Where possible, heterocyclyl rings may be linked to the adjacent radical through carbon or nitrogen. Examples of heterocyclyl groups include, but are not limited to, pyrrolidine, piperidine, morpholine, thiomorpholine, piperazine, oxetane, azetidine, tetrahydrofuran or dihydrofuran etc.
[00026] As used herein, the term lactam refers to cyclic amides of amino carboxylic acids, having a l-azacycloalkan one structure, or analogues having unsaturation or heteroatoms replacing one or more carbon atoms of the ring. An alpha-lactam, refers to a lactam comprised of a 3-membered ring. A beta-lactam, refers to a lactam comprised of a 4-membered ring. A gamma-lactam, refers to a lactam comprised of a 5-membered ring. A delta-lactam, refers to a lactam comprised of a 6-membered ring. An epsilon-lactam, refers to a lactam comprised of a 7-membered ring.
[00027] The term “oxo” as used herein refers to the radical =0.
[00028] A “combination therapy” is a treatment that includes the administration of two or more therapeutic agents, e.g., a compound of Formula I and a MAPKAP pathway inhibitor, to a patient in need thereof.
[00029] “Disease,” “disorder,” and “condition” are used interchangeably herein.
[00030] “Individual,” “patient,” or “subject” are used interchangeably and include any animal, including mammals, preferably mice, rats, other rodents, rabbits, dogs, cats, swine, cattle, sheep, horses, or primates, and most preferably humans. The compounds described herein can be administered to a mammal, such as a human, but can also be administered to other mammals such as an animal in need of veterinary treatment, e.g., domestic animals (e.g., dogs, cats, and the like), farm animals (e.g., cows, sheep, pigs, horses, and the like) and laboratory animals (e.g., rats, mice, guinea pigs, and the like).
[00031] A “MAPKAP pathway inhibitor” is an inhibitor of the MAP kinase signaling pathway. Inhibitors of this pathway include Ras inhibitors (e.g. AMG-510, MRTX 849), RAF inhibitors (e.g. dabrafenib, vemurafenib, LY3009120), MEK inhibitors (e.g. trametinib, binimetinib, selumetinib, cobimetinib), and ERK inhibitors (e.g. ulixertinib, SCH772984, LY3214996). The terms “MAPKAP pathway inhibitor” and “MAPKAP kinase inhibitor are used interchangeably herein.
[00032] “Pharmaceutically or pharmacologically acceptable” include molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, or a human, as appropriate. For human administration, preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by FDA Office of Biologies standards.
[00033] The term “pharmaceutically acceptable carrier” or “pharmaceutically acceptable excipient” as used herein refers to any and all solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. The compositions may also contain other active compounds providing supplemental, additional, or enhanced therapeutic functions.
[00034] The term “pharmaceutical composition” as used herein refers to a composition comprising at least one compound as disclosed herein formulated together with one or more pharmaceutically acceptable carriers.
[00035] The term pharmaceutically acceptable salt(s) as used herein refers to salts of acidic or basic groups that may be present in compounds used in the compositions.
Compounds included in the present compositions that are basic in nature are capable of forming a wide variety of salts with various inorganic and organic acids. The acids that may be used to prepare pharmaceutically acceptable acid addition salts of such basic compounds are those that form non-toxic acid addition salts, i.e., salts containing pharmacologically acceptable anions, including, but not limited to, malate, oxalate, chloride, bromide, iodide, nitrate, sulfate, bisulfate, phosphate, acid phosphate, isonicotinate, acetate, lactate, salicylate, citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate and pamoate (i.e., l,T-methylene-Z?z.s-(2- hydroxy naphthoate)) salts. Compounds included in the present compositions that are acidic in nature are capable of forming base salts with various pharmacologically acceptable cations. Examples of such salts include alkali metal or alkaline earth metal salts, particularly calcium, magnesium, sodium, lithium, zinc, potassium, and iron salts. Compounds included in the present compositions that include a basic or acidic moiety may also form pharmaceutically acceptable salts with various amino acids. The compounds of the disclosure may contain both acidic and basic groups; for example, one amino and one carboxylic acid group. In such a case, the compound can exist as an acid addition salt, a zwitterion, or a base salt.
[00036] The compounds of the disclosure may contain one or more chiral centers and, therefore, exist as stereoisomers. The term “stereoisomers” when used herein consist of all enantiomers or diastereomers. These compounds may be designated by the symbols “(+),” “(),” “R” or “S,” depending on the configuration of substituents around the stereogenic carbon atom, but the skilled artisan will recognize that a structure may denote a chiral center implicitly. The presently described compounds encompasses various stereoisomers of these compounds and mixtures thereof. Mixtures of enantiomers or diastereomers may be designated “(+)” in nomenclature, but the skilled artisan will recognize that a structure may denote a chiral center implicitly.
[00037] In the present specification, the term “therapeutically effective amount” means the amount of the subject compound that will elicit the biological or medical response of a tissue, system or animal, (e.g. mammal or human) that is being sought by the researcher, veterinarian, medical doctor or other clinician. The compounds described herein are administered in therapeutically effective amounts to treat a disorder.
[00038] “Treating” includes any effect, e.g., lessening, reducing, modulating, or eliminating, that results in the improvement of the condition, disease, disorder and the like. [00039] The disclosure also embraces isotopically labeled compounds which are identical to those recited herein, except that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine and chlorine, such as 2Η, 3H, 13C, 14C, 15N, 18Ο, 170,31P, 32P, 35S, 18F, and 36Cl, respectively. For example, a compound of the disclosure may have one or more H atom replaced with deuterium.
[00040] Individual enantiomers and diasteriomers of compounds of the present invention can be prepared synthetically from commercially available starting materials that contain asymmetric or stereogenic centers, or by preparation of racemic mixtures followed by resolution methods well known to those of ordinary skill in the art. These methods of resolution are exemplified by (1) attachment of a mixture of enantiomers to a chiral auxiliary, separation of the resulting mixture of diastereomers by recrystallization or chromatography and liberation of the optically pure product from the auxiliary, (2) salt formation employing an optically active resolving agent, (3) direct separation of the mixture of optical enantiomers on chiral liquid chromatographic columns or (4) kinetic resolution using stereoselective chemical or enzymatic reagents. Racemic mixtures can also be resolved into their component enantiomers by well-known methods, such as chiral-phase liquid chromatography or crystallizing the compound in a chiral solvent. Stereoselective syntheses, a chemical or enzymatic reaction in which a single reactant forms an unequal mixture of stereoisomers during the creation of a new stereocenter or during the transformation of a pre-existing one, are well known in the art. Stereoselective syntheses encompass both enantio- and diastereoselective transformations, and may involve the use of chiral auxiliaries. For examples, see Carreira and Kvaerno, Classics in Stereoselective Synthesis, Wiley-VCH: Weinheim, 2009.
Compounds
[00041] Described herein is a compound represented by Formula I:
<img file="IL287787A_D0002.tif" />
Formula I or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: W is CH or N; X is CH or N; Y is C(R3) or N; R1 is selected from the group consisting of halogen, cyano, C1-C5alkyl, and C3-C5cycloalkyl, wherein each C1-C5alkyl and C3C5cycloalkyl may be optionally substituted by one, two or three independent occurrences of fluorine; R2 is selected from the group consisting of H, halogen, cyano, C1-C5alkyl, C3C6cycloalkyl, C2-C5alkenyl, C2-C5alkynyl, C!-C5alkoxy, and C1-C5alkoxy-C2-C5alkyl, wherein each C!-C5alkyl, C3-C6cycloalkyl, C2-C5alkenyl, C2-C5alkynyl, and C!-C5alkoxy may be optionally substituted by one, two, or three independent occurrences of fluorine or cyano; each occurrence of R3 and R33 is independently selected from the group consisting of H, halogen, C!-C6alkyl, and C!-C6alkoxy, wherein each C!-C6alkyl and C!-C6alkoxy may be optionally substituted by one or more independent occurrences of fluorine; R4 is selected from the group consisting of B, D, NR6R9, NR6-(C(R10)2)P-NR9R9, C(O)-NR6R9; C(O)-B; C(O)-D , and CN; B is selected from an N-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein B may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9; D is selected from a C-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein D may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9; each occurrence of R5 is independently selected from the group consisting of H, C!-C6alkyl, C3-C6cycloalkyl, and heterocyclyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R7 is independently selected from the group consisting of H, C!-C6alkyl, C3-C6cycloalkyl, cyano, and (C(R10)2)hNR9R9, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R7 are joined together with the atom to which they are attached to form oxo; each occurrence of R6 and R9 is independently selected from the group consisting of H, C!-C6alkyl, C3-C6cycloalkyl, C1-C5alkoxy-C2-C5alkyl, C(=0)R5, SO2R5, and D, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R10 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl, wherein each C!-C3alkyl and C3-C5cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R10 are joined together with the carbon to which they are attached to form a C3-C5cycloalkyl; Z is selected from the group consisting of a 4 membered lactam ring bound through the nitrogen atom or a 6-10 membered lactam ring bound through the nitrogen atom, wherein a lactam ring atom may optionally be oxygen or NR6 when the lactam ring is a 6-10 membered ring and an available carbon atom on 4 membered lactam ring or a 6-10 membered lactam is optionally substituted by R36; each occurrence of R36 is independently selected from C1-C6alkyl and C3-C6cycloalkyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl; h is 1, 2, or 3; m is 0, 1, 2, or 3; n is 2, 3, or 4; and p is 2 or 3;; provided that both X and Y are not N.
[00042] In some embodiments, W is N. In some embodiments, X is CH and Y is N. In some embodiments, X is CH and Y is C(R3).
[00043] In some embodiments, Z is selected from:
<img file="IL287787A_D0003.tif" />
wherein V is selected from the group consisting of oxygen, CH2, and NR6; each occurrence of R34 is independently selected from H and R36, wherein each occurrence of R36 is independently selected from C1-C6alkyl and C3-C6cycloalkyl, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl; q is 0, 1, 2, or 3; and r is 2 or 4, provided that, if q is 0, then r is not 2.
[00044] In some embodiments, Z is selected from:
<img file="IL287787A_D0004.tif" />
and
<img file="IL287787A_D0005.tif" />
wherein V is selected from the group consisting of oxygen, C(R34)2, and NR6; each occurrence of R34 is independently selected from H and R36, wherein each occurrence of R36 is independently selected from C1-C6alkyl and C3-C6cycloalkyl, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl; q is 0, 1,2, or
3; and r is 2 or 3, provided that, if q is 0, then r is not 2.
[00045] In some embodiments, Z is selected from the group consisting of:
<img file="IL287787A_D0006.tif" />
<img file="IL287787A_D0007.tif" />
[00046] In some embodiments, Z is selected from:
<img file="IL287787A_D0008.tif" />
and
<img file="IL287787A_D0009.tif" />
wherein V is selected from the group consisting of oxygen, CH2, and NR6; q is 0, 1,2, or 3; and r is 2 or 3, provided that, if q is 0, then r is not 2.
[00047] In some embodiments, Z is selected from the group consisting of:
<img file="IL287787A_D0010.tif" />
<img file="IL287787A_D0011.tif" />
[00048] In some embodiments, R4 is B.
<img file="IL287787A_D0012.tif" />
wherein u is 1 or 2.
[00050] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0013.tif" />
<img file="IL287787A_D0014.tif" />
[00051] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0015.tif" />
[00052] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0016.tif" />
<img file="IL287787A_D0017.tif" />
[00053] In some embodiments, R4 is D.
[00054] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0018.tif" />
<img file="IL287787A_D0019.tif" />
<img file="IL287787A_D0020.tif" />
<img file="IL287787A_D0021.tif" />
and
<img file="IL287787A_D0022.tif" />
[00055] In some embodiments, m is 0. In some embodiments, m is 1. In some embodiments, m is 2. In some embodiments, m is 3.
[00056] In some embodiments, R1 is selected from the group consisting of halogen, CiCsalkyl, and C3-C5cycloalkyl, wherein C1-C5alkyl may be optionally substituted with one, two, or three occurrences of fluorine. In some embodiments, R1 is CF3. In some embodiments, R1 is CF2H. In some embodiments, R1 is halogen. In some embodiments, R1 is bromo. In some embodiments, R1 is cyclopropyl.
[00057] In some embodiments, R2 is selected from the group consisting of H, C3C5cycloalkyl, C1-C5alkyl, halogen, CN, C2-C5alkenyl, and C2-C5alknyl, wherein C1-C5alkyl may be optionally substituted with one, two, or three independent occurrences of fluorine. In some embodiments, R2 is selected from the group consisting of C!-2alkyl and C3-4cycloalkyl. In some embodiments, R2 is selected from the group consisting of chloro and bromo.
[00058] In some embodiments, R2 is selected from the group consisting of C!-C5alkyl, H, and C3-C4cycloalkyl. In some embodiments, R2 is selected from the group consisting of C!-C2alkyl and C3-C4cycloalkyl. In some embodiments, R2 is selected from the group consisting of chloro and bromo.
[00059] In some embodiments, n is 3.
[00060] In some embodiments, the compound is represented by Formula II:
<img file="IL287787A_D0023.tif" />
R4
Formula II or a pharmaceutically acceptable salt thereof, wherein: n is 2, 3, or 4; R1 is selected from the group consisting of halogen, cyano, C!-C5alkyl, and C3-C5cycloalkyl, wherein each CiC5alkyl and C3-C5cycloalkyl may be optionally substituted by one, two or three independent occurrences of fluorine; R2 is selected from the group consisting of halogen, C!-C2alkyl and C3-C4cycloalkyl; R4 is selected from the group consisting of:
<img file="IL287787A_D0024.tif" />
each occurrence of R6 and R9 is independently selected from the group consisting of H, CiC6alkyl, C3-C6cycloalkyl, C(=O)R5, SO2R5, and D, wherein each C!-C6alkyl and C3C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R5 is independently selected from the group consisting of H, CiC6alkyl, C3-C6cycloalkyl, and heterocyclyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R7 is independently selected from the group consisting of H, C1-C6 alkyl, and C3-C6cycloalkyl, wherein each C1-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R7 are joined together with the atom to which they are attached to form oxo; D is selected from a C-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein D may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9; Z is selected from the group consisting of:
<img file="IL287787A_D0025.tif" />
<img file="IL287787A_D0026.tif" />
each occurrence of R34 is independently selected from H and R36, wherein each occurrence of R36 is independently selected from C!-C6alkyl and C3-C6cycloalkyl, wherein each C!-C5alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl.
[00061] In some embodiments, R1 is selected from the group consisting of halogen, CiC5alkyl, and C3-C5cycloalkyl, wherein C!-C5alkyl may be optionally substituted with one, two, or three occurrences of fluorine, and C3-C5cycloalkyl. In some embodiments, R1 is CF3. In some embodiments, R1 is CF2H. In some embodiments, R1 is halogen. In some embodiments, R1 is bromo. In some embodiments, R1 is cyclopropyl.
[00062] In some embodiments, R2 is selected from the group consisting of H, C3C4cycloalkyl, C1-C5alkyl, and halogen. In some embodiments, R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro.
[00063] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0027.tif" />
[00064] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0028.tif" />
[00065] In some embodiments, each R6 and R9 is independently selected from the group consisting of H, C!-C6alkyl, and C3-C6cycloalkyl, wherein each of C!-C6alkyl and C3C6cycloalkyl is optionally substituted by one or more independent occurrences of fluorine. [00066] In some embodiments, R7 is H.
[00067] In some embodiments, each occurrence of R34 is independently selected from the group consisting of H and C!-C5alkyl, wherein C!-C5alkyl may be optionally substituted by one, two, or three independent occurrences of fluorine. In some embodiments, two R34 are joined together with the carbon to which they are attached to form C3-C6cycloalkyl.
[00068] In some embodiments, Z is selected from the group consisting of:
<img file="IL287787A_D0029.tif" />
<img file="IL287787A_D0030.tif" />
<img file="IL287787A_D0031.tif" />
<img file="IL287787A_D0032.tif" />
<img file="IL287787A_D0033.tif" />
[00069]
In some embodiments, Z is selected from the group consisting of:
<img file="IL287787A_D0034.tif" />
<img file="IL287787A_D0035.tif" />
<img file="IL287787A_D0036.tif" />
[00070] In some embodiments, n is 3.
[00071] In an embodiment, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0037.tif" />
<img file="IL287787A_D0038.tif" />
<img file="IL287787A_D0039.tif" />
N
R9
Formula IIA.3
&#1494;
<img file="IL287787A_D0040.tif" />
<img file="IL287787A_D0041.tif" />
Formula IIA.5 ,
<img file="IL287787A_D0042.tif" />
Formula IIA.6 ’ Formula IIA.7 , and Formula IIA.8 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl;
each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3C5cycloalkyl; and n is 3.
[00072] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C1-C3alkyl; each R34 is H; and n is 3.
[00073] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C1-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[00074] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl.; and n is 3 In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C1-C3alkyl; each R34 is H; and n is 3.
[00075] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0043.tif" />
Formula IIA.9 , and Formula IIA.10 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; and n is 3.
[00076] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C1-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and C1-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3C4cycloalkyl; each occurrence of R9 is independently selected from H and C!-C3alkyl; and n is 3.
[00077] In an embodiment, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0044.tif" />
<img file="IL287787A_D0045.tif" />
Formula HA. 11
<img file="IL287787A_D0046.tif" />
<img file="IL287787A_D0047.tif" />
<img file="IL287787A_D0048.tif" />
<img file="IL287787A_D0049.tif" />
Formula IIA.16 , and Formula IIA.17
Formula IIA.15 1 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R9 is independently selected from the group consisting of H, C1-C3alkyl, and C3-C5cycloalkyl; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3C5cycloalkyl; and n is 3.
[00078] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[00079] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C1-C3alkyl; each R34 is H; and n is 3.
[00080] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl.; and n is 3 In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[00081] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0050.tif" />
Formula IIA.18 &#1497; and Formula IIA.19 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C1-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; and n is 3.
[00082] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from the group consisting of C1-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and C1-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from the group consisting of CiC3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and CiC3alkyl; and n is 3.
[00083] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0051.tif" />
<img file="IL287787A_D0052.tif" />
Formula IIA.20
<img file="IL287787A_D0053.tif" />
<img file="IL287787A_D0054.tif" />
<img file="IL287787A_D0055.tif" />
<img file="IL287787A_D0056.tif" />
<img file="IL287787A_D0057.tif" />
wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R34 is selected from the group consisting of H, C1-C2alkyl, and C3-C5cycloalkyl; and n is 3.
[00084] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[00085] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[00086] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[00087] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0058.tif" />
Formula IIA.27 Formula IIA.28 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
[00088] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from
C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
[00089] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0059.tif" />
Formula IIA.34 Formula IIA.35 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C1-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3C5cycloalkyl; and n is 3.
[00090] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[00091] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C1-C3alkyl; each R34 is H; and n is 3.
[00092] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl.; and n is 3 In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[00093] In some embodiments, the compound is represented by a formula selected from:
<img file="IL287787A_D0060.tif" />
Formula IIA.36 &#1497; and Formula IIA.37 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; and n is 3.
[00094] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C1-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and C1-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3C4cycloalkyl; each occurrence of R9 is independently selected from H and C!-C3alkyl; and n is 3.
[00095] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0061.tif" />
<img file="IL287787A_D0062.tif" />
<img file="IL287787A_D0063.tif" />
Formula IIA.38
<img file="IL287787A_D0064.tif" />
<img file="IL287787A_D0065.tif" />
Formula IIA.40
<img file="IL287787A_D0066.tif" />
<img file="IL287787A_D0067.tif" />
Formula IIA.42- Formula IIA.43 , and Formula IIA.44 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C1-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3-C5cycloalkyl; and n is 3.
[00096] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[00097] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[00098] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[00099] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0068.tif" />
Formula IIA.45&#1470; and Formula IIA.46 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C1-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
[000100] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
[000101] In some embodiments, the compound is represented by:
<img file="IL287787A_D0069.tif" />
<img file="IL287787A_D0070.tif" />
R9
Formula IIA.2-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; and R9 is selected from the group consisting of C!-C3alkyl, H, and C3-C5cycloalkyl. In some embodiments, R1 is CF3; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is bromo; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is CF2H; R2 is selected from the group consisting of C1-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H.
[000102] In some embodiments, the compound is represented by:
<img file="IL287787A_D0071.tif" />
Formula IIA.7-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; R2 is selected from the group consisting of C1-C2alkyl, C3-C4cycloalkyl, and halogen; and R9 is selected from the group consisting of C!-C3alkyl, H, and C3-C5cycloalkyl. In some embodiments, R1 is CF3; R2 is selected from the group consisting of C1-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is bromo; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is CF2H; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H.
[000103] In some embodiments, the compound is represented by:
<img file="IL287787A_D0072.tif" />
<img file="IL287787A_D0073.tif" />
R9
Formula IIA.8-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; and R9 is selected from the group consisting of C!-C3alkyl, H, and C3-C5cycloalkyl. In some embodiments, R1 is CF3; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is bromo; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is CF2H; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H.
[000104] In some embodiments, the compound is represented by:
<img file="IL287787A_D0074.tif" />
Formula IIA.ll-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; and R9 is selected from the group consisting of C!-C3alkyl, H, and C3-C5cycloalkyl. In some embodiments, R1 is CF3; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is bromo; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is CF2H; R2 is selected from the group consisting of C1-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H.
[000105] In some embodiments, the compound is represented by:
<img file="IL287787A_D0075.tif" />
Formula IIA.14-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; and R9 is selected from the group consisting of C1-C3alkyl, H, and C3-C5cycloalkyl. In some embodiments, R1 is CF3; R2 is selected from the group consisting of C1-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is bromo; R2 is selected from the group consisting of C1-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H. In some embodiments, R1 is CF2H; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, bromo, and chloro; and R9 is selected from C!-C3alkyl and H.
[000106] In some embodiments, the compound is represented by:
<img file="IL287787A_D0076.tif" />
wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen. In some embodiments, R1 is CF3; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro. In some embodiments, R1 is bromo; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro. In some embodiments, R1 is CF2H; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro.
[000107] In some embodiments, the compound is represented by:
<img file="IL287787A_D0077.tif" />
<img file="IL287787A_D0078.tif" />
Formula IIA.44-A wherein R1 is selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen. In some embodiments, R1 is CF3; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro. In some embodiments, R1 is bromo; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro. In some embodiments, R1 is CF2H; and R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro.
[000108] In some embodiments, the compound is represented by:
<img file="IL287787A_D0079.tif" />
R4
Formula III or a pharmaceutically acceptable salt thereof, wherein: n is 2, 3, or 4; R1 is selected from the group consisting of halogen, cyano, C!-C5alkyl, and C3-C5cycloalkyl, wherein each CiC5alkyl and C3-C5cycloalkyl may be optionally substituted by one, two or three independent occurrences of fluorine; R2 is selected from the group consisting of C!-C2alkyl, C3C4cycloalkyl, and halogen; R4 is selected from the group consisting of:
<img file="IL287787A_D0080.tif" />
each occurrence of R6 and R9 is independently selected from the group consisting of H, CiC6alkyl, C3-C6cycloalkyl, C(=O)R5, SO2R5, and D, wherein each C!-C6alkyl and C3C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R5 is independently selected from the group consisting of H, CiC6alkyl, C3-C6cycloalkyl, and heterocyclyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine; each occurrence of R7 is independently selected from the group consisting of H, C1-C6 alkyl, and C3-C6cycloalkyl, wherein each C!-C6alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R7 are joined together with the atom to which they are attached to form oxo; D is selected from a C-linked heterocyclyl having at least one nitrogen and optionally having an additional ring nitrogen or oxygen and heteroaryl, wherein D may be optionally substituted on one or more available carbons by R7 and may be optionally substituted on an available nitrogen by R9; Z is selected from the group consisting of:
<img file="IL287787A_D0081.tif" />
each occurrence of R34 is independently selected from H and R36, wherein each occurrence of R36 is independently selected from C!-C6alkyl and C3-C6cycloalkyl, wherein each C!-C5alkyl and C3-C6cycloalkyl may be optionally substituted by one or more independent occurrences of fluorine, or two R36 are joined together with the carbon to which they are attached to form a C3-C6cycloalkyl.
[000109] In some embodiments, R1 is selected from the group consisting of halogen, CiC5alkyl, and C3-C5cycloalkyl, wherein C!.C5alkyl may be optionally substituted with one, two, or three occurrences of fluorine, and C3-C5cycloalkyl. In some embodiments, R1 is CF3.
In some embodiments, R1 is CF2H. In some embodiments, R1 is halogen. In some embodiments, R1 is bromo. In some embodiments, R1 is cyclopropyl.
[000110] In some embodiments, R2 is selected from the group consisting of H, C3C4cycloalkyl, C!-C5alkyl, and halogen. In some embodiments, R2 is selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, anc chloro.
[000111] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0082.tif" />
[000112] In some embodiments, R4 is selected from the group consisting of:
<img file="IL287787A_D0083.tif" />
[000113] In some embodiments, each R6 and R9 is independently selected from the group consisting of H, C!-C6alkyl, and C3-C6cycloalkyl, wherein each of C!-C6alkyl and C3C6cycloalkyl is optionally substituted by one or more independent occurrences of fluorine. [000114] In some embodiments, R7 is H.
[000115] In some embodiments, R34 is selected from the group consisting of H and CiC5alkyl, wherein C!-C5alkyl may be optionally substituted by one, two, or three independent occurrences of fluorine. In some embodiments, two R34 are joined together with the carbon to which they are attached to form C3-C6cycloalkyl;
[000116] In some embodiments, Z is selected from the group consisting of:
<img file="IL287787A_D0084.tif" />
<img file="IL287787A_D0085.tif" />
<img file="IL287787A_D0086.tif" />
<img file="IL287787A_D0087.tif" />
[000117] In some embodiments, Z is selected from the group consisting of:
<img file="IL287787A_D0088.tif" />
<img file="IL287787A_D0089.tif" />
[000118] In some embodiments, n is 3.
[000119] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0090.tif" />
<img file="IL287787A_D0091.tif" />
<img file="IL287787A_D0092.tif" />
<img file="IL287787A_D0093.tif" />
N
R9
Formula IIIA.2 &#1497;
Formula IIIA.3
&#1494;
<img file="IL287787A_D0094.tif" />
<img file="IL287787A_D0095.tif" />
<img file="IL287787A_D0096.tif" />
N
R9
Formula IIIA.4
Formula IIIA.5,
<img file="IL287787A_D0097.tif" />
Formula IIIA.6 ’ Formula IIIA.7 , and Formula IIIA.8
R34 R34 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3C5cycloalkyl; and n is 3.
[000120] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[000121] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C1-C3alkyl; each R34 is H; and n is 3.
[000122] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl.; and n is 3 In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[000123] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0098.tif" />
<img file="IL287787A_D0099.tif" />
<img file="IL287787A_D0100.tif" />
N
R9
Formula IIIA.9 , and
Formula IIIA.10 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C1-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; and n is 3.
[000124] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C1-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C1-C3alkyl and C3C4cycloalkyl; each occurrence of R9 is independently selected from H and C!-C3alkyl; and n is 3.
[000125] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0101.tif" />
<img file="IL287787A_D0102.tif" />
N
R9
Formula IIIA.ll ’
<img file="IL287787A_D0103.tif" />
<img file="IL287787A_D0104.tif" />
Formula IIIA.13
<img file="IL287787A_D0105.tif" />
<img file="IL287787A_D0106.tif" />
<img file="IL287787A_D0107.tif" />
<img file="IL287787A_D0108.tif" />
Formula IIIA.15 &#1523;
Formula IIIA.16 , and Formula IIIA.17 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3C5cycloalkyl; and n is 3.
[000126] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[000127] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C1-C3alkyl; each R34 is H; and n is 3.
[000128] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl.; and n is 3 In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[000129] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0109.tif" />
<img file="IL287787A_D0110.tif" />
<img file="IL287787A_D0111.tif" />
N
R9
<img file="IL287787A_D0112.tif" />
N
R9
Formula IIIA.18 &#1497; and Formula IIIA.19 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C1-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; and n is 3.
[000130] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from the group consisting of C1-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from the group consisting of C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and C1-C3alkyl; and n is 3.
[000131] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0113.tif" />
<img file="IL287787A_D0114.tif" />
<img file="IL287787A_D0115.tif" />
Formula IIIA.21
&#1494;
<img file="IL287787A_D0116.tif" />
<img file="IL287787A_D0117.tif" />
<img file="IL287787A_D0118.tif" />
<img file="IL287787A_D0119.tif" />
Formula IIIA.22
<img file="IL287787A_D0120.tif" />
Formula IIIA.23
<img file="IL287787A_D0121.tif" />
wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3-C5cycloalkyl; and n is 3.
[000132] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[000133] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[000134] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[000135] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0122.tif" />
Formula IIIA.27 Formula IIIA.28 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
[000136] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
[000137] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0123.tif" />
<img file="IL287787A_D0124.tif" />
<img file="IL287787A_D0125.tif" />
<img file="IL287787A_D0126.tif" />
<img file="IL287787A_D0127.tif" />
wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3C5cycloalkyl; and n is 3.
[000138] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from CiC2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[000139] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is independently selected from H and C1-C3alkyl; each R34 is H; and n is 3.
[000140] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl.; and n is 3 In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R9 is selected from H and C!-C3alkyl; each R34 is H; and n is 3.
[000141] In some embodiments, the compound is represented by a formula selected from:
<img file="IL287787A_D0128.tif" />
<img file="IL287787A_D0129.tif" />
<img file="IL287787A_D0130.tif" />
N
R9
Formula IIIA.36 &#1497; and
Formula IIIA.37 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from the group consisting of H, C!-C3alkyl, and C3-C5cycloalkyl; and n is 3.
[000142] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is selected from H and C!-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; each occurrence of R9 is independently selected from H and C1-C3alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3C4cycloalkyl; each occurrence of R9 is independently selected from H and C1-C3alkyl; and n is 3.
[000143] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0131.tif" />
<img file="IL287787A_D0132.tif" />
<img file="IL287787A_D0133.tif" />
Formula IIIA.39
<img file="IL287787A_D0134.tif" />
Formula IIIA.40 ’
<img file="IL287787A_D0135.tif" />
<img file="IL287787A_D0136.tif" />
wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C!-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R34 is selected from the group consisting of H, C!-C2alkyl, and C3-C5cycloalkyl; and n is 3.
[000144] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[000145] In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C!-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[000146] In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R34 is independently selected from the group consisting of H and C1-C2alkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from C!-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each R34 is H; and n is 3.
[000147] In some embodiments, the compound is represented by a formula selected from the group consisting of:
<img file="IL287787A_D0137.tif" />
Formula IIIA.45 and Formula IIIA.46 wherein each occurrence of R1 is independently selected from the group consisting of bromo, chloro, CF3, CF2H, and cyclopropyl; each occurrence of R2 is independently selected from the group consisting of C1-C2alkyl, C3-C4cycloalkyl, and halogen; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
[000148] In some embodiments, each occurrence of R1 is bromo; each occurrence of R2 is independently selected from C1-C2alkyl, C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF3; each occurrence of R2 is independently selected from C1-C2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3. In some embodiments, each occurrence of R1 is CF2H; each occurrence of R2 is independently selected from CiC2alkyl,C3-C4cycloalkyl, bromo, and chloro; each occurrence of R6 is independently selected from C!-C3alkyl and C3-C4cycloalkyl; and n is 3.
In an embodiment, described herein is a compound selected from the group consisting of: 1(3-((5-bromo ((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((4-(4-ethylpiperazin-l-yl)-2methylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3((5-chloro ((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)pyri midin-4yl)amino)propyl)piperidin one, l-(3-((2-((2-cyclopropyl (4-methyl-l,4-diazepan-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3-((5chloro ((2-methyl (l-methylpiperidin yl)phenyl)amino)pyrimi din-4yl)amino)propyl)piperidin one, (R)-l-(3-ethyl ((4-((3-(2-oxopiperidin-lyl)propyl)amino) (trifluoromethyl)pyrimidin yl)amino)phenyl)pyrrolidine carbonitrile, l-(3-((2-((4-(4-cyclopropylpiperazin-l-yl) methylphenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, l-(3-((5-bromo ((2isopropyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)piperidin-2one, l-(3-((2-((2-ethyl (4-ethylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin4-yl)amino)propyl)piperidin one, l-(3-((2-((2-cyclopropyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 4-(3cyclopropyl ((4-((3-(2-oxopiperidin-l-yl)propyl)amino) (trifluoromethyl)pyrimi din-2yl)amino)phenyl)-l-methylpiperazin one, l-(3-((5-bromo ((4-(4-ethylpiperazin-l-yl)-2isopropylphenyl)amino)pyrimidin yl)amino)propyl)piperidin one, l-(3-((2-((2-ethyl-4(4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyri midin-4yl)amino)propyl)piperidin one, l-(3-((2-((2-methyl (l-methylpiperidin-4yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3-((5chloro ((4-(4-ethylpiperazin-l-yl) isopropylphenyl)amino)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((2-cyclopropyl (piperazin-l-yl)pheny !)amino)5-(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, l-(3-((2-((2-cyclopropyl-5fluoro (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimi din-4yl)amino)propyl)piperidin one, l-(3-((2-((2-methyl (piperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, l-(3-((2-((2-methyl (4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyri midin-4yl)amino)propyl)piperidin one, l-(3-((2-((4-(4-(2-fluoroethyl)piperazin-l-yl)-2 methylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3((5-chloro ((2-methyl (piperidin yl)phenyl)amino)pyri midin-4yl)amino)propyl)piperidin one, l-(3-((2-((4-(4-acetylpiperazin-l-yl)-2cyclopropylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, l-(3-((5-chloro ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimi din-4yl)amino)propyl)piperidin one, (S)-l-(3-ethyl ((4-((3-(2-oxopiperidin-lyl)propyl)amino) (trifluoromethyl)pyrimidin yl)amino)phenyl)pyrrolidine carbonitrile, l-(3-((5-bromo ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((4-(4-isopropylpiperazin-l-yl)-2methylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3((2-((2-isopropyl (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((4-(4-cyclobutylpiperazin-l-yl)-2methylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3((2-((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, l-(3-((2-((2-cyclopropyl (4ethylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((2-methyl (piperidin yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3-((2-((4-(1,4-diazepan-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3-((2((2-ethyl (4-methyl-1,4-diazepan-1 -yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((4-(4-ethylpiperazin-l-yl)-2isopropylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1(3-((2-((4-(4-ethyl-l,4-diazepan-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((4-methyl morpholinopyridin yl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 3-(3-((2-((2-ethyl (4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3oxazinan one, 3-(3-((2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((5-chloro ((2ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3-oxazinan2-one, 3-(3-((5-bromo ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, 3-(3-((5-cyclopropyl ((2-ethyl (4methylpiperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3((2-((2-ethyl (piperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-cyclopropyl (piperazin-l yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3((5-bromo ((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-methyl (piperazin-l-yl)pheny!)amino)5-(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-ethyl-4((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, rac-(R) (3-((2-((2ethyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, rac-(R) (3-((2-((2cyclopropyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-ethyl (4methyl oxopiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyri midin yl)amino)propyl)l,3-oxazinan one, 3-(3-((2-((2-methyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 4-(3-((2-((2-cyclopropyl4-(4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)morpholin one, l-(3-((2-((2-cyclopropyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)azepan one, 4-(3-((2((2-ethyl morpholinophenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 4-(3-((2-((2-cyclopropyl morpholinophenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2cy clopropy 1 (4-methy Ipiperazin-1 -yl)pheny 1) amino)- 5 - (trifluoromethyl)py rimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4(3-((5-chloro ((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-chloro ((2-ethyl-4morpholinophenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5chloro ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)l,4-oxazepan one, 4-(3-((5-chloro ((2-cyclopropyl-4morpholinophenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4ethylpiperazin-l-yl) isopropylphenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-cyclopropyl ((2-ethyl (4methylpiperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3((2-((2-cyclopropyl (piperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (4-methyl-l,4-diazepan-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 455 (3-((2-((2-ethyl fluoro (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-bromo ((2cyclopropyl (4-methylpiperazin-1 -yl)phenyl)amino)pyrimidin yl)amino)propyl)-1,4oxazepan one, 4-(3-((5-bromo ((2-ethyl (4-methylpiperazin-lyl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-bromo ((2isopropyl (4-methylpiperazin yl)phenyl)amino)pyrimidin yl)amino)propyl)-1,4oxazepan one, 4-(3-((2-((2-methyl (4-methylpiperazin-1 -yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 4-(3-((2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2cyclopropyl morpholinophenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)l,4-oxazepan one, 4-(3-((2-((2-ethyl morpholinophenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4ethylpiperazin-l-yl) isopropylphenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-methyl (piperazin-l-yl)phenyl)amino)5-(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-bromo ((2ethyl (4-methylpiperazin-1 -yl)phenyl)amino)pyrimidin yl)amino)propyl)-1,4-oxazepan5-one, rac (3-((2-((4-((lR,4R) oxa azabicyclo[2.2.1]heptan yl)-2methylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (4-methyl-l,4-diazepan-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-chloro ((2ethyl (4-methylpiperazin-1 -yl)phenyl)amino)pyrimidin yl)amino)propyl)-1,4-oxazepan5-one, 4-(3-((5 -bromo ((2-cyclopropy 1 (4-methylpiperazin-1 -y!)phenyl)amino)pyrimidin4-yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-chloro ((2-cyclopropyl (4methylpiperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3((5-cyclopropyl ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (piperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2cyclopropyl (piperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl fluoro (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4(3-((5-bromo ((2-isopropyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-chloro ((2-isopropyl (4-methylpiperazin l-yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-chloro ((2cyclopropyl (piperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan-5one, 4-(3-((2-((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan-3yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, rac(R) (3-((2-((2-ethyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 1-(3-((2-((2cyclopropy 1 (4-methy Ipiperazin-1 -yl)pheny 1) amino)- 5 - (trifluoromethyl)py ridin-4yl)amino)propyl)piperidin one, 4-(3-((2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-l,4-oxazepan one, 4-(3((2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyridin-4yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((4-(4-methylpiperazin-l-yl)phenyl)amino)5-(trifluoromethyl)pyridin yl)amino)propyl)-l,3-oxazinan one, 1-(3-((2-((4-(4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)piperidin2-one, l-(3-((2-((4-methyl (4-methylpiperazin-l-yl)pyridin yl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)piperidin one, l-(3-((2-((4-methyl-6morpholinopyridin yl)amino) (trifluoromethyl)pyridin yl)amino)propyl)piperidin-2one, 4-(3-((5-chloro ((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)pyridin-4yl)amino)propyl)-l,4-oxazepan one, l-(3-((5-cyclopropyl ((4-(4-cyclopropylpiperazin-lyl)phenyl)amino)pyrimidin yl)amino)propyl)-5,5-dimethylpyrrolidin one, 1-(3-((2-((2methyl (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimi din-4yl)amino)propyl)pyrrolidin one, l-(3-((2-((2-methyl (piperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)pyrrolidin one, l-(3-((2-((2-ethyl (4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)pyrrolidin one, l-(3-((2-((4-methyl (4-methylpiperazin-l-yl)pyridin-3yl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3-((2-((5-(4methylpiperazin-l-yl)pyridin yl)amino) (trifluoromethyl)pyridin-4yl)amino)propyl)piperidin one, 4-(3-((2-((4-ethyl (4-methylpiperazin-l-yl)pyridin-3yl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2((4-ethyl (4-methylpiperazin-l-yl)pyridin yl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, (R) (3-((2-((2-cyclopropyl-4(hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl ((lS,4S) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((2-ethyl ((lS,4S) methyl-2,5 diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, 4-(3-((2-((2-cyclopropyl ((lS,4S) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((2-cyclopropyl ((lS,4S) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, 4-(3-((2-((2-ethyl ((lR,4R) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-cyclopropyl ((lR,4R) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((2-ethyl ((lR,4R) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, l-(3-((2-((2-cyclopropyl (3(dimethylamino)azetidin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one, 4-(3-((2-((2-(methoxymethyl) (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 3(3-((2-((4-ethyl (4-methylpiperazin-l-yl)pyridin yl)amino) (trifluoromethyl)pyrimidin4-yl)amino)propyl)-l,3-oxazinan one, 2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) ((3-(5-oxo-l,4-oxazepan yl)propyl)amino)pyrimidine carbonitrile, 3(3-((2-((2-cyclopropyl ((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan-2yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, (S)2-(4-(3-ethyl ((4-((3-(2-oxo-l,3-oxazinan yl)propyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)phenyl)-1 -methylpiperazin yl)acetonitrile, (R) (4(3-ethyl ((4-((3-(2-oxo-l,3-oxazinan yl)propyl)amino) (trifluoromethyl)pyrimidin-2yl)amino)phenyl)-l-methylpiperazin yl)acetonitrile, (S) (l-methyl (3-methyl ((4-((3(5-oxo-l,4-oxazepan yl)propyl)amino) (trifluoromethyl)pyrimidin-2yl)amino)phenyl)piperazin yl)acetonitrile, (R) (l-methyl (3-methyl ((4-((3-(5-oxol,4-oxazepan yl)propyl)amino) (trifluoromethyl)pyrimidin yl)amino)phenyl)piperazin2-yl)acetonitrile, 4-(3-((5-(difluoromethyl) ((2-ethyl (4-methylpiperazin-lyl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 3-(3-((5(difluoromethyl) ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, 2-((2-ethyl (4-methylpiperazin-l-yl)pheny!)amino)4-((3-(2-oxo-l,3-oxazinan yl)propyl)amino)pyrimidine carbonitrile, 4-(3-((2-((2-ethyl-4(l-methylpiperidin yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 4-(3-((2-((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan-8 yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4(3-((2-((2-ethyl (9-methyl-3,9-diazabicyclo[3.3.1]nonan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (3methyl-3,9-diazabicyclo[3.3.1]nonan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, (S) (3-((2-((4-(3-(dimethylamino)pyrrolidin-l-yl)-2ethylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, (R) (3-((2-((4-(3-(dimethylamino)pyrrolidin-l-yl) ethylphenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (lmethylpyrrolidin yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 4-(3-((2-((2-ethynyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-(ethynyl-d)4-(4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)l,4-oxazepan one, 4-(3-((2-((2-(ethyl-d5) (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4methylpiperazin-l-yl) (2,2,2-trifluoroethyl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-(l,l-difluoroethyl) (4-methylpiperazinl-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 5(4-methylpiperazin-l-yl) ((4-((3-(5-oxo-l,4-oxazepan yl)propyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)benzonitrile, 2-methyl (5-(4-methylpiperazin-l-yl)2-((4-((3-(5-oxo-l,4-oxazepan yl)propyl)amino) (trifluoromethyl)pyrimidin-2yl)amino)phenyl)propanenitrile, 2-(5-(4-methylpiperazin-l-yl) ((4-((3-(5-oxo-l,4oxazepan yl)propyl)amino) (trifluoromethyl)pyrimidin yl)amino)phenyl)acetonitrile, 4-(3-((2-((4-(4-methylpiperazin-l-yl) (trifluoromethyl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2(difluoromethyl) (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-bromo (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4(3-((2-((2-chloro (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-cyclopropyl (3(dimethylamino)azetidin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-cyclopropyl (3((dimethylamino)methyl)azetidin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, l-(3-((2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-3 methyltetrahydropyrimidin-2(lH)-one, l-(3-((2-((2-cyclopropyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-3methyltetrahydropyrimidin-2(lH)-one, 3-(3-((2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazepan one, 3(3-((2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazepan one, l-(3-((2-((2-ethyl (4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-4methyl-l,4-diazepan one, l-(3-((2-((2-cyclopropyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl) methyl-l,4-diazepan-2one, 4-(3-((2-((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propy 1) methyl-l,4-diazepan one, 4-(3-((2-((2cy clopropy 1 (4-methy Ipiperazin-1 -yl)pheny 1) amino)- 5 - (trifluoromethyl)py rimidin-4yl)amino)propyl)-l-methyl-l,4-diazepan one, l-(3-((2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl) methyl-l,3-diazepan-2one, l-(3-((2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl) methyl-l,3-diazepan one, 3-(3-((2-((2cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) (difluoromethyl)pyrimidin-4yl)amino)propyl)-l,3-oxazinan one, 3-(3-((5-(difluoromethyl) ((2-ethyl ((lR,5S)-8methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3oxazinan one, 3-(3-((2-((2-cyclopropyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan3-yl)phenyl)amino) (difluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3(3-((5-(difluoromethyl) ((2-ethyl ((lS,4S) methyl-2,5-diazabicyclo[2.2.1]heptan-2yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((5(difluoromethyl) ((2-ethyl ((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan-2yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3-oxazinan one, (R) (3-((5(difluoromethyl) ((2-ethyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3-oxazinan one, (S) (3-((5(difluoromethyl) ((2-ethyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((5(difluoromethyl) ((2-ethyl (piperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)l,3-oxazinan one, 3-(3-((2-((2-cyclopropyl (piperazin-l-yl)phenyl)amino)-5(difluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 1-(3-((5(difluoromethyl) ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl) methyltetrahydropyrimidin-2(lH)-one, l-(3-((2-((2-cyclopropyl (4 methylpiperazin-l-yl)phenyl)amino) (difluoromethyl)pyrimidin yl)amino)propyl)-3methyltetrahydropyrimidin-2(lH)-one, 4-(3-((5-(difluoromethyl) ((2-ethyl (4methylpiperazin-l-yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3((2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) (difluoromethyl)pyrimidin4-yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-cyclopropyl (4-methylpiperazin-lyl)phenyl)amino) (difluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 3(3-((5-(difluoromethyl) ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-l,3-oxazepan one, 3-(3-((2-((2-cyclopropyl (4-methylpiperazin-lyl)phenyl)amino) (difluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazepan one, 1(3-((5-(difluoromethyl) ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl) methyl-l,4-diazepan one, l-(3-((2-((2-cyclopropyl (4methylpiperazin-l-yl)phenyl)amino) (difluoromethyl)pyrimidin yl)amino)propyl)-4methyl-l,4-diazepan one, 4-(3-((5-(difluoromethyl) ((2-ethyl (4-methylpiperazin-lyl)phenyl)amino)pyrimidin yl)amino)propy 1) methyl-l,4-diazepan one, 4-(3-((2-((2cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) (difluoromethyl)pyrimidin-4yl)amino)propyl)-l-methyl-l,4-diazepan one, l-(3-((5-(difluoromethyl) ((2-ethyl (4methylpiperazin yl)phenyl)amino)pyrimidin yl)amino)propyl) methyl-1,3-diazepan-2one, l-(3-((2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino)-5(difluoromethyl)pyrimidin yl)amino)propyl) methyl-l,3-diazepan one, 2-((2cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan-3yl)propyl)amino)pyrimidine carbonitrile, 2-((2-cyclopropyl ((lR,5S) methyl-3,8diazabicyclo[3.2.1]octan yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan-3yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl ((lR,5S) methyl-3,8diazabicyclo[3.2.1]octan yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan-3yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl ((lS,4S) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan-3yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl ((lR,4R) methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan-3yl)propyl)amino)pyrimidine carbonitrile, (R) ((2-ethyl (hexahydropyrrolo[l,2a]pyrazin-2(lH)-yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan yl)propyl)amino)pyrimidine5-carbonitrile, (S) ((2-ethyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino)-4((3-(2-oxo-l,3-oxazinan yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl-4(piperazin-l-yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan yl)propyl)amino)pyrimidine-5carbonitrile, 2-((2-cyclopropyl (piperazin-l-yl)phenyl)amino) ((3-(2-oxo-l,3-oxazinan
3-yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) ((3-(3-methyl oxotetrahydropyrimidin-l(2H)yl)propyl)amino)pyrimidine carbonitrile, 2-((2-cyclopropyl (4-methylpiperazin-1 yl)phenyl)amino) ((3-(3-methyl oxotetrahydropyrimidin-l(2H)yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl (4-methylpiperazin-1 yl)phenyl)amino) ((3-(3-oxo-l,4-oxazepan yl)propyl)amino)pyrimidine carbonitrile, 2((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) ((3-(3-oxo-l,4-oxazepan-4yl)propyl)amino)pyrimidine carbonitrile, 2-((2-cyclopropyl (4-methylpiperazin-1 yl)phenyl)amino) ((3-(5-oxo-l,4-oxazepan yl)propyl)amino)pyrimidine carbonitrile, 2((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino) ((3-(2-oxo-l,3-oxazepan-3yl)propyl)amino)pyrimidine carbonitrile, 2-((2-cyclopropyl (4-methylpiperazin-1 yl)phenyl)amino) ((3-(2-oxo-l,3-oxazepan yl)propyl)amino)pyrimidine carbonitrile, 2((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) ((3-(4-methyl oxo-l,4diazepan-l-yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl (4-methylpiperazin-lyl)phenyl)amino) ((3-(4-methyl oxo-l,4-diazepan-l-yl)propyl)amino)pyrimidine-5carbonitrile, 2-((2-cyclopropyl (4-methylpiperazin-l-yl)phenyl)amino) ((3-(4-methyl-7oxo-l,4-diazepan-l-yl)propyl)amino)pyrimidine carbonitrile, 2-((2-ethyl (4methylpiperazin-l-yl)phenyl)amino) ((3-(3-methyl oxo-l,3-diazepan-lyl)propyl)amino)pyrimidine carbonitrile, 2-((2-cyclopropyl (4-methylpiperazin-1 yl)phenyl)amino) ((3-(3-methyl oxo-l,3-diazepan-l-yl)propyl)amino)pyrimidine-5carbonitrile, l-(3-((2-((2-cyclopropyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan-3yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 1-(3-((2((2-cyclopropyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(difluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 3-(3-((2-((2-ethyl ((lR,5S)8-methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-6,6-dimethyl-l,3-oxazinan one, 4-(3-((2-((2-cyclopropyl ((lR,5S)-8methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-cyclopropyl (5-methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (difluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5-(difluoromethyl) ((2-ethyl (5-methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan-5one, 4-(3-((5-(difluoromethyl) ((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan3-yl)phenyl)amino)pyrimidin yl)amino)propyl)-1,4-oxazepan one, 4-(3-((2-((2-ethyl-4((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-562 (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((5(difluoromethyl) ((2-ethyl (5-methyl-2,5-diazabicyclo[2.2.1]heptan-2yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (5methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 3-(3-((5-(difluoromethyl) ((2-ethyl ((lR,5S)-8methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)pyrimidin yl)amino)propyl)-l,3oxazepan one, 3-(3-((2-((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan-3yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazepan one, 4(3-((2-((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-6,6-dimethyl-l,4-oxazepan one, 3-(3-((2-((2-ethyl (4-methylpiperazinl-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-6,6-dimethyl-l,3oxazinan one, 4-(3-((2-((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan-3yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-2,2-dimethyl-l,4oxazepan one, 4-(3-((2-((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-2,2-dimethyl-l,4-oxazepan one, 4-(3-((5(difluoromethyl) ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)-6,6-dimethyl-l,4-oxazepan one, 8-(3-((2-((2-ethyl (4-methylpiperazinl-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl) oxa-8azaspiro[2.6]nonan one, 4-(3-((2-((4-(1,4-diazabicyclo[3.2. l]octan yl)-2ethylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4(3-((2-((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-6,6-dimethyl-l,4-oxazepan one, 4-(3-((5(difluoromethyl) ((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan-3yl)phenyl)amino)pyrimidin yl)amino)propyl)-6,6-dimethyl-l,4-oxazepan one, 4-(3-((2((4-(1,4-diazabicyclo[3.2. l]octan yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin4-yl)amino)propyl)-6,6-dimethyl-l,4-oxazepan one, 4-(3-((2-((4-(1,4diazabicyclo[3.2.1]octan yl) ethylphenyl)amino) (difluoromethyl)pyrimidin-4yl)amino)propyl)-6,6-dimethyl-l,4-oxazepan one, l-(3-((2-((2-ethyl (4-methylpiperazinl-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)azetidin one, 1-(3-((2((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-3,3-dimethylazetidin one, 1-(3-((2-((4-(1,4-diazabicyclo[3.2. l]octan-4yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)azetidin one, 1(3-((2-((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)azetidin one, l-(3-((2-((2-ethyl ((lR,5S)
8-methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-3,3-dimethylazetidin one, 1-(3-((2-((4-(1,4-diazabicyclo[3.2. l]octan-4yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-3,3dimethylazetidin one, l-(3-((2-((2-ethyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)azetidin one, 1-(3-((2((2-ethyl (hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-3,3-dimethylazetidin one, 1-(3-((2-((2ethyl (5-methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)azetidin one, l-(3-((2-((2-ethyl (5-methyl2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-3,3-dimethylazetidin one, l-(3-((2-((2-ethyl (5-methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)pyrrolidin one, l-(3-((5-(difluoromethyl) ((2-ethyl (5-methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino)pyrimidin yl)amino)propyl)pyrrolidin one, l-(3-((2-((2-ethyl (5-methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-3,3-dimethylpyrrolidin one, 1-(3-((2-((2ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)pyrrolidin one, l-(3-((5-(difluoromethyl)-2((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)pyrimidin-4yl)amino)propyl)pyrrolidin one, l-(3-((2-((2-ethyl ((lR,5S) methyl-3,8diazabicyclo[3.2.1]octan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-3,3-dimethylpyrrolidin one, l-(3-((2-((4-(l,4-diazabicyclo[3.2.1]octan-4yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)pyrrolidin one, l-(3-((2-((4-(l,4-diazabicyclo[3.2.1]octan yl) ethylphenyl)amino)-5(difluoromethyl)pyrimidin yl)amino)propyl)pyrrolidin one, 1-(3-((2-((4-(1,4diazabicyclo[3.2.1]octan yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-3,3-dimethylpyrrolidin one, l-(3-((2-((2-ethyl (hexahydropyrrolo[l,2a]pyrazin-2(lH)-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)pyrrolidin one, l-(3-((5-(difluoromethyl) ((2-ethyl-4(hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino)pyrimi din-4yl)amino)propyl)pyrrolidin one, l-(3-((2-((2-ethyl (hexahydropyrrolo[l,2-a]pyrazin2(lH)-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-3,3dimethylpyrrolidin one, l-(3-((5-chloro ((2-ethyl (5-methyl-2,5diazabicyclo[2.2.1]heptan yl)phenyl)amino)pyrimidin yl)amino)propyl)pyrrolidin one, l-(3-((5-chloro ((2-ethyl ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan-3yl)phenyl)amino)pyrimidin yl)amino)propyl)pyrrolidin one, 1-(3-((2-((4-(1,4diazabicyclo[3.2.1]octan yl) ethylphenyl)amino) chloropyrimidin-4yl)amino)propyl)pyrrolidin one, 1 -(3-((5-chloro ((2-ethyl (hexahydropyrrolo[l ,2a]pyrazin-2(lH)-yl)phenyl)amino)pyrimidin yl)amino)propyl)pyrrolidin one, 1-(3-((5bromo ((2-ethyl (5-methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)pyrimidin4-yl)amino)propyl)pyrrolidin one, l-(3-((5-bromo ((2-ethyl ((lR,5S) methyl-3,8diazabicyclo[3.2.1]octan yl)phenyl)amino)pyrimidin yl)amino)propyl)pyrrolidin one, l-(3-((2-((4-(l,4-diazabicyclo[3.2.1]octan yl) ethylphenyl)amino) bromopyrimidin-4yl)amino)propyl)pyrrolidin one, l-(3-((5-bromo ((2-ethyl (hexahydropyrrolo[l,2a]pyrazin-2(lH)-yl)phenyl)amino)pyrimidin yl)amino)propyl)pyrrolidin one, 4-(3-((2((4-(3- (diethy lamino)propy 1) ethy Ipheny 1) amino) -5 - (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-cyclopropyl (3morpholinopropyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 3-(3-((2-((2-ethyl (2-(pyrrolidin-l-yl)ethyl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-cyclopropyl4-((dimethylamino)methyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)l,3-oxazinan one, 3-(3-((2-((2-cyclopropyl (4-methylpiperazine-lcarbonyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan-2one, 3-methoxy-N-(l-methylpiperidin yl) ((4-((3-(5-oxo-l,4-oxazepan-4yl)propyl)amino) (trifluoromethyl)pyrimidin yl)amino)benzamide, 4-(3-((2-((4-(4(diethylamino)piperidin-l-yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, (S) (3-((2-((2-cyclopropyl (3(dimethylamino)pyrrolidin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, l-(3-((2-((2-cyclopropyl-4(morpholinomethyl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one, l-(3-((2-((2-ethyl (2-(pyrrolidin-l-yl)propan-2yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 4-(3-((2((2-ethyl (2-(4-methylpiperazin-l-yl) oxoethyl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4((dimethylamino)methyl)piperidin-l-yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin4-yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4-(dimethylglycyl)piperazin-l-yl)-2ethylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4(3-((2-((4-(3,3-dimethylpiperazin-l-yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin65
4-yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (3,3,5,5-tetramethylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4(3-((2-((2-cyclopropyl (3,4,5-trimethylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl-4(3,3,4-trimethylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-ethyl (3,3,4,5,5-pentamethylpiperazinl-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 1(3-((2-((2-chloro (3,4-dimethylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin4-yl)amino)propyl)azepan one, 3-(3-((2-((4-(hexahydropyrrolo[l,2-a]pyrazin-2(lH)yl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-l,3-oxazepan one, 4-(3((2-((4-(hexahydropyrrolo[l,2-a]pyrazin-2(lH)-yl)phenyl)amino) (trifluoromethyl)pyridin4-yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(octahydro-2H-pyrido[l,2-a]pyrazin-2yl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-l,4-oxazepan one, 3-(3((2-((4-(4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyridin-4yl)amino)propyl)-l,3-oxazepan one, 4-(3-((2-((4-(4-methylpiperazin-l-yl)phenyl)amino)5-(trifluoromethyl)pyridin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(5-methyl2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino) (trifluoromethyl)pyridin-4yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((2-bromo (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-l,3-oxazepan one, 4-(3((2-((2-methyl (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyridin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((6-(5-methyl-2,5-diazabicyclo[2.2.1]heptan2-yl)pyridin yl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-l,4-oxazepan one, l-(3-((2-((4-((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)azepan one, l-(3-((2-((2-cyclopropyl (5methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino) (difluoromethyl)pyridin-4yl)amino)propyl)pyrrolidin one, 4-(3-((2-((4-(4-methylpiperazin-l-yl)-2(trifluoromethyl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-l,4-oxazepan5-one, 4-(3-((2-((2-methyl (4-(methylsulfonyl)piperazin-1 -yl)phenyl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4(dimethylglycyl)piperazin-l-yl)phenyl)amino) (trifluoromethyl)pyridin-4yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((2-ethyl (4-methylpiperazine-lcarbonyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan-2one, l-(3-((2-((2-cyclopropyl (morpholinomethyl)phenyl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)piperidin one, 3-(3-((2-((2-ethyl (266 (pyrrolidin-1 -yl)ethyl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-1,3oxazinan one, 3-(3-((2-((2-fluoro (3-morpholinopropyl)phenyl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)-l,3-oxazinan one, l-(3-((2-((2-cyclopropyl-4((l,l-dioxidothiomorpholino)methyl)phenyl)amino) (trifluoromethyl)pyridin-4yl)amino)propyl)piperidin one, l-(3-((2-((2-cyclopropyl ((4-methylpiperazin-lyl)sulfony!)phenyl)amino) (trifluoromethyl)pyridin y 1)amino)propyl)piperidin one, 3(3-((2-((4-(3-(diethylamino)propyl) (trifluoromethyl)phenyl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)-l,3-oxazinan one, 4-(3-((2-((2-chloro (3,4dimethylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyridin yl)amino)propyl)-l,4oxazepan one, l-(3-((2-((2-cyclopropyl (morpholinosulfonyl)phenyl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)piperidin one, 3-(3-((2-((2-(2-hydroxypropan2-yl) (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimi din-4yl)amino)propyl)-l,3-oxazinan one, 4-(3-((2-((2-(2-hydroxypropan yl) (4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 4-(3-((2-((2-(l-hydroxyethyl) (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-methyl-4((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-chloro-4((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-(1hydroxyethyl) ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-methyl-4((lS,4S) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-chloro-4((lS,4S) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-(1hydroxyethyl) ((lS,4S) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-methyl-4((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-chloro-4((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-(1hydroxyethyl) ((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((2-chloro (4 methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,3oxazinan one, 3-(3-((2-((2-(l-hydroxyethyl) (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-chloro-4((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-(1hydroxyethyl) ((lR,5S) methyl-3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-methyl-4((lS,4S) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-chloro-4((lS,4S) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-(1hydroxyethyl) ((lS,4S) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-methyl-4((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-chloro-4((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-(1hydroxyethyl) ((lR,4R) methyl-2,5-diazabicyclo[2.2.1]heptan yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,3-oxazinan one, 4-(3-((2-((2-methyl (4methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 4-(3-((2-((2-chloro (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-(1hydroxyethyl) (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-methyl ((lR,5S) methyl-3,8diazabicyclo[3.2.1]octan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-chloro ((lR,5S) methyl-3,8diazabicyclo[3.2.1]octan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((2-(l-hydroxyethyl) ((lR,5S) methyl3,8-diazabicyclo[3.2.1]octan yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4-methylpiperazin-l-yl)-2(trifluoromethoxy)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4oxazepan one, 4-(3-((2-((2-(difluoromethoxy) (4-methylpiperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 3-(3-((2-((2(methoxymethyl) (4-methylpiperazin-l-yl)phenyl)amino) (trifluoromethyl)pyrimi din-4 yl)amino)propyl)-l,3-oxazinan one, 3-(3-((2-((2-cyclopropyl (4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-6,6-dimethyl-l,3oxazinan one, 4-(3-((2-((4-((lR,5S)-3,8-diazabicyclo[3.2.1]octan yl)-2ethylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, 1(3-((2-((2-cyclopropyl (3-((dimethylamino)methyl)azetidin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one, 4-(3-((2-((4-(3((dimethylamino)methyl)azetidin-l-yl) ethylphenyl)amino) (trifluoromethyl)pyrimidin4-yl)amino)propyl)-l,4-oxazepan one, 4-(3-((2-((4-(4-methylpiperazin-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)-l,4-oxazepan one, and pharmaceutically acceptable salts, enantiomers, stereoisomers, and tautomers thereof.
Methods of Treatment
[000149] Compounds described herein can act as inhibitors of autophagy useful in the treatment of a disorder in a patient in need thereof. The disorder, for example, can be a tumor, e.g., a solid tumor. The disorder may also be cancer.
[000150] Exemplary disorders also include gastrointestinal stromal tumors, esophageal cancer, gastric cancer, melanomas, gliomas, glioblastomas, ovarian cancer, bladder cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, renal cancers, hepatic cancers, osteosarcomas, multiple myelomas, cervical carcinomas, cancers that are metastatic to bone, papillary thyroid carcinoma, non-small cell lung cancer, and colorectal cancers. A cancer treated by the methods described herein may be a metastatic cancer.
[000151] In some embodiments, the compounds described herein are useful for the treatment of cancers caused by RAS mutation. In some embodiments, the cancer is caused by a KRAS mutation. In some embodiments, the cancer has additional mutations in tumor suppressor proteins, including mutations in TP53, PTEN, CDN2A/INK4A, pl6, or STAG2. In some embodiments, these additional mutations occur in one or more of TP53, PTEN, CDN2A/INK4A, pl6, or STAG2. In some embodiments, the cancer is pancreatic ductal adenocarcinoma. In some embodiments, the cancer is lung cancer. In some embodiments, the cancer is colorectal.
[000152] In some embodiments, determination of cellular inhibition of autophagy by compounds described herein is determined by monitoring of autophagic flux, for instance by monitoring inhibition of autophagy-mediated clearance of mCherry/GFP-LC3 fusion protein. In some embodiments, determination of cellular inhibition of autophagy by compounds described herein is determined by monitoring of accumulation of autophagic proteins such as p62 or LC-3. In some embodiments, determination of cellular inhibition of autophagy by compounds described herein is determined by decreased clearance of luciferase-tagged LC3 protein. In some embodiments, determination of cellular inhibition of autophagy by compounds described herein is determined by monitoring decreases in cellular autophagosomes, for instance by measurement of fluorescent puncta with the autophagosome marker Cyto-ID.
[000153] In some embodiments, cellular inhibition of ULK kinase by compounds described herein is determined by inhibition of phosphorylation of cellular ULK substrates including ATG13, ATG14, Beclin 1, or STING either in tumor cells or in non-tumor host tissues. In some embodiments, cellular inhibition of ULK kinase by compounds described herein is determined in host tissues including immune cells.
[000154] In some embodiments, in vivo inhibition of autophagy by compounds described herein is determined by inhibition of phosphorylation of cellular ULK substrates including ATG13, ATG14, Beclin 1, or STING either in tumor cells or in non-tumor host tissues. In some embodiments, in vivo inhibition of ULK kinase by compounds described herein is determined in host tissues including immune cells. In some embodiments, the in vivo inhibition of autophagic flux by compounds described herein can be used as a pharmacodynamic model for monitoring the kinetics and extent of such ULK inhibition. In some embodiments, tin vivo inhibition of ULK kinase by compounds described herein is determined in pancreatic cancer-bearing animals. In some embodiments, in vivo inhibition of ULK kinase by compounds described herein is determined in lung cancer-bearing animals. In some embodiments, in vivo inhibition of ULK kinase is determined in colorectal cancer- bearing animals. In some embodiments, in vivo inhibition of autophagy by compounds described herein is determined by inhibition of autophagic flux in tumor cells, or in non-tumor host tissues by monitoring inhibition of autophagosome formation, or by accumulation of autophagic proteins such as p62 or LC-III. In some embodiments, in vivo inhibition of autophagy is determined in host tissues including immune cells. In some embodiments, the in vivo inhibition of autophagic flux can be used as a pharmacodynamic model for monitoring the kinetics and extent of such ULK inhibition.
[000155] In some embodiments, inhibition of autophagy and anti-tumor activity by compounds described herein are evaluated in xenograft studies utilizing human RAS mutant cell lines in immunocompromised mice, for instance in SCID or nude mice. In some embodiments, inhibition of autophagy and anti-tumor activity by compounds described herein are evaluated in xenograft studies utilizing human RAS mutant patient-derived tumor xenografts (PDXs) in immunocompromised mice, for instance in SCID or nude mice. In some embodiments, xenograft studies include evaluation of compounds described herein in pancreatic cancer models. In some embodiments, inhibition of autophagy and anti-tumor activity by compounds described herein are evaluated in syngeneic murine genetically engineered models (GEMs) of mutant RAS cancers. In some embodiments, inhibition of autophagy and anti-tumor activity by compounds described herein are evaluated in the murine GEM syngeneic orthotopic pancreatic cancer model known as the KPC model (LSLKrasG12D/+;LSL-Trp53R172H/+;Pdx-l-Cre) or variants of the KPC model.
[000156] In some embodiments, compounds described herein will be evaluated in xenograft or GEM cancer models in combination with a MEK inhibitor. In some embodiments, compounds described herein will be evaluated in xenograft or GEM cancer models in combination with a RAF inhibitor. In some embodiments, compounds described herein will be evaluated in xenograft or GEM cancer models in combination with an ERK inhibitor. In some embodiments, compounds described herein will be evaluated in xenograft or GEM cancer models in combination with a RAS G12C direct inhibitor.
[000157] In some embodiments, inhibition of autophagy and anti-tumor activity by compounds described herein is evaluated in immunocompetent murine cancer models to assess an immunomodulatory component to the mechanism of action of ULK inhibitors. In some embodiments, the immunocompetent murine model is the murine GEM syngeneic orthotopic pancreatic cancer model known as the KPC model (LSL-KrasG12D/+;LSLTrp53R172H/+;Pdx-l-Cre) or variants of the KPC model. In some embodiments, immunomodulatory properties of compounds described herein are evaluated in combination with a MEK inhibitor. In some embodiments, immunomodulatory properties of compounds described herein are evaluated in combination with a RAF inhibitor. In some embodiments, immunomodulatory properties of compounds described herein are evaluated in combination with an ERK inhibitor. In some embodiments, immunomodulatory properties of compounds described herein are evaluated in combination with a RAS G12C direct inhibitor.
[000158] In some embodiments, the immunomodulatory component of ULK inhibition is an enhanced innate immune response. In some embodiments, the immunomodulatory component of ULK inhibition is an enhanced adaptive immune response. In some embodiments, the immunomodulatory component of ULK inhibition is an enhanced activity of antigen-presenting cells. In some embodiments, the immunomodulatory component of ULK inhibition is an enhanced anti-tumor activity of myeloid cells including macrophages. In some embodiments, the immunomodulatory component of ULK inhibition is an enhanced anti-tumor activity of Natural Killer cells. In some embodiments, the immunomodulatory component of ULK inhibition is an enhanced activity of effector T Cells, including cytotoxic T Cells.
[000159] In an embodiment, provided herein is a method of treating a disorder described herein that includes: administering a therapeutically effective amount of compound described herein in a patient in need thereof, and during or after the course of administration (e.g., at discrete time points, such as one week, two weeks, or on month after initial administration of a contemplated compound) detecting the engagement of the compound with an ULK kinase, wherein detecting comprises contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) with a phospho-ATG13 antibody ELISA assay to detect inhibition of ULK kinase activity, e.g, based on the level of phospho-ATG13 in the sample. In some embodiments, a contemplated method comprises optionally contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) prior to administration of the compound with a phosphoATG13 antibody ELISA assay, and comparing the level of phospho-ATG13 in the sample obtained prior to administration with the level of phospho-ATG13 in the sample obtained during or after the course of administration. In some embodiments, the phospho-ATG13 is pS318ATG13.
[000160] In an embodiment, provided herein is a method of treating a disorder described herein that includes: administering a therapeutically effective amount of compound described herein in a patient in need thereof, and during or after the course of administration (e.g., at discrete time points, such as one week, two weeks, or on month after initial administration of a contemplated compound) detecting the engagement of the compound with an ULK kinase, wherein detecting comprises contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) with a phospho-ATG14 antibody ELISA assay to detect inhibition of ULK kinase activity, e.g, based on the level of phospho-ATG14 in the sample. In some embodiments, a contemplated method comprises optionally contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) prior to administration of the compound with a phosphoATG14 antibody ELISA assay, and comparing the level of phospho-ATG14 in the sample obtained prior to administration with the level of phospho-ATG14 in the sample obtained during or after the course of administration. In some embodiments, the phospho-ATG14 is pATG 14 Ser29.
[000161] In an embodiment, provided herein is a method of treating a disorder described herein that includes: administering a therapeutically effective amount of compound described herein in a patient in need thereof, and during or after the course of administration (e.g., at discrete time points, such as one week, two weeks, or on month after initial administration of a contemplated compound) detecting the engagement of the compound with an ULK kinase, wherein detecting comprises contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) with a p62 antibody ELISA assay to detect inhibition of ULK kinase activity, e.g, based on the level of p62 in the sample. In some embodiments, a contemplated method comprises optionally contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) prior to administration of the compound with a p62 antibody ELISA assay, and comparing the level of p62 in the sample obtained prior to administration with the level of p62 in the sample obtained during or after the course of administration.
[000162] In an embodiment, provided herein is a method of treating a disorder described herein that includes: administering a therapeutically effective amount of compound described herein in a patient in need thereof, and during or after the course of administration (e.g., at discrete time points, such as one week, two weeks, or on month after initial administration of a contemplated compound) detecting the engagement of the compound with an ULK kinase, wherein detecting comprises contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) with a pBeclin antibody ELISA assay to detect inhibition of ULK kinase activity, e.g, based on the level of pBeclin in the sample. In some embodiments, a contemplated method comprises optionally contacting a sample obtained from the patient (including but not limited to a tumor, blood, saliva, or tissue) prior to administration of the compound with a pBeclin antibody ELISA assay, and comparing the level of pBeclin in the sample obtained prior to administration with the level of pBeclin in the sample obtained during or after the course of administration.
[000163] The compounds provided herein may be administered to patients (animals and humans) in need of such treatment in dosages that will provide optimal pharmaceutical efficacy. It will be appreciated that the dose required for use in any particular application will vary from patient to patient, not only with the particular compound or composition selected, but also with the route of administration, the nature of the condition being treated, the age and condition of the patient, concurrent medication or special diets then being followed by the patient, and other factors which those skilled in the art will recognize, with the appropriate dosage ultimately being at the discretion of the attendant physician. For treating clinical conditions and diseases noted above, a compound provided herein may be administered orally, subcutaneously, topically, parenterally, by inhalation spray or rectally in dosage unit formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants and vehicles. Parenteral administration may include subcutaneous injections, intravenous or intramuscular injections or infusion techniques.
[000164] Treatment can be continued for as long or as short a period as desired. The compositions may be administered on a regimen of, for example, one to four or more times per day. A suitable treatment period can be, for example, at least about one week, at least about two weeks, at least about one month, at least about six months, at least about 1 year, or indefinitely. A treatment period can terminate when a desired result is achieved.
Combination Therapy
[000165] Compounds described herein, e.g., a compound of Formula I as defined herein, can be administered in combination with one or more additional therapeutic agents to treat a disorder described herein, such as cancer. For example, provided in the present disclosure is a pharmaceutical composition comprising a compound described herein, e.g., a compound of Formula I as defined herein, one or more additional therapeutic agents, and a pharmaceutically acceptable excipient. In some embodiments, a compound of Formula I as defined herein and one additional therapeutic agent is administered. In some embodiments, a compound of Formula I as defined herein and two additional therapeutic agents are administered. In some embodiments, a compound of Formula I as defined herein and three additional therapeutic agents are administered. Combination therapy can be achieved by administering two or more therapeutic agents, each of which is formulated and administered separately. For example, a compound of Formula I as defined herein and an additional therapeutic agent can be formulated and administered separately. Combination therapy can also be achieved by administering two or more therapeutic agents in a single formulation, for example a pharmaceutical composition comprising a compound of Formula I as one therapeutic agent and one or more additional therapeutic agents such as a MAPKAP pathway inhibitor or chemotherapeutic agent. For example, a compound of Formula I as defined herein and an additional therapeutic agent can be administered in a single formulation. Other combinations are also encompassed by combination therapy. While the two or more agents in the combination therapy can be administered simultaneously, they need not be. For example, administration of a first agent (or combination of agents) can precede administration of a second agent (or combination of agents) by minutes, hours, days, or weeks. Thus, the two or more agents can be administered within minutes of each other or within 1, 2, 3, 6, 9, 12, 15, 18, or 24 hours of each other or within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14 days of each other or within 2, 3, 4, 5, 6, 7, 8, 9, or weeks of each other. In some cases even longer intervals are possible. While in many cases it is desirable that the two or more agents used in a combination therapy be present in within the patient's body at the same time, this need not be so.
[000166] Combination therapy can also include two or more administrations of one or more of the agents used in the combination using different sequencing of the component agents. For example, if agent X and agent Y are used in a combination, one could administer them sequentially in any combination one or more times, e.g., in the order X-Y-X, X-X-Y, YX-Y, Y-Y-X, X-X-Y-Y, etc.
[000167] In some embodiments, the one or more additional therapeutic agents that may be administered in combination with a compound provided herein can be a MAPKAP pathway inhibitor. Such MAPKAP pathway inhibitors include, for example, MEK inhibitors, ERK inhibitors, RAF inhibitors, and Ras inhibitors.
[000168] Exemplary MEK inhibitors include, but are not limited to, trametinib, selumetinib, cobimetinib, binimetinib, and pharmaceutically acceptable salts thereof. Exemplary ERK inhibitors include, but are not limited to, include, but are not limited to, ulixertinib, SCH772984, LY3214996, ravoxertinib, VX-lle, and pharmaceutically acceptable salts thereof. Exemplary RAF inhibitors include, but are not limited to, LY3009120, LXH254, RAF709, dabrafenib, vemurafenib, and pharmaceutically acceptable salts thereof. Exemplary Ras inhibitors include, but are not limited to, AMG-510, MRTX849, and pharmaceutically acceptable salts thereof.
[000169] The compounds described herein may be administered in combination with other therapeutic agents known to treat cancers. Such other therapeutic agents include radiation therapy, anti-tubulin agents, DNA alkylating agents, DNA synthesis-inhibiting agents, DNA intercalating agents, anti-estrogen agents, anti-androgens, steroids, anti-EGFR agents, kinase inhibitors, mTOR inhibitors, PI3 kinase inhibitors, cyclin-dependent kinase inhibitors, CD4/CD6 kinase inhibitors, topoisomerase inhibitors, Histone Deacetylase (HDAC) inhibitors, DNA methylation inhibitors, anti-HER2 agents, anti-angiogenic agents, proteasome inhibitors, PARP inhibitors, cell cycle regulating kinase inhibitors, thalidomide, lenalidomide, antibody-drug-conjugates (ADCs), immunotherapeutic agents including immunomodulating agents, targeted therapeutic agents, cancer vaccines, and CAR-T cell therapy.
[000170] In an embodiment, the additional therapeutic agents can be chemotherapeutic agents including but not limited to an anti-tubulin agents (for example, paclitaxel, paclitaxel protein-bound particles for injectable suspension including nab-paclitaxel, eribulin, docetaxel, ixabepilone, vincristine, auristatins, or maytansinoids), vinorelbine, DNAalkylating agents (including cisplatin, carboplatin, oxaliplatin, cyclophosphamide, ifosfamide, temozolomide), DNA intercalating agents or DNA topoisomerase inhibitors (including anthracyclines such as doxorubicin, pegylated liposomal doxorubicin, daunorubicin, idarubicin, mitoxantrone, or epirubicin, camptothecins such as topotecan, irinotecan, or exatecan), 5-fluorouracil, capecitabine, cytarabine, decitabine, 5-aza cytadine, gemcitabine and methotrexate.
[000171] In some embodiments, the additional therapeutic agents can be kinase inhibitors including but not limited to erlotinib, gefitinib, neratinib, afatinib, osimertinib, lapatanib, crizotinib, brigatinib, ceritinib, alectinib, lorlatinib, everolimus, temsirolimus, abemaciclib, LEE011, palbociclib, cabozantinib, sunitinib, pazopanib, sorafenib, regorafenib, sunitinib, axitinib, dasatinib, imatinib, nilotinib, idelalisib, ibrutinib, BLU-667, Loxo 292, larotrectinib, and quizartinib, anti-estrogen agents including but not limited to tamoxifen, fulvestrant, anastrozole, letrozole, and exemestane, anti-androgen agents including but not limited to abiraterone acetate, enzalutamide, nilutamide, bicalutamide, flutamide, cyproterone acetate, steroid agents including but not limited to prednisone and dexamethasone, PARP inhibitors including but not limited to neraparib, olaparib, talazoparib, and rucaparib, topoisomerase I inhibitors including but not limited to irinotecan, camptothecin, exatecan, and topotecan, topoisomerase II inhibitors including but not limited to anthracyclines, etoposide, etoposide phosphate, and mitoxantrone, Histone Deacetylase (HDAC) inhibitors including but not limited to vorinostat, romidepsin, panobinostat, valproic acid, and belinostat, DNA methylation inhibitors including but not limited to DZNep and 5aza-2'-deoxycytidine, proteasome inhibitors including but not limited to bortezomib and carfilzomib, thalidomide, lenalidomide, pomalidomide, biological agents including but not limited to trastuzumab, ado-trastuzumab, pertuzumab, cetuximab, panitumumab, ipilimumab, tremelimumab, anti-PD-1 agents including pembrolizumab, nivolumab, pidilizumab, and Cemiplimab, anti-PD-Ll agents including atezolizumab, avelumab, durvalumab and BMS936559, anti-angiogenic agents including bevacizumab and aflibercept, and antibody-drugconjugates (ADCs) including DM1, DM4, MMAE, MMAF, or camptothecin payloads, brentuximab vedotin and trastuzumab emtansine, radiotherapy, therapeutic vaccines including but not limited to sipuleucel-T.
[000172] In some embodiments, the additional therapeutic agents can be immunomodulatory agents including but not limited to anti-PD-lor anti-PDL-1 therapeutics including pembrolizumab, nivolumab, atezolizumab, durvalumab, BMS-936559, or avelumab, anti-TIM3 (anti-HAVcr2) therapeutics including but not limited to TSR-022 or MBG453, anti-LAG3 therapeutics including but not limited to relatlimab, LAG525, or TSR033, anti IBB (anti-CD37, anti-TNFRSF9), CD40 agonist therapeutics including but not limited to SGN-40, CP-870,893 or RO7009789, anti-CD47 therapeutics including but not limited to Hu5F9-G4, anti-CD20 therapeutics, anti-CD38 therapeutics, STING agonists including but not limited to ADU-S100, MK-1454, ASA404, or amidobenzimidazoles, anthracyclines including but not limited to doxorubicin or mitoxanthrone, hypomethylating agents including but not limited to azacytidine or decitabine, other immunomodulatory therapeutics including but not limited to epidermal growth factor inhibitors, statins, metformin, angiotensin receptor blockers, thalidomide, lenalidomide, pomalidomide, prednisone, or dexamethasone.
[000173] In some embodiments, the additional therapeutic agent is selected from a luteinizing hormone-releasing hormone (LHRH) analog, including goserelin and leuprolide. [000174] In some embodiments, the additional therapeutic agent is selected from the group consisting of selected from the group consisting of everolimus, trabectedin, abraxane, TLK 286, AV-299, DN-101, pazopanib, GSK690693, RTA 744, ON O91O.Na, AZD 6244 (ARRY-142886), AMN-107, TKI-258, GSK461364, AZD 1152, enzastaurin, vandetanib, ARQ-197, MK-0457, MLN8054, PHA-739358, R-763, AT-9263, pemetrexed, erlotinib, dasatanib, nilotinib, decatanib, panitumumab, amrubicin, oregovomab, Lep-etu, nolatrexed, azd2171, batabulin, of atumtunab, zanolimumab, edotecarin, tetrandrine, rubitecan, tesmilifene, oblimersen, ticilimumab, ipilimumab, gossypol, Bio 111, 131-I-TM-601, ALT110, BIO 140, CC 8490, cilengitide, gimatecan, IL13-PE38QQR, INO 1001, IPdRi KRX0402, lucanthone, LY 317615, neuradiab, vitespan, Rta 744, Sdx 102, talampanel, atrasentan, Xr 311, romidepsin, ADS-100380, sunitinib, 5-fluorouracil, vorinostat, etoposide, gemcitabine, doxorubicin, irinotecan, liposomal doxorubicin, 5'-deoxy fluorouridine, vincristine, temozolomide, ZK-304709, seliciclib; PD0325901, AZD-6244, capecitabine, LGlutamic acid, N- [4- [2-(2-amino-4,7-dihydro oxo-1 H-pyrrolo [2,3 -d]pyrimidin-5 -yl)ethyl]benzoyl]-, disodium salt, heptahydrate, camptothecin, PEG-labeled irinotecan, tamoxifen, toremifene citrate, anastrazole, exemestane, letrozole, DES(diethylstilbestrol), estradiol, estrogen, conjugated estrogen, bevacizumab, IMC-1C11, CHIR-258,); 3-[5(methylsulfonylpiperadinemethyl)-indolylj-quinolone, vatalanib, AG-013736, AVE-0005, the acetate salt of [D-Ser(Bu t) 6, Azgly 10] (pyro-Glu-His-Trp-Ser-Tyr-D-Ser(Bu t)-Leu-ArgPro-Azgly-NH2 acetate [C59H84N!8Oi4-(C2H4O2)x where x=l to 2.4], goserelin acetate, leuprolide acetate, triptorelin pamoate, medroxyprogesterone acetate, hydroxyprogesterone caproate, megestrol acetate, raloxifene, bicalutamide, flutanide, nilutamide, megestrol acetate, CP-724714; TAK-165, HKI-272, erlotinib, lapatanib, canertinib, ABX-EGF antibody, erbitux, EKB-569, PKI-166, GW-572016, lonafarnib, BMS-214662, tipifarnib; amifostine, NVP-LAQ824, suberoyl analide hydroxamic acid, valproic acid, trichostatin A, FK-228, SUI 1248, sorafenib, KRN951, aminoglutethimide, amsacrine, anagrelide, Lasparaginase, Bacillus Calmette-Guerin (BCG) vaccine, bleomycin, buserelin, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, diethylstilbestrol, epirubicin, fludarabine, fludrocortisone, fluoxymesterone, flutamide, gemcitabine, gleevac, hydroxyurea, idarubicin, ifosfamide, imatinib, leuprolide, levamisole, lomustine, mechlorethamine, melphalan, 6-mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, octreotide, oxaliplatin, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab, streptozocin, teniposide, testosterone, thalidomide, thioguanine, thiotepa, tretinoin, vindesine, 13-cis-retinoic acid, phenylalanine mustard, uracil mustard, estramustine, altretamine, floxuridine, 5-deooxyuridine, cytosine arabinoside, 6mecaptopurine, deoxycoformycin, calcitriol, valrubicin, mithramycin, vinblastine, vinorelbine, topotecan, razoxin, marimastat, COL-3, neovastat, BMS-275291, squalamine, endostatin, SU5416, SU6668, EMD121974, interleukin-12, IM862, angiostatin, vitaxin, droloxifene, idoxyfene, spironolactone, finasteride, cimitidine, trastuzumab, denileukin diftitox, gefitinib, bortezimib, irinotecan, topotecan, doxorubicin, docetaxel, vinorelbine, bevacizumab (monoclonal antibody) and erbitux, cremophor-free paclitaxel, epithilone B, BMS-247550, BMS-310705, droloxifene, 4-hydroxytamoxifen, pipendoxifene, ERA-923, arzoxifene, fulvestrant, acolbifene, lasofoxifene, idoxifene, TSE-424, HMR-3339, ZK186619, PTK787/ZK 222584, VX-745, PD 184352, rapamycin, 40-O-(2-hydroxyethyl)rapamycin, temsirolimus, AP-23573, RAD001, ABT-578, BC-210, LY294002, LY292223, LY292696, LY293684, LY293646, wortmannin, ZM336372, L-779,450, PEG-filgrastim, darbepoetin, erythropoietin, granulocyte colony-stimulating factor, zolendronate, prednisone, cetuximab, granulocyte macrophage colony-stimulating factor, histrelin, pegylated interferon alfa-2a, interferon alfa-2a, pegylated interferon alfa-2b, interferon alfa-2b, azacitidine, PEGL-asparaginase, lenalidomide, gemtuzumab, hydrocortisone, interleukin-11, dexrazoxane, alemtuzumab, all-transretinoic acid, ketoconazole, interleukin-2, megestrol, immune globulin, nitrogen mustard, methylprednisolone, ibritgumomab tiuxetan, androgens, decitabine, hexamethylmelamine, bexarotene, tositumomab, arsenic trioxide, cortisone, editronate, mitotane, cyclosporine, liposomal daunorubicin, Edwina-asparaginase, strontium 89, casopitant, netupitant, an NK-1 receptor antagonists, palonosetron, aprepitant, diphenhydramine, hydroxyzine, metoclopramide, lorazepam, alprazolam, haloperidol, droperidol, dronabinol, dexamethasone, methylprednisolone, prochlorperazine, granisetron, ondansetron, dolasetron, tropisetron, sspegfilgrastim, erythropoietin, epoetin alfa and darbepoetin alfa, ipilumumab, vemurafenib, and mixtures thereof.
Pharmaceutical Compositions and Kits
[000175] Another aspect of this disclosure provides pharmaceutical compositions comprising compounds as disclosed herein formulated together with a pharmaceutically acceptable carrier. In particular, the present disclosure provides pharmaceutical compositions comprising compounds as disclosed herein formulated together with one or more pharmaceutically acceptable carriers. These formulations include those suitable for oral, rectal, topical, buccal, parenteral (e.g., subcutaneous, intramuscular, intradermal, or intravenous) rectal, vaginal, or aerosol administration, although the most suitable form of administration in any given case will depend on the degree and severity of the condition being treated and on the nature of the particular compound being used. For example, disclosed compositions may be formulated as a unit dose, and/or may be formulated for oral or subcutaneous administration.
[000176] Exemplary pharmaceutical compositions may be used in the form of a pharmaceutical preparation, for example, in solid, semisolid or liquid form, which contains one or more of the compounds described herein, as an active ingredient, in admixture with an organic or inorganic carrier or excipient suitable for external, enteral or parenteral applications. The active ingredient may be compounded, for example, with the usual nontoxic, pharmaceutically acceptable carriers for tablets, pellets, capsules, suppositories, solutions, emulsions, suspensions, and any other form suitable for use. The active object compound is included in the pharmaceutical composition in an amount sufficient to produce the desired effect upon the process or condition of the disease.
[000177] For preparing solid compositions such as tablets, the principal active ingredient may be mixed with a pharmaceutical carrier, e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound provided herein, or a non-toxic pharmaceutically acceptable salt thereof. When referring to these preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules. [000178] In solid dosage forms for oral administration (capsules, tablets, pills, dragees, powders, granules and the like), the subject composition is mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as, for example, acetyl alcohol and glycerol monostearate; (8) absorbents, such as kaolin and bentonite clay; (9) lubricants, such a talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof; and (10) coloring agents. In the case of capsules, tablets and pills, the compositions may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
[000179] A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared using binder (for example, gelatin or hydroxypropylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent. Molded tablets may be made by molding in a suitable machine a mixture of the subject composition moistened with an inert liquid diluent. Tablets, and other solid dosage forms, such as dragees, capsules, pills and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art.
[000180] Compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders. Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the subject composition, the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, com, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, cyclodextrins and mixtures thereof.
[000181] Suspensions, in addition to the subject composition, may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
[000182] Formulations for rectal or vaginal administration may be presented as a suppository, which may be prepared by mixing a subject composition with one or more suitable non-irritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the body cavity and release the active agent.
[000183] Dosage forms for transdermal administration of a subject composition include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants. The active component may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required. [000184] The ointments, pastes, creams and gels may contain, in addition to a subject composition, excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
[000185] Powders and sprays may contain, in addition to a subject composition, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances. Sprays may additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
[000186] Compositions and compounds of the present disclosure may alternatively be administered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation or solid particles containing the compound. A non-aqueous (e.g., fluorocarbon propellant) suspension could be used. Sonic nebulizers may be used because they minimize exposing the agent to shear, which may result in degradation of the compounds contained in the subject compositions. Ordinarily, an aqueous aerosol is made by formulating an aqueous solution or suspension of a subject composition together with conventional pharmaceutically acceptable carriers and stabilizers. The carriers and stabilizers vary with the requirements of the particular subject composition, but typically include non-ionic surfactants (Tweens, Pluronics, or polyethylene glycol), innocuous proteins like serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars or sugar alcohols. Aerosols generally are prepared from isotonic solutions.
[000187] Pharmaceutical compositions of the present disclosure suitable for parenteral administration comprise a subject composition in combination with one or more pharmaceutically-acceptable sterile isotonic aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
[000188] Examples of suitable aqueous and non-aqueous carriers which may be employed in the pharmaceutical compositions provided herein include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate and cyclodextrins. Proper fluidity may be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
[000189] In another aspect, provided are enteral pharmaceutical formulations including a disclosed compound and an enteric material; and a pharmaceutically acceptable carrier or excipient thereof. Enteric materials refer to polymers that are substantially insoluble in the acidic environment of the stomach, and that are predominantly soluble in intestinal fluids at specific pHs. The small intestine is the part of the gastrointestinal tract (gut) between the stomach and the large intestine, and includes the duodenum, jejunum, and ileum. The pH of the duodenum is about 5.5, the pH of the jejunum is about 6.5 and the pH of the distal ileum is about 7.5.
[000190] Accordingly, enteric materials are not soluble, for example, until a pH of about 5.0, of about 5.2, of about 5.4, of about 5.6, of about 5.8, of about 6.0, of about 6.2, of about 6.4, of about 6.6, of about 6.8, of about 7.0, of about 7.2, of about 7.4, of about 7.6, of about 7.8, of about 8.0, of about 8.2, of about 8.4, of about 8.6, of about 8.8, of about 9.0, of about 9.2, of about 9.4, of about 9.6, of about 9.8, or of about 10.0. Exemplary enteric materials include cellulose acetate phthalate (CAP), hydroxypropyl methylcellulose phthalate (HPMCP), polyvinyl acetate phthalate (PVAP), hydroxypropyl methylcellulose acetate succinate (HPMCAS), cellulose acetate trimellitate, hydroxypropyl methylcellulose succinate, cellulose acetate succinate, cellulose acetate hexahydrophthalate, cellulose propionate phthalate, cellulose acetate maleate, cellulose acetate butyrate, cellulose acetate propionate, copolymer of methylmethacrylic acid and methyl methacrylate, copolymer of methyl acrylate, methylmethacrylate and methacrylic acid, copolymer of methylvinyl ether and maleic anhydride (Gantrez ES series), ethyl methyacrylate-methylmethacrylatechlorotrimethylammonium ethyl acrylate copolymer, natural resins such as zein, shellac and copal collophorium, and several commercially available enteric dispersion systems (e.g., Eudragit L30D55, Eudragit FS30D, Eudragit L100, Eudragit S100, Kollicoat EMM30D, Estacryl 30D, Coateric, and Aquateric). The solubility of each of the above materials is either known or is readily determinable in vitro. The foregoing is a list of possible materials, but one of skill in the art with the benefit of the disclosure would recognize that it is not comprehensive and that there are other enteric materials that would meet the objectives described herein.
[000191] Advantageously, provided herein are kits for use by a e.g. a consumer in need of treatment of cancer. Such kits include a suitable dosage form such as those described above and instructions describing the method of using such dosage form to mediate, reduce or prevent inflammation. The instructions would direct the consumer or medical personnel to administer the dosage form according to administration modes known to those skilled in the art. Such kits could advantageously be packaged and sold in single or multiple kit units. An example of such a kit is a so-called blister pack. Blister packs are well known in the packaging industry and are being widely used for the packaging of pharmaceutical unit dosage forms (tablets, capsules, and the like). Blister packs generally consist of a sheet of relatively stiff material covered with a foil of a preferably transparent plastic material. During the packaging process recesses are formed in the plastic foil. The recesses have the size and shape of the tablets or capsules to be packed. Next, the tablets or capsules are placed in the recesses and the sheet of relatively stiff material is sealed against the plastic foil at the face of the foil which is opposite from the direction in which the recesses were formed. As a result, the tablets or capsules are sealed in the recesses between the plastic foil and the sheet. Preferably the strength of the sheet is such that the tablets or capsules can be removed from the blister pack by manually applying pressure on the recesses whereby an opening is formed in the sheet at the place of the recess. The tablet or capsule can then be removed via said opening.
[000192] It may be desirable to provide a memory aid on the kit, e.g., in the form of numbers next to the tablets or capsules whereby the numbers correspond with the days of the regimen which the tablets or capsules so specified should be ingested. Another example of such a memory aid is a calendar printed on the card, e.g., as follows First Week, Monday, Tuesday,. etc. Second Week, Monday, Tuesday,. etc. Other variations of memory aids will be readily apparent. A daily dose can be a single tablet or capsule or several pills or capsules to be taken on a given day. Also, a daily dose of a first compound can consist of one tablet or capsule while a daily dose of the second compound can consist of several tablets or capsules and vice versa. The memory aid should reflect this.
EXAMPLES
[000193] The compounds described herein can be prepared in a number of ways based on the teachings contained herein and synthetic procedures known in the art. In the description of the synthetic methods described below, it is to be understood that all proposed reaction conditions, including choice of solvent, reaction atmosphere, reaction temperature, duration of the experiment and workup procedures, can be chosen to be the conditions standard for that reaction, unless otherwise indicated. It is understood by one skilled in the art of organic synthesis that the functionality present on various portions of the molecule should be compatible with the reagents and reactions proposed. Substituents not compatible with the reaction conditions will be apparent to one skilled in the art, and alternate methods are therefore indicated. The starting materials for the examples are either commercially available or are readily prepared by standard methods from known materials.
[000194] The following abbreviation are used in this disclosure and have the following definitions: “ADP” is adenosine diphosphate, “Boc” is t-butylcarbonate, “GDI” is carbodiimidazole, “cone.” is concentrated, “Cs2CO3” is cesium carbonate, “Cui” is copper (I) iodide, “DBU” is l,8-diazabicyclo[5.4.0]undec ene, “DCC” is N,N'Dicyclohexylcarbodiimide, “DCE” is dichloroethane, “DCM” is dichloromethane, “DIEA” is A,Wdiisopropylethylamine, “DMA” is A,Wdimethylacetamide, “DMAP” is 4(dimethylamino)pyridine, “DMF” is A,Wdimethy!formamide, “dppf” is 1,1 bis(diphenylphosphino)ferrocene,”DMEM” is Dulbecco's Modified Eagle Media, “DMSO” is dimethylsulfoxide, “DPPA” is diphenylphosphryl azide, “EDC” is l-Ethyl (3dimethylaminopropyl)carbodiimide, “ESI” is electrospray ionization, “Et2O” is diethylether, “EtOAc” is ethyl acetate, “EtOH” is ethanol, “GST” is glutathione S-transferase, “h” is hour or hours, “HBTU” is (2-(lH-benzotriazol-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate, “H2” is hydrogen gas, “HQ” is hydrochloric acid, “Hex” is hexane, “H2O” is water, “HOBt” is Hydroxybenzotriazole “IC50” is half maximal inhibitory concentration, “K2CO3” is potassium carbonate, “K3PO4” is potassium phosphate, “LiMHDS” is lithium bis(trimethylsilyl)amide, “MeCN” is acetonitrile, “MeOH” is methanol, “Me4tBuXPhos” is di-tert-butyl(2',4',6'-triisopropyl-3,4,5,6-tetramethyl-[l,rbiphenyl] yl)phosphine, “MgSO4” is magnesium sulfate, “MHz” is megahertz, “min” is minute or minutes, “MS” is mass spectrometry, “MTBE” is methyl ieri-butyl ether, “NADH” is nicotinamide adenine dinucleotide, “NaH” is sodium hydride, “NaHC03” is sodium bicarbonate, “Na2SO4” is sodium sulfate, “NH4Q” is ammonium chloride, “NaSMe” is sodium thiomethoxide, “NBS” is N-bromosuccinimide, “NMR” is nuclear magnetic resonance, “PBS” is phosphate buffered saline, “Pd/C” is palladium on carbon, “Pd2(dba)3” is tris(dibenzylideneacetone)dipalladium(0), “Pd(OAc)2” is palladium (II) acetate, “Pd(PPh3)4” is tetrakis(triphenylphosphine)palladium (0), “prep-HPLC” is preparative high performance liquid chromatography, “PyBOP” is benzotriazol yl-oxytripyrrolidinophosphonium hexafluorophosphate, “rt” is room temperature which is also known as “ambient temp,” which will be understood to consist of a range of normal laboratory temperatures ranging from 15-25 °C, “satd.” is saturated, “T3P” is n-propanephosphonic acid anhydride, “TEA” is triethylamine, “TFA” is trifluoroacetic acid, “THF” is tetrahydrofuran, “TMS” is trimethylsilyl, “Tris” is tris(hydroxymethyl)aminomethane, “Xantphos” is 4,5bis(diphenylphosphino)-9,9-dimethylxanthene, “X-Phos” is 2-dicyclohexylphosphino2',4',6'-triisopropylbiphenyl and “ZnC12” is zinc chloride.
General Chemistry
[000195] Exemplary compounds described herein are available by the general synthetic methods illustrated in the Schemes below, Intermediate preparations, and the accompanying Examples.
Synthetic Schemes
Scheme 1
<img file="IL287787A_D0138.tif" />
[000196] Scheme 1 illustrates an exemplary preparation of amines D-I-i, D-I-ii, and DI-iii. Treatment of A-I with amine R4-H, which can be aliphatic or heterocyclic, in the presence of a base (e.g. Cs2CO3 or K2CO3) affords compound B-I. Further treatment of B-I where R2a is Br with commercially available boronic esters/boronic acids/trifluoroborates in the presence of a palladium catalyst (Suzuki coupling) or Sonogashira coupling reaction affords compound C-I. Intermediate C-I may be selectively converted to amine D-I-i where R2b is alkenyl, alkynyl, or cycloalkyl by mild reducing conditions for example, zinc or iron metal with ammonium chloride. Intermediate C-I can be fully reduced to D-I-iii by palladium catalyzed hydrogenation. Intermediate B-I where R2a is Cl, Br, alkyl, CN or alkoxy may be reduced to D-I-ii by mild reducing conditions for example, zinc or iron metal with ammonium chloride.
[000197] In Scheme 1, examples of X include N and CH, examples of Y include N, CH, and C-F where X and Y are not both N, examples of R2 include alkyl and cycloalkyl, and examples of R4 include an N-linked alkyl and N-linked heterocylcyl with suitable optional substituents as exemplified by the tables of interemediates below.
Scheme 2
<img file="IL287787A_D0139.tif" />
[000198] Scheme 2 illustrates an exemplary preparation of amine D-II-i, D-II-ii and DReaction of A-II (commercially available starting materials) and amine R4-H under reductive amination conditions (e.g. sodium cyanoborohydride or sodium triacetoxyborohydride in the presence of a catalytic amount of acetic acid in polar solvents like MeOH) affords compound B-II. Further treatment of B-II where R2a is Br with commercially available boronic esters/boronic acids/trifluoroborates in the presence of a palladium catalyst (Suzuki coupling) or Sonogashira coupling reaction affords compound CII. Intermediate C-II may be selectively converted to amine D-II-i where R2b is alkenyl, alkynyl, cycloalkyl by mild reducing conditions for example, zinc or iron metal with ammonium chloride. Intermediate C-II can be fully reduced to D-II-iii by palladium catalyzed hydrogenation. Intermediate B-II where R2a is Cl, Br, alkyl, CN or alkoxy may be reduced to D-II-ii by mild reducing conditions for example, zinc or iron metal with ammonium chloride.
[000199] In Scheme 2, examples of X include N and CH, examples of Y include N, CH, and C-F where X and Y are not both N, examples of R2 include alkyl and cycloalkyl, and examples of R4 include an N-linked alkyl and N-linked heterocylcyl with suitable optional substituents as exemplified by the tables of interemediates below.
Scheme 3
<img file="IL287787A_D0140.tif" />
D-lll-i
<img file="IL287787A_D0141.tif" />
<img file="IL287787A_D0142.tif" />
D-III-ii
<img file="IL287787A_D0143.tif" />
D-III-iii
[000200] Scheme 3 illustrates an exemplary preparation of amine D-III-i, D-III-ii and D-III-iii. Reduction of A-III-i with reducing reagents such as DIBAL affords aldehyde AIH-ii. Another way to prepare A-III-ii is reduction of A-III-i to the corresponding alcohol followed by mild oxidation conditions such as using Mn02. Reaction of A-III-ii and amine R4-H under reductive amination conditions (e.g. sodium cyanoborohydride or sodium triacetoxyborohydride in the presence of a catalytic amount of acetic acid in polar solvents like MeOH) affords compound B-III. Another way to prepare B-III is reduction of A-III-I to the alcohol followed by conversion of the alcohol to the sulfonates A-III-iii. Reaction of AIII-iii with amine R4-H in the presence of base such as triethylamine, Hunig’s base, or cesium carbonate affords B-III. Further treatment of B-III where R2a is Br with commercially available boronic esters/boronic acids/trifluoroborates in the presence of a palladium catalyst (Suzuki coupling) or Sonogashira coupling reaction affords compound CIII. Intermediate C-III may be selectively converted to amine D-III-iii where R2b is alkenyl, alkynyl, or cycloalkyl by mild reducing conditions for example, zinc or iron metal with ammonium chloride. Intermediate C-III can be fully reduced to D-III-ii by palladium catalyzed hydrogenation. Intermediate B-III where R2a is Cl, Br, alkyl, CN or alkoxy may be reduced to D-III-i by mild reducing conditions for example, zinc or iron metal with ammonium chloride.
[000201] In Scheme 3, examples of X include N and CH, examples of Y include N, CH, and C-F where X and Y are not both N, examples of R include methyl and ethyl, examples of R2 include alkyl and cycloalkyl, examples of R4 include an N-linked alkyl and N-linked heterocylcyl with suitable optional substituents as exemplified by the tables of interemediates below, and examples of LG include mesylate and tosylate.
Scheme 4
<img file="IL287787A_D0144.tif" />
R = Me or Et
<img file="IL287787A_D0145.tif" />
or 2
Pd coupling if R2a = Br
<img file="IL287787A_D0146.tif" />
<img file="IL287787A_D0147.tif" />
D-IV-i reduction reduction
<img file="IL287787A_D0148.tif" />
D-IV-ii
<img file="IL287787A_D0149.tif" />
D-IV-iii
[000202] Scheme 4 illustrates an exemplary preparation of amine D-IV. Reaction of AHl-i and various amines under amide coupling reagents (e.g. GDI, DCC, EDC, HOBt, HBTU, PyBOP, or T3P) in the presence of a catalytic amount of DMAP, if needed, affords amide B-IV.
Further treatment of B-IV where R2a is Br with commercially available boronic esters/boronic acids/trifluoroborates in the presence of a palladium catalyst (Suzuki coupling) or Sonogashira coupling reaction affords compound C-IV. Intermediate C-IV may be selectively converted to amine D-IV-i where R2b is alkenyl, alkynyl, or cycloalkyl by mild reducing conditions for example, zinc or iron metal with ammonium chloride. Intermediate C-IV can be fully reduced to D-IV-iii by palladium catalyzed hydrogenation. Intermediate BIV where R2a is Cl, Br, alkyl, CN or alkoxy may be reduced to D-IV-ii by mild reducing conditions for example, zinc or iron metal with ammonium chloride.
[000203] In Scheme 4, examples of X include N and CH, examples of Y include N, CH, and C-F where X and Y are not both N, examples of R include methyl and ethyl, examples of R2 include alkyl and cycloalkyl, and examples of R4 include -C(O)-alkyl and -C(O)heterocylcyl, where the alkyl and heterocyclyl moieties are N-linked with suitable optional substituents as exemplified by the tables of interemediates below.
Scheme 5
<img file="IL287787A_D0150.tif" />
B-v c-v D-V
[000204] Scheme 5 illustrates an exemplary preparation of amine D-V. B-V reacts with boronic esters/boronic acids/trifluoroborates in the presence of a palladium catalyst (Suzuki coupling) to afford compound C-V. Many boronic esters/boronic acids/trifluoroborates are commercially available and those that are not can be readily prepared from the corresponding carboxylic acids (see Scheme 7). Intermediate C-V may be converted to amine D-V by standard reducing conditions, for example, by palladium catalyzed hydrogenation or by mild reducing conditions including zinc metal and ammonium chloride.
[000205] In Scheme 5, examples of X include N and CH, examples of Y include N, CH, and C-F, examples of R2 include alkyl and cycloalkyl, and examples of R4 include a C-linked heterocylcyl and heteroaryl with suitable optional substituents as exemplified by the tables of interemediates below.
Scheme 6
<img file="IL287787A_D0151.tif" />
1) deprotection
2) reductive amination = 0,1, or 2
C-VI-i no2 ii 3) reduction 1A'!&#1523; _________&#9658; m = 0, 1, or 2
K
C-VI
<img file="IL287787A_D0152.tif" />
D-VI
[000206] Scheme 6 illustrates an exemplary preparation of D-VI from C-VI-i where, in C-VI-i, R4 contains a nitrogen protecting group, e.g. a Boc group. C-VI-i can be deprotected under acidic conditions to provide the amine salt. Further treatment of the salt with sodium cyanoborohydride or sodium triacetoxyborohydride and an aldehyde or ketone in the presence of a catalytic amount of acetic acid in polar solvents such as MeOH (reductive amination conditions) affords C-VI. Intermediate C-VI may be converted to aniline D-VI by standard reducing conditions, for example, by palladium catalyzed hydrogenation or by mild reducing conditions including zinc metal and ammonium chloride.
[000207] In Scheme 6, examples of X include N and CH, examples of Y include N, CH, and C-F where X and Y are not both N, examples of R2 include alkyl and cycloalkyl, and examples of R4 include heterocylcyl with suitable optional substituents as exemplified by the tables of interemediates below.
Scheme 7
<img file="IL287787A_D0153.tif" />
<img file="IL287787A_D0154.tif" />
[000208] Scheme 7 illustrates an exemplary preparation of boronic acid/boronic ester T, which are not commercially available. These compounds can be readily prepared from the substituted carboxylic acid. The starting material carboxylic acid can be activated by 2hydroxyisoindoline-1,3-dione in the presence of coupling reagent (e.g. DCI or Et3N/HATU) to afford Q. Intermediate Q may be converted to boronic ester T by nickel-catalyzed decarboxylation borylation with the [B2pin2Me]Li complex, which is premixed with methyllithium and B2pin2 (Science, 356, 1045 (2017), JACS, 138, 2174 (2016)).
[000209] In Scheme 7, examples of m include 0, 1, and 2, and examples of R4 include alkyl, cycloalkyl, and heterocyclyl with suitable optional substituents as exemplified by the tables of interemediates below.
Scheme 8
<img file="IL287787A_D0155.tif" />
Cui CsF
TMSCHF2 NMP
<img file="IL287787A_D0156.tif" />
ZnCI2
L-II-1
NaSMe
<img file="IL287787A_D0157.tif" />
L-l-1
<img file="IL287787A_D0158.tif" />
L-ll-2
ZnCI2
NaSMe
<img file="IL287787A_D0159.tif" />
L-I-2
[000210] Scheme 8 illustrates an exemplary preparation of L-I-l and L-I-2. Commercially available 2,4-dichloro iodopyrimidine reacts with TMSCF2H in a solvent such as NMP or DMF in the presence of Cui and CsF to produce difluoromethylpyrimidine L-II-1 (US20150284341). Difluoromethylpyrimidine L-II-1 can be converted to thiomethyletherpyrimidine L-I-l by treatment with sodium thiomethoxide and zinc chloride in diethyl ether at temperatures lower than 10 °C (WO2012110773). In a similar manner to L1-1, trifluoromethylpyrimidine L-I-2 can be prepared from the commercially available 2,4dichloro ( trifluoromethyl)pyrimidine, L-II-2.
Scheme 9
<img file="IL287787A_D0160.tif" />
coupling
R1-B(OR)2 R1-B(OH)2 or R1-BF3K
<img file="IL287787A_D0161.tif" />
L-lll (t = 0)
<img file="IL287787A_D0162.tif" />
L-lll (t=2)
[000211] Scheme 9 illustrates an exemplary preparation of sulfonylpyrimidine L-III (t = 2) where R1 can be cycloalkyl. Treatment of commercially available 5-bromo chloro-4(methylthio)pyrimidine with commercially available boronic esters/boronic acids/trifluoroborates (see scheme 7) in the presence of a palladium catalyst (Suzuki coupling) affords thiopyrimidine L-III (t = 0). The intermediate thiopyrimidine L-III (t = 0) may be converted to sulfonylpyrimidine L-III (t = 2) by standard oxidations, for example, by mCPBA.
Scheme 10
Z-H
E
1) base
BocHN
<img file="IL287787A_D0163.tif" />
deprotection ----------&#9658; H2N n Z
<img file="IL287787A_D0164.tif" />
<img file="IL287787A_D0165.tif" />
<img file="IL287787A_D0166.tif" />
[000212] Scheme 10 illustrates an exemplary preparation of intermediate Η (I-XIII) using a widely known method. Treatment of commercially available lactam/cycliccarbamate/oxolactam/cyclic-urea/diazepanone E with (Boc)-protected bromo-intermediate F in the presence of base, for example sodium hydride or potassium tert-butoxide, provides G. The Boc protecting group of G may be removed upon exposure to acid, for example HC1 or TFA.
[000213] In Scheme 10, q can be 0, 1, 2, or 3, r can be 2, 3, or 4, V can be C(R34)2, O, or NR6, where R6 is alkyl, n can be 2, 3, or 4, each R34 can, independently, be H, C1-C6alkyl, or two R34 can be taken together to form a cycloalkyl.
Scheme 11
<img file="IL287787A_D0167.tif" />
[000214] In another embodiment to prepare H, H-XIV can be prepared from DBU via one step process as illustrated in Scheme 11. DBU can be hydrolyzed by potassium hydroxide in the solution of methanol and water at ambient temperature to provide H-XIV.
Scheme 12
<img file="IL287787A_D0168.tif" />
<img file="IL287787A_D0169.tif" />
L-l (R1 =CHF2
CF3 orCN)
<img file="IL287787A_D0170.tif" />
<img file="IL287787A_D0171.tif" />
<img file="IL287787A_D0172.tif" />
<img file="IL287787A_D0173.tif" />
<img file="IL287787A_D0174.tif" />
[000215] Scheme 12 illustrates an exemplary preparation of key intermediates J and K. Key intermediate J can be prepared from H (either free base or acid addition salt) by reacting with thiopyrimidine L-I in the presence of an organic base (e. g. triethylamine or DIEA) and optional heating. In a similar manner, key intermediate K can be prepared from H with either L-II or L-III.
[000216] In Scheme 12, q can be 0, 1, 2, or 3, r can be 2, 3, or 4, V can be C(R34)2, O, or NR6, where R6 is alkyl, n can be 2, 3, or 4, each R34 can, independently, be H, C!-C6alkyl, or two R34 can be taken together to form a cycloalkyl group.
Scheme 13
<img file="IL287787A_D0175.tif" />
[000217] Scheme 13 illustrates an exemplary preparation of key intermediate M. Treatment of H with commercially available iodopyridine under Buchwald-Hartwig coupling conditions (Cs2CO3, Xantphos and Pd(OAc)2), typically performed in an aprotic solvent (e. g. DME, DMF, DMSO, or NMP) at temperatures ranging from ambient temp to 140 °C, provides key intermediate M.
[000218] In Scheme 13, R1 can be Br, Cl, alkyl optionally substituted by one or more fluorine atoms, or cycloalkyl, q can be 0, 1, 2, or 3, r can be 2, 3, or 4, V can be C(R34)2, O, or NR6, where R6 is alkyl, n can be 2, 3, or 4, each R34 can, independently, be H, C!-C6alkyl, or two R34 can be taken together to form a cycloalkyl.
Scheme 14
<img file="IL287787A_D0176.tif" />
κ
<img file="IL287787A_D0177.tif" />
2) D-l
1) oxidation (J:t = 1)
<img file="IL287787A_D0178.tif" />
J t = 0
1) deprotection of Boc group
2) reductive alkylation, acylation orsulfonylation
<img file="IL287787A_D0179.tif" />
<img file="IL287787A_D0180.tif" />
<img file="IL287787A_D0181.tif" />
<img file="IL287787A_D0182.tif" />
[000219] Scheme 14 illustrates an exemplary preparation of compounds of Formula I from substituted anilines or aminopyridines (D-I). The preparation of Formula I-A can be accomplished from key intermediates K and J. First, a nucleophilic substitution reaction of K with amine D can be typically performed in an aprotic solvent at temperatures ranging from ambient temp to 150 °C, in some embodiments with microwave heating, optionally in the presence of an acid for example 4 N HC1 in 1,4-dioxane to provide Formula I-A. Compounds D-I, which are not commercially available, can be readily prepared from substituted nitrobenzenes or nitropyridines (see schemes 1-6). An alternative general synthesis of Formula I-A is via a two-step process by first converting J (t = 0) to sulfoxide (J (t = 1, major product) by oxidation using various oxidants, for example mCPBA. The sulfoxide reacts with amine D-I by a nucleophilic substitution reaction, typically performed in an aprotic solvent at temperatures ranging from ambient temp to 150 °C, in some embodiments with microwave heating, optionally in the presence of an acid for example 4 N HC1 in 1,4-dioxane or pTSA. Formula I-A which contains a nitrogen protecting group such as a Boc group, can be deprotected under acidic conditions to provide Formula I-A containing a free NH on R4 (free amine or acid addition salt). Further treatment of Formula I-A (free base or acid addition salt) with sodium cyanoborohydride or sodium tri acetoxy borohydride and an aldehyde or ketone in the presence of a catalytic amount of acetic acid in polar solvents such as MeOH (reductive amination conditions) affords R4 N-substituted Formula I-A. For acylation and sulfonylation, the free amine (or salt) can be treated with commercially available acyl chloride or sulfonyl chloride to afford N-substituted Formula I-A.
Scheme 15
<img file="IL287787A_D0183.tif" />
<img file="IL287787A_D0184.tif" />
[000220] Scheme 15 illustrates exemplary preparations of compounds of Formula I-B. The preparation of Formula I-B can be accomplished by Buchwald-Hartwig coupling reaction with D-I and M. Amines D-I which are not commercially available can be readily prepared from substituted nitrobenzene or nitropyridine (see schemes 1-6). Formula I-B which contains a nitrogen protecting group such as a Boc group can be deprotected under an acidic condition to provide Formula I-B containing a free NH on R4 (free amine or acid addition salt). Further treatment of Formula I-B (free base or acid addition salt) with sodium cyanoborohydride or sodium triacetoxyborohydride and an aldehyde or ketone in the presence of a catalytic amount of acetic acid in polar solvents such as MeOH (reductive amination conditions) affords R4 N-substituted Formula I-B. In a same manner as Scheme 14, the free amine (or acid addition salt) can be treated with commercially available acyl chloride or sulfonyl chloride to afford N-substituted Formula I-B.
Preparation of Intermediates.
[000221] Using the synthetic procedures and methods described herein and methods known to those skilled in the art, the following compounds were made:
General Method A: Aromatic Nucleophilic Substitution:
Intermediate B-I-8: l-(3-bromo nitrophenyl) methylpiperazine
NO2
&#1512;&#1509; &#1500;)
N I
[000222] A mixture of 2-bromo fluoro nitrobenzene (50 g, 227 mmol) and 1methylpiperazine (24 g, 250 mmol) in DMF (400 mL) was treated with K2CO3 (63 g, 455 mmol) at RT and the reaction mixture was stirred at 60 °C for 16 h. The reaction mixture was diluted with ice water (500 mL) and the precipitated solid was filtered. The solid was further triturated with Et2O and n-pentane to obtained l-(3-bromo nitrophenyl) methy!piperazine (58 g, 85 % yield) as a yellow solid. 1H NMR (400 MHz, DMSO-d6): δ 7.98 (d, J = 9.4 Hz, 1H), 7.24 (d, J = 2.1 Hz, 1H), 7.01 (dd, J = 2.2 and 9.4 Hz, 1H), 3.42 (m, 4H), 2.40 (m, 4H), 2.19 (s, 3H); LC-MS (ESI) m/z: 299.0 (M+H+).
General Method B: Deprotection and Reductive Amination:
Intermediate B-I-24: 3-(3-bromo nitrophenyl) methyl-3,8-diazabicyclo[3.2.1 ]octane
<img file="IL287787A_D0185.tif" />
<img file="IL287787A_D0186.tif" />
I
[000223] A solution of tert-butyl 3-(3-bromo nitrophenyl)-3,8diazabicyclo[3.2.1]octane carboxylate (B-I-14, 2.57 g, 6.2 mol) in MeOH (30 mL) was treated with 4 N HC1 in 1,4-dioxanes (16 mL, 62 mmol) and the reaction mixture was stirred at rt 16 h. The reaction mixture was concentrated to dryness under vacuum to provide 3-(3bromo nitrophenyl)-3,8-diazabicyclo[3.2.1]octane hydrochloride (2.17 g, 100 % yield) as a white solid. Material was carried forward without further purification. A suspension of 3-(3bromo nitrophenyl)-3,8-diazabicyclo[3.2.1]octane hydrochloride (1.92 g, 5.5 mmol) in DCE (25 mL) was treated withDIEA (2.9 mL, 17 mmol) and formaldehyde (1.2 mL, 17 mmol). The yellow suspension became a clear orange solution. The reaction mixture was stirred for 10 min at rt and then acetic acid (0.63 mL, 11 mmol) was added. The orange solution became a yellow suspension which was stirred for 20 min. Sodium triacetoxyborohydride (2.33 g, 11 mmol) was added and the reaction mixture was stirred at rt for 4 h. The reaction mixture was diluted with aqueous NaHCO3 (50 mL) and the solution was extracted with DCM (3 x 50 mL). The combined organics were dried over anhydrous Na2SO4, filtered, and concentrated to afford a brown solid. The brown solid was purified using silica gel column chromatography (0 to 15 % MeOH/DCM) to afford 3-(3-bromo-4nitrophenyl) methyl-3,8-diazabicyclo[3.2.1]octane (1.71 g, 95 % yield) as a yellow solid. 1H NMR (400 MHz, DMSO-d6): δ 7.98 (d, J = 9.4 Hz, 1H), 7.10 (d, J = 2.7 Hz, 1H), 6.89 (dd, J = 9.5 and 2.7 Hz, 1H), 3.54 (d, J = 11.6 Hz, 2H), 3.22 (brs, 2H), 2.99-3.04 (m, 2H), 2.22 (s, 3H), 1.92-1.95 (m, 2H), 1.52-1.56 (m, 2H); LC-MS (ESI) m/z: 326.0 (M+H+).
General Method C: Alkylation:
Intermediate B-I-23: 1 -(2-fluoroethyl) (3-methyl nitropheny !)piperazine
<img file="IL287787A_D0187.tif" />
[000224] A mixture of 1-(3-methyl nitropheny!)piperazine hydrochloride (Bocdeprotected product of B-I-3 1.5 g, 0.58 mmol) and K2CO3 (4.0 g, 2.9 mmol) in 1,4-dioxane (20 mL) was treated with 1-fluoro iodoethane (2.0 mL, 2.6 mmol) [Note: material described as prone to instability - some solids present in the orange liquid], capped tightly and heated to 100 °C for 24 h. The mixture was cooled to rt and the solids (K2CO3) were removed via filtration, rinsed with DCM and the filtrate was concentrated to dryness to afford l-(2-fluoroethyl) (3-methyl nitrophenyl)piperazine (1.52 g, 98 % yield) as a yellow oil which solidified upon standing to an amber solid. 1H NMR (400 MHz, DMSO-d6): δ 7.97 (d, J = 9.6 Hz, 1H), 6.87-6.89 (m, 2H), 4.61 (t, J = 4.9 Hz, 1H), 4.52 (t, J = 4.9 Hz, 1H), 3.41 (m, 4H), 2.69 (t, J = 4.9 Hz, 1H), 2.63 (t, J = 4.9 Hz, 1H), 2.54-2.56 (m, 7H); LC-MS (ESI) m/z: 268.2 (M+H+).
[000225] Using the General Methods A-C above, the following Intermediates in Table A were prepared.
Table A.
<td> Intermediate</td><td> Structure</td><td> Method</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSOd<sub>6</sub>): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> B-I-l</td><td> NO, ΰ N 1</td><td> A</td><td> 90</td><td> 8.04 (d, J = 9.4 Hz, 2H), 7.02 (d, J = 9.4 Hz, 2H), 3.44 (brs, 4H), 2.41 (brs, 4H), 2.21 (s, 3H).</td><td> 222.1</td>
<td> B-I-2</td><td> no<sub>2 </sub>A Γ: N A</td><td> A</td><td> 81</td><td> 8.03 (d, 2H), 7.01 (d, 2H), 3.40 (t, J = 5.0 Hz, 4H), 2.63 (t, J = 5.0 Hz, 4H), 1.63-1.67 (m, 1H), 0.42-0.45 (m, 2H), 0.33-0.36 (m, 2H).</td><td> 248.2</td>
<td> B-I-3</td><td> no<sub>2 </sub>'φ t: N 1 Boc</td><td> A</td><td> 96</td><td> 7.99 (d, J = 9.0 Hz, 1H), 6.866.88 (m, 2H), 3.43 (s, 8H), 2.54 (s, 3H), 1.41 (s, 9H).</td><td> 322.2</td>
<td> B-I-4</td><td> no<sub>2</sub> C״:j N A</td><td> A</td><td> 90</td><td> 7.97 (d, J = 9.6 Hz, 1H), 6.87 (m, 2H), 3.37 (brs, 4H), 2.62 (brs, 4H), 2.54 (s, 3H), 1.64 (m, 1H), 0.43 (m, 2H), 0.36 (m, 2H).</td><td> 262.3</td>
<td> B-I-5</td><td> no<sub>2 </sub>'A %</td><td> A</td><td> 87</td><td> 7.99 (d, J = 9.2 Hz, 1H), 6.58 (brs, 2H), 4.82 (s, 1H), 4.69 (s, 1H), 3.78 (m, 1H), 3.63 (m, 1H), 3.52 (m, 1H), 3.16 (d, J = 10.0 Hz, 1H), 2.54 (s, 3H), 1.91 (m, 2H).</td><td> 235.1</td>
<td> B-I-6</td><td> no<sub>2 </sub>A o Boc</td><td> A</td><td> 80</td><td> No NMR Data</td><td> 322.2</td>
<td> B-I-7</td><td> no<sub>2</sub> Boc</td><td> A</td><td> 54</td><td> 7.95-7.98 (m, 1H), 6.72-6.74 (m, 2H), 3.73 (t, J = 6.0 Hz, 1H), 3.68 (t, J = 5.6 Hz, 1H), 3.58-3.62 (m, 2H), 3.54 (t, J = 6.0 Hz, 1H), 3.47 (t, J = 5.6 Hz, 1H), 3.26 (t, J = 5.2 Hz, 1H), 3.19(t, J = 5.7 Hz, 1H), 2.54 (d, J = 3.3 Hz, 3H), 1.80</td><td> 358.2 (M+Na+H<sup>+</sup>)</td>
<td></td><td></td><td></td><td></td><td> (t, J = 6.3Hz, 1H), 1.73 (s, 1H), 1.28 (s, 4H), 1.14 (s, 5H).</td><td></td>
<td> B-I-9</td><td> no<sub>2</sub> רץ 0 N 1 Boc</td><td> A</td><td> 100</td><td> 8.01 (d, J = 9.3 Hz, 1H), 7.24 (m, 1H), 7.01 (m, 1H), 3.44 (brs, 8H), 1.41 (s, 9H).</td><td> 408.0 410.0 (M+Na+H<sup>+</sup>) (M+Na+3H ר</td>
<td> B-I-10</td><td> no<sub>2 </sub>Bi\/L רץ 0</td><td> B</td><td> 92</td><td> 7.98 (d, J = 9.4 Hz, 1H), 7.24 (d, J = 2.7 Hz, 1H), 7.01 (dd, J = 9.4 and 2.7 Hz, 1H), 3.42 (t, J = 5.0 Hz, 4H), 2.44 (t, J = 5.0 Hz, 4H), 2.35 (q, J = 7.2 Hz, 2H), 1.01 (t, J = 7.2 Hz, 3H).</td><td> No data</td>
<td> B-I-ll</td><td> no<sub>2</sub> רץ 0</td><td> B</td><td> 95</td><td> No NMR Data</td><td> 328.0 330.0</td>
<td> B-I-12</td><td> no<sub>2 </sub>Β\Λ וזו ¢1</td><td> A</td><td> 58</td><td> 8.02 (d, J = 8.0 Hz, 1H), 7.27 (d, J = 2.0 Hz, 1H), 7.05 (dd, J = 8.0 and 2.0 Hz, 1H), 3.73 (m, 2H), 3.41 (m, 2H).</td><td> 287.0 289.0</td>
<td> B-I-13</td><td> no<sub>2</sub> BK/k Q 1</td><td> A</td><td> 53</td><td> 8.0 (d, J = 9.2 Hz, 1H), 7.24 (s, 1H), 6.99 (m, 1H), 4.02 (s, 2H), 3.72 (brs, 2H), 3.45 (d, J = 4.0, 2H), 2.90 (s, 3H).</td><td> 313.0 315.0</td>
<td> B-I-14</td><td> no<sub>2</sub> .N. 1 Boc</td><td> A</td><td> 76</td><td> 7.99 (d, J = 9.5 Hz, 1H), 7.19 (s, 1H), 6.95-6.97 (m, 1H), 4.16-4.23 (m, 2H), 3.72 (d, J = 12.1 Hz, 2H), 2.99 (d, J = 12.1Hz, 2H), 1.85 (brs, 2H), 1.67 (d, J = 7.5 Hz, 2H), 1.41 (s, 9H).</td><td> No Data</td>
<td> B-I-15</td><td> no<sub>2 </sub>ΒΚ/L רץ <sup>F</sup> A N</td><td> A</td><td> 37</td><td> 7.99 (d, J = 9.4 Hz, 1H), 7.18 (d, J = 2.7 Hz, 1H), 6.96 (dd, J = 9.4 and 2.8 Hz, 1H), 4.57 (t, J = 4.2 Hz, 1H), 3.44 (dd, J = 12.9 and 5.6 Hz, 1H), 3.013.07 (m, 1H), 2.88-2.97 (m, 3H), 2.80-2.86 (m, 1H), 2.71 (dd, J = 13.3, 4.9 Hz, 1H), 2.51 (s, 1H), 1.85-1.92 (m, 1H), 1.69-1.75 (m, 1H).</td><td> No Data</td>
<td> B-I-16</td><td> no<sub>2 </sub>BkzL רץ <sup>F </sup>ό N 1</td><td> A</td><td> 87</td><td> 8.02 (m, 1H), 7.33 (m, 1H), 3.26 (m,4H), 2.43 (m, 4 H), 2.20 (s, 3 H).</td><td> 318.0 320.0</td>
<td> B-I-17</td><td> o' <sup>M</sup> z</td><td> A</td><td> 20</td><td> 8.03 (d, J = 9.2 Hz, 1H), 6.93 (s, 1H), 6.69 (d, J = 9.3 Hz, 1H), 3.72 (t, J = 8.5 Hz, 1H), 3.58-3.66 (m, 2H), 3.52 (t, J = 7.8 Hz, 1H), 3.41-3.46 (m, 1H), 2.35-2.42 (m, 1H), 2.232.30 (m, 1H).</td><td> No Data</td>
<td> B-I-18</td><td> no<sub>2</sub> C H,</td><td> A</td><td> 76</td><td> 8.03 (d, J = 9.2 Hz, 1H), 6.93 (d, J = 2.6 Hz, 1H), 6.68 (dd, J = 9.3, 2.6 Hz, 1H), 3.703.73 (m, 1H), 3.58-3.66 (m, 2H), 3.53 (dt, J = 10.3 and 6.8 Hz, 1H), 3.41-3.46 (m, 1H), 2.36-2.41 (m, 1H), 2.23-2.30 (m, 1H).</td><td> No Data</td>
<td> B-I-19</td><td> no<sub>2</sub> 0 Boc</td><td> A</td><td> 77</td><td> 7.97 (dd, J = 9.4 and 4.1 Hz, 1H), 7.07 (s, 1H), 6.86 (d, J = 9.6 Hz, 1H), 3.47-3.76 (m, 6 H), 3.21-3.28 (m, 2H), 1.671.81 (m, 2H), 1.21 (s , 9H).</td><td> 422.2 424.2</td>
<td> B-I-20</td><td> no<sub>2</sub> :</td><td> A</td><td> 36</td><td> 7.98 (d, J = 9.4 Hz, 1H), 7.26 (d, J = 2.8 Hz, 1H), 7.03 (dd, J = 9.4, 2.8 Hz, 1H), 4.11 (d, J = 12.2 Hz, 1H), 3.95 (d, J = 12.7 Hz, 1H), 2.92-3.05 (m, 3H), 2.63(1, J =11.3 Hz, 1H), 2.15 (t, J = 11.3Hz, 1H), 2.06 (q, J = 8.7 Hz, 1H), 1.91-2.00 (m, 1H), 1.80-1.86 (m, 1H), 1.64-1.73 (m, 2H), 1.30- 1.40 (m, 1H).</td><td> 326.0 328.0</td>
<td> B-I-21</td><td> no<sub>2</sub></td><td> A</td><td> 64</td><td> 7.98 (d, J = 9.4 Hz, 1H), 7.26 (d, J = 2.8 Hz, 1H), 7.03 (dd, J = 9.4, 2.8 Hz, 1H), 4.11 (d, J = 12.2 Hz, 1H), 3.95 (d, J = 12.7 Hz, 1H), 2.92-3.05 (m, 3H), 2.63(1, J =11.3 Hz, 1H), 2.15 (1, J = 11.3Hz, 1H), 2.06 (q, J = 8.7 Hz, 1H), 1.91-2.00 (m, 1H), 1.80-1.86 (m, 1H), 1.64-1.73 (m, 2H), 1.30- 1.40 (m, 1H).</td><td> 326.0 328.0</td>
<td> B-I-22</td><td> no<sub>2</sub> N 1</td><td> A</td><td> 86</td><td> 7.97 (d, J = 9.6 Hz, 1H), 6.88 (d, J = 8.0 Hz, 2H), 3.40 (brs, 4H), 2.54 (s, 3H), 2.40 (brs, 4H), 2.20 (s, 3H).</td><td> 236.2</td>
<td> B-I-25</td><td> no<sub>2</sub> Br\J\ 7</td><td> A</td><td> 41</td><td> 8.00 (d, J = 9.1Hz, 1H), 6.69 (d, J = 2.5 Hz, 1H), 6.44 (dd, J = 9.1 and 2.5 Hz, 1H), 4.05 (m, 2H), 3.81 (dd,J = 9.1, 5.1Hz, 2H), 2.11 (s, 6H).</td><td> 300.2 302.2</td>
<td> B-I-26</td><td> no<sub>2</sub> רץ <sup>n</sup> ft 1</td><td> B</td><td> 44</td><td> 7.99 (d, J = 9.3 Hz, 1H), 6.606.91 (brm, 2H), 4.59 (s, 1H), 3.49 (s, 1H), 3.34 (s, 2H), 2.81 (dd, J = 9.6 and 2.0 Hz, 1H), 2.42,(d, J = 9.7 Hz, 1H), 2.27 (s, 3H), 1.90 (m, 1H), 1.75 (m, 1H).</td><td> 312.0 314.0</td>
<td> B-I-27</td><td> no<sub>2</sub> 0</td><td> A</td><td> 90</td><td> 8.86 (s, 1H), 6.83 (s, 1H), 3.68 (brs, 8H), 2.51 (s, 3H).</td><td> 224.33</td>
<td> B-I-28</td><td> no<sub>2 </sub>X^N נ) N 1</td><td> A</td><td> 99</td><td> 8.84 (s, 1H), 6.83 (s, 1H), 3.71 (brs, 4H), 2.52 (s, 3H), 2.37 (brs, 4H), 2.20 (s, 3H).</td><td> 237.2</td>
<td> B-I-29</td><td> no<sub>2</sub> 0 N 1</td><td> A</td><td> 83</td><td> 8.84 (s, 1H), 6.79 (s, 1H), 3.71 (brs, 4H), 2.89 (q, 2H), 2.38 (brs, 4H), 2.21 (s, 3H), 1.19 (t, J = 7.4 Hz, 3H).</td><td> 251.2</td>
<td> B-I-30</td><td> no<sub>2 </sub>TJ r N 1</td><td> A</td><td> 74</td><td> 7.87 (d, J = 9.2 Hz, 1H), 6.59 (d, J = 9.2 Hz, 1H), 6.53 (s, 1H), 3.90 (s, 3H), 3.43 (s, 4H), 2.41 (s, 4H), 2.21 (s, 3H),</td><td> 252.1</td>
<td> B-I-31</td><td> no<sub>2</sub> ז Xj 0 N 1</td><td> A</td><td> 71</td><td> 7.82 (d, J = 9.2 Hz, 1H), 6.51 (m, 2H), 4.82 (m, 1H), 3.92 (m, 4H), 2.40 (m, 4H), 2.21 (s, 3H), 1.28 (d, J = 6.0 Hz, 6H).</td><td> 280.1</td>
<td> B-I-32</td><td> no<sub>2</sub> רץ IS N 1</td><td> B</td><td> 87</td><td> 7.99 (d, J = 9.3 Hz, 1H), 6.606.91 (brm, 2H), 4.59 (s, 1H), 3.49 (s, 1H), 3.34 (s, 2H), 2.81 (dd, J = 9.6 and 2.0 Hz, 1H), 2.42,(d, J = 9.7 Hz, 1H), 2.27 (s, 3H), 1.90 (m, 1H), 1.75 (m, 1H).</td><td> 312.0 314.0</td>
<td> B-I-A</td><td> no<sub>2 </sub>ba! רץ N 1</td><td> A</td><td> 57</td><td> 7.88 (d, J = 9.1Hz, 1H), 5.98 (dd, J = 9.1, 2.2Hz, 1H), 5.80 (d, J = 2.3Hz, 1H), 4.20 (t, J = 8.3Hz, 2H), 3.83(1, J = 7.1Hz, 2H), 3.47 (d, J = 7.2Hz, 2H), 3.27 (m, 1H), 2.81 (s, 6H).</td><td> 314.0 316.0</td>
<td> B-I-B</td><td> 0 no<sub>2</sub> >ΑΛ 0 N 1</td><td> A</td><td> crude</td><td> No NMR Data</td><td> 280.2</td>
<td> B-I-C</td><td> no<sub>2 </sub>Bk/L רץ 0 /</td><td> A</td><td> 70</td><td> 8.01 (d, J = 9.3 Hz, 1H), 6.86 (d, J = 2.6 Hz, 1H), 6.61 (dd, J = 2.6 and 9.3 Hz, 1H), 3.54 (m, 1H), 3.44 (m, 1H), 3.35 (m, 1H), 3.12 (m, 1H), 2.77 (m, 1H), 2.18 (s, 6H), 2.14 (m, 1H), 1.80 (m, 1H).</td><td> 314.2 316.2</td>
<td> B-I-D</td><td> no<sub>2 </sub>Bia/L רץ /</td><td> A</td><td> 58</td><td> 8.01 (d, J = 9.3 Hz, 1H), 6.86 (d, J = 2.6 Hz, 1H), 6.61 (dd, J = 2.6 and 9.3 Hz, 1H), 3.54 (m, 1H), 3.44 (m, 1H), 3.35 (m, 1H), 3.12 (m, 1H), 2.77 (m, 1H), 2.18 (s, 6H), 2.14 (m, 1H), 1.80 (m, 1H).</td><td> 336.2 338.2 (Na)</td>
<td> B-I-E</td><td> no<sub>2 </sub>Br^/k רץ N % 1</td><td> A</td><td> 57</td><td> No NMR Data</td><td> 314.2</td>
<td rowspan="2"> B-I-F</td><td colspan="2"> no<sub>2</sub></td><td rowspan="2"> A</td><td rowspan="2"> 74</td><td rowspan="2"> 7.99 (d, J = 9.4 Hz, 1H), 7.07 (d, J = 2.7 Hz, 1H), 6.96 (dd, J = 2.7 and 9.5 Hz, 1H), 3.42 (t, J = 5.1 Hz, 4H), 2.39 (t, J = 5.1Hz, 4H), 2.20 (s, 3H).</td><td rowspan="2"> 256.0</td>
<td> C1\</td><td> 0 A</td>
<td></td><td></td><td> 1</td><td></td><td></td><td></td><td></td>
Intermediate B-I-33: l-(3-bromo nitrophenyl) methylpiperazin 2-one.
<img file="IL287787A_D0188.tif" />
[000226] A mixture of tert-butyl (2-aminoethyl) (methyl)carbamate (4.3 g, 24 mmol) and potassium carbonate (3.8 g, 27 mmol) in DMF (50 mL) was treated with 4-fluoro-2bromo nitrobenzene (5 g, 22 mmol) at rt under N2 atmosphere and the mixture was stirred at 90 °C for 16 h. The reaction mixture was diluted with water (200 mL) and the solution was extracted with EtOAc (2 x 100 mL), The combined organics were dried over anhydrous Na2SO4, filtered and concentrated. The crude was purified by silica gel column chromatography (2 % MeOH/DCM, 10 CV’s) to give tert-butyl (2-((3-bromo-4nitrophenyl)amino)ethyl)(methyl)carbamate (5.6 g, 66 % yield) as a yellow liquid. 1H NMR (400 MHz, DMSO-d6): δ 7.98 (d, J = 9.0 Hz, 1H), 6.77 (S, 1H), 6.46 (d, J = 9.0 Hz, 1H), 3.54 (s, 2H), 3.31 (t, J = 6.0 Hz, 2H), 2.90 (s, 3H), 1.47 (s, 9H); LC-MS (ESI) m/z: 374.1 (M+H+).
[000227] A mixture of tert-butyl (2-((3-bromo-4nitrophenyl)amino)ethyl)(methyl)carbamate (5.6 g, 15 mmol) and TEA (7.6 g, 75 mmol) in DCM (100 mL) was treated with chloroacetylchloride (5.1 g, 45 mmol) at 0 °C under N2 atmosphere and the mixture was stirred at rt for 16 h. The reaction mixture was diluted with water (100 mL) and the solution was extracted with DCM (2 x 100 mL). The combined organics were evaporated under reduced pressure and the crude was purified by silica gel column chromatography (2 % MeOH/DCM, 10 CV’s) to obtain tert-butyl (2-(N-(3-bromo-4nitrophenyl) chloroacetamido)ethyl)(methyl)carbamate (5.6 g, 66 % yield) as a yellow liquid. 1H NMR (400 MHz, DMSO-d6): δ 8.12 (d, J = 8.6 Hz, 1H), 7.97 (s, 1H), 6.66 (d, J =
&#906;Α Hz, 1Η), 4.24 (m, 2H), 3.82 (s, 2H), 3.18 (s, 2H), 2.70 (s, 3H), 1.41 (s, 9H); LC-MS (ESI) m/z: 374.1 (M+H+).
[000228] A solution of N-(3-bromo nitrophenyl) chloro-N-(2(methylamino)ethy!)acetamide hydrochloride (5.6 g, 12 mmol) in dioxane (100 mL) was treated with 4 N HC1 in 1,4-dioxane (100 mL) at 0 °C under N2 atmosphere and the reaction mixture was stirred at rt for 16 h. The reaction mixture evaporated under reduced pressure and the crude was purified by crystallization in Et2O (100 mL) to obtain N-(3-bromo-4nitrophenyl) chloro-N-(2-(methylamino)ethyl)acetamide hydrochloride (4.79 g, 99 % yield) as a yellow solid. 1H NMR (400 MHz, DMSO-d6): δ 8.75 (brs, 2H), 8.16 (m, 2H), 7.83 (d, J = 7.8 Hz, 1H), 4.20 (s, 2H), 3.98 (t, 2H), 3.20 (s, 2H), 2.56 (s, 3H), 1.41 (s, 9H); LC-MS (ESI) m/z: 374.1 (M+H+).
[000229] A solution of N-(3-bromo nitrophenyl) chloro-N-(2(methylamino)ethyl)acetamide hydrochloride (5.0 g, 12 mmol) in DMF (50 mL) was added to NaH in 60% mineral oil (1.1 g, 25 mmol) at 0 °C under N2 atmosphere and the reaction mixture was stirred at rt for 2 h. The reaction mixture was diluted with water (100 mL) and the solution was extracted with EtOAc (2 x 50 mL), The combined organics were evaporated under reduced pressure and the crude was purified by silica gel column chromatography (2 % MeOH/DCM, 10 CV’s) to give l-(3-bromo nitrophenyl) methylpiperazin one (3.1 g, 76 % yield) as a yellow solid. 1H NMR (400 MHz, DMSO-d6): δ 8.0 (d, J = 9.4 Hz, 1H), 7.24 (d, J = 2.3 Hz, 1H), 6.99 (dd, J = 2.3 and 9.3 Hz, 1H), 4.0 (s, 2H), 3.72 (t, J = 5.4 Hz, 2H), 3.45 (t, J = 5.4 Hz, 2H), 2.90 (s, 3H); LC-MS (ESI) m/z: 314.2 (M+H+).
Intermediate B-I-34: 1 -(3-(methoxymethyl) nitrophenyl) methylpiperazine:
<img file="IL287787A_D0189.tif" />
N
I
[000230] A solution of (5-(4-methylpiperazin-l-yl) nitrophenyl)methanol (1.0 g, 4.0 mmol) in DMF (30 mL) was cooled to 0 °C. Sodium hydride (0.80 g, 60% in mineral) was added in portions and the mixture was stirred under the same conditions. lodomethane (1.7 g, 12 mmol) was added at 0 °C and the mixture was slowly warmed to rt and stirred for 2 h. The reaction was diluted with EtOAc and carefully quenched with ice water. The mixture was extracted with EtOAc (3 x 30 mL) and the combined organic extracts were dried over anhydrous Na2SO4, filtered and concentrated under the reduced pressure to obtain the crude. The crude was purified by silica gel column chromatography (hexane/EtOAc) 1-(3(methoxymethyl) nitrophenyl) methylpiperazine (0.76 g, 72 % yield). 1H NMR (400 MHz, DMSO-d6): δ 8.03 (m, 1H), 7.08 (s, 1H), 6.96 (m, 1H), 4.76 (s, 2H), 3.45 (brs, 4H), 3.40 (s, 3H), 2.42 (brs, 4H), 2.22 (s, 3H); LC-MS (ESI) m/z: 266.2 (M+H+).
General Method D: Suzuki Coupling Reaction:
Intermediate C-V-4: l-methyl (3-methyl nitrophenyl)-lH-imidazole:
<img file="IL287787A_D0190.tif" />
[000231] A suspension of 4,4,5,5-tetramethyl (3-methyl nitrophenyl)-l,3,2dioxaborolane (0.80 g, 3.0 mmol) and 4-bromo-l-methyl-IH-imidazole (0.49 g, 3.0 mmol) in a mixture of 1,4-dioxane (12 mL) and water (0.5 mL) was treated with potassium carbonate (1.26 g, 9.1 mmol) and the suspension was allowed to stir. The reaction mixture was degassed by bubbling argon for two minutes and treated with Pd(dppf)C12.DCM adduct (0.50 g, 0.61 mmol). The resulting reaction mixture was heated at 100 °C 16 h. The reaction was diluted with water and extracted with DCM (4 x 25 mL). The organics were combined and dried over anhydrous Na2SO4, filtered and concentrated to dryness under vacuum to afford a black oil. The black oil was purified using silica gel (0 to 15% MeOH/DCM, 15 CV's) to obtain l-methyl (3-methyl nitrophenyl)-lH-imidazole (0.31 g, 47 % yield). 1H NMR (400 MHz, DMSO-d6): δ 8.02 (d, J = 8.6 Hz, 1H), 7.84 (d, J = 7.7 Hz, 2H), 7.77 (d, J = 8.6 Hz, 1H), 7.72 (s, 1H), 3.70 (s, 3H), 2.57 (s, 3H); LC-MS (ESI) m/z: 218.2 (M+H+).
[000232] Using the General Method D above, the following Intermediates of Table B were prepared.
Table B.
<td> Intermediate</td><td> Structure</td><td> Method</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSOd6): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> c-v-1</td><td> no<sub>2</sub></td><td> D</td><td> 62</td><td> No NMR Data</td><td> 319.2</td>
<td></td><td> 1 Boc</td><td></td><td></td><td></td><td></td>
<td> C-V-2</td><td> no<sub>2</sub> κ 1</td><td> D</td><td> 64</td><td> No NMR Data</td><td> 233.2</td>
<td> C-V-3</td><td> no<sub>2 </sub>X) N-N</td><td> D</td><td> 72</td><td> 8.34 (s, 1H), 8.02 (s, 1H), 8.00 (s, 1H), 7.72 (s, 1H), 7.63 (m, 1H), 3.88 (s, 3H), 2.56 (s, 3H).</td><td> 218.2</td>
General Method E: Suzuki coupling reaction
Intermediate C-I-l: l-(3-cyclopropyl nitrophenyl) methylpiperazine
<img file="IL287787A_D0191.tif" />
[000233] A mixture of l-(3-bromo nitrophenyl) methylpiperazine (B-I-8, 20 g, 67 mmol) and cyclopropylboronic acid (8.6 g, 100 mmol) in toluene: H2O (9:1) (200 mL) was treated with K3PO4 (43 g, 200 mmol) and the reaction mixture was purged with nitrogen for 20 min. Tricyclohexyl phosphine (3.7 g, 13 mmol) and Pd(OAc)2 (2.2 g, 10 mmol) were added into the reaction mixture and then the reaction mixture was stirred at 100 °C for 5 h.
the reaction mixture was diluted with water (100 mL) and the solution was extracted with EtOAc (3 x 200 mL). The combined organic extracts were washed with brine (50 mL), dried over anhydrous Na2SO4, filtered and concentrated. The crude was purified by silica gel column chromatography (0 to 80% EtOAc/hexane, 15 CV’s) to obtain l-(3-cyclopropyl-4 nitrophenyl) methy!piperazine (12 g, 69 % yield) as a yellow solid. 1H NMR (400 MHz, DMSO-d6): δ 7.89 (d, J = 9.3 Hz, 1H), 6.85 (dd, J = 2.4 and 9.4 Hz 1H), 6.55 (s, 1H), 3.36 (m, 4H), 2.45 (m, 1H), 2.40 (m, 4H), 2.20 (s, 3H), 0.94 (m, 2H), 0.75 (m, 2H); LC-MS (ESI) m/z: 261.3 (M+H+).
General Method F: Suzuki coupling reaction
Intermediate C-I-12: l-methyl (4-nitro vinylphenyl) piperazine
<img file="IL287787A_D0192.tif" />
[000234] A mixture of l-(3-bromo nitrophenyl) methylpiperazine (B-I-8, 30 g, lOOmmol) and potassium trifluorovinyl borate (20 g, 150 mmol) in DMSO (210 mL) was treated with K2CO3 (42 g, 301 mmol) at rt and the reaction mixture was purged with nitrogen for 15 min. PdC12(dppf) (3.7 g, 5.0 mmol) was added into the reaction mixture and the reaction mixture was stirred at 80 °C for 3 h. The reaction mixture was diluted with cold water (300 mL) and the solution was extracted with EtOAc (3 x 250 mL). The combined organic extracts were washed with brine (200 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. The crude was purified by silica gel column chromatography (0 to 80 % EtOAc/hexane, 10 CV’s) to obtain l-methyl (4-nitro-3vinylphenyl) piperazine. (20 g, 81 % yield) as a yellow solid. 1H NMR (400 MHz, DMSOd6): δ 7.96 (d, J = 9.2 Hz, 1H), 7.21 (m, 1H), 6.98 (m, 2H), 5.77 (t, J = 17.2 Hz, 1H), 5.41 (d, J = 11.2 Hz, 1H), 3.44 (t, J = 4.8 Hz, 4H), 2.42 (t, J = 4.8 Hz, 4H), 2.21 (s, 3H); LC-MS (ESI) m/z: 247.3 (M+H+).
[000235] The General Method E or General Method F for the Suzuki reaction was used to prepare the following intermediates in Table C.
Table C.
<td> Intermediate</td><td> Structure</td><td> Method</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSOd6): δ</td><td> LC-MS</td>
Ill
<td></td><td></td><td></td><td></td><td></td><td> (m/z: (M+H<sup>+</sup>)</td>
<td> C-I-2</td><td> Λ N02 פ N 1 Boc</td><td> E</td><td> 43</td><td> 7.90 (d, J = 9.3 Hz, 1H), 6.84 (dd, J = 9.3 and 2.7 Hz, 1H), 6.53 (d, J = 2.7 Hz, 1H), 3.363.45 (m, 8H), 2.44-2.47 (m, 1H), 1.41 (s, 9H), 0.93-0.97 (m, 2H), 0.73-0.76 (m, 2H).</td><td> No MS Data</td>
<td> C-I-3</td><td> a NO2 פ! k.</td><td> E</td><td> 91</td><td> No NMR Data</td><td> 276.2</td>
<td> C-I-4</td><td> A <sup>N</sup>°<sup>2</sup> γτ Λ N 1</td><td> E</td><td> 62</td><td> 7.83 (d, J = 5.9 Hz, 1H), 6.63 (d, J = 5.9 Hz, 1H), 3.21 (s, 4H), 2.43 (s, 4H), 2.38 (m, 1H), 2.20 (s, 3H), 0.96 (m, 2H), 0.74 (m, 2H).</td><td> 280.2</td>
<td> C-I-5</td><td> A <sup>N</sup>°<sup>2</sup> סי N 1</td><td> E</td><td> 53</td><td> 7.91 (d, J = 9.2 Hz, 1H), 6.84 (m, 1H), 6.49 (m, 1H), 3.98 (s, 2H), 3.68 (m, 2H), 3.45 (m, 2H), 2.9 (s, 3H), 2.47 (s, 1H), 0.94 (m, 2H), 0.78 (m, 2H).</td><td> 276.1</td>
<td> C-I-6</td><td> A NO<sub>2</sub> סי Q 1</td><td> E</td><td> 78</td><td> 7.91 (d, J = 9.2 Hz, 1H), 6.84 (m, 1H), 6.49 (m, 1H), 3.98 (s, 2H), 3.68 (m, 2H), 3.45 (m, 2H), 2.8 (s, 3H), 2.47 (s, 1H), 0.94 (m, 2H), 0.78 (m, 2H).</td><td> 276.1</td>
<td> C-I-7</td><td> a no<sub>2 </sub>10 c \</td><td> E</td><td> 44</td><td> 7.91 (d, J = 9.3 Hz, 1H), 6.66 (dd, J = 2.6 and 9.4 Hz 1H), 6.32 (d, J = 2.4 Hz, 1H), 3.59 (m, 2H), 3.53 (m, 2H), 3.28 (m, 1H), 2.58 (m, 2H), 2.44 (m, 2H), 2.24 (s, 3H), 1.87 (m,</td><td> 276.1</td>
<td></td><td></td><td></td><td></td><td> 2H), 0.95 (dd, J =1.6 and 8.4 Hz, 2H), 0.73 (m, 2H).</td><td></td>
<td> C-I-8</td><td> A <sup>N</sup>°<sup>2</sup> 0</td><td> E</td><td> 93</td><td> 7.90 (d, J = 9.3 Hz, 1H), 6.86 (dd, J = 9.3 and 2.6 Hz, 1H), 6.55 (d, J = 2.6 Hz, 1H), 3.70 (t, J = 4.8 Hz, 4H), 3.30-3.33 (m, 4H), 2.46-2.48 (m, 1H), 0.93-0.96 (m, 2H), 0.73-0.76 (m, 2H).</td><td> No Data</td>
<td> C-I-9</td><td> Y</td><td> E</td><td> 58</td><td> 7.89 (d, J = 8.5 Hz, 1H), 6.87 (m, 1H), 6.55 (d, J = 2.6 Hz, 1H), 3.99 (m, 2H), 2.97-3.04 (m, 2H), 2.88 (m, 1H), 2.55 (m, 1H), 2.45-2.47 (m, 1H), 2.15 (m, 1H), 2.05 (m, 1H), 1.95 (m, 1H), 1.80-1.85 (m, 1H), 1.63-1.74 (m, 2H), 1.35 (m, 1H), 0.92-0.96 (m, 2H), 0.72-0.75 (m, 2H).</td><td> 288.2</td>
<td> C-I-10</td><td> A <sup>N</sup>°<sup>2 </sup>Ό N. 1</td><td> E</td><td> 64</td><td> 7.91 (d, J = 9.2 Hz, 1H), 6.50 (s, 1H), 6.18 (s, 1H), 4.55 (s, 1H), 3.48 (s, 1H), 2.80 (d, J = 9.5 Hz, 1H), 2.53 (m, 1H), 2.41 (d, J = 9.8 Hz, 1H), 2.27 (s, 3H), 1.89 (d,J = 9.3 Hz, 1H), 1.73 (d, J = 9.7 Hz, 1H), 0.94 (m, 2H), 0.71 (m, 2H).</td><td> 274.2</td>
<td> C-I-ll</td><td> Λ NO2</td><td> E</td><td> 78</td><td> 7.90 (d, J = 9.0 Hz, 1H), 6.28 (dd, J = 9.1 and 2.4 Hz, 1H), 6.01 (s, 1H), 4.01 (t, J = 7.8 Hz, 2H), 3.75 (dd, J = 8.6 and 5.2 Hz, 2H), 3.12 (m, 1H), 2.10 (s, 6 H), 0.95 (m, 2H), 0.8 (m, 2H).</td><td> 262.2</td>
<td> C-I-13</td><td> no<sub>2 </sub>Y נ) N 1 Boc</td><td> F</td><td> 87</td><td> 7.98 (d, J = 9.3 Hz, 1H), 7.21 (dd, J = 17.2 and 10.9 Hz, 1H), 6.95-6.97 (m, 2H), 5.79 (d, J = 17.2 Hz, 1H), 5.42 (d, J= 11.0 Hz, 1H), 3.46 (s, 8H), 1.41 (s, 9H).</td><td> 356.2 (M+Na+ H<sup>+</sup>).</td>
<td> C-I-14</td><td> no<sub>2 </sub>׳Ό 0 k</td><td> F</td><td> 77</td><td> No NMR Data</td><td> 262.2</td>
<td> C-I-15</td><td> no<sub>2 </sub>γ</td><td> F</td><td> 96</td><td> No NMR Data</td><td> 276.2</td>
<td></td><td> 0</td><td></td><td></td><td></td><td></td>
<td> C-I-16</td><td> no<sub>2 </sub>γφ 0</td><td> F</td><td> 90</td><td> 7.98 (d, J = 9.0 Hz, 1H), 7.21 (dd, J = 17.3 and 10.9 Hz, 1H), 7.00 (m 1H), 6.98 (s, 1H), 5.80 (d, J = 17.2 Hz, 1H), 5.42 (d, J = 11.0 Hz, 1H), 3.72 (t, J = 4.8 Hz, 4H), 3.41 (t, J = 4.8 Hz, 4H).</td><td> 235.2</td>
<td> C-I-17</td><td> no<sub>2</sub> כץ Φ.</td><td> F</td><td> 81</td><td> 8.01 (d,J = 9.1 Hz, 1H), 7.25 (dd, J = 17.3 and 10.9 Hz, 1H), 6.62-6.65 (m, 2H), 5.78 (d, J = 17.3 Hz, 1H), 5.41 (d, J =11.0 Hz, 1H), 3.73-3.77 (m, 1H), 3.46-3.70 (m, 4H), 2.35-2.43 (m, 1H), 2.24-2.31 (m, 1H).</td><td> No Data</td>
<td> C-I-18</td><td> no<sub>2</sub> כץ 0 tN</td><td> F</td><td> 72</td><td> 8.01 (d,J = 9.1 Hz, 1H), 7.25 (dd, J = 17.3 and 10.9 Hz, 1H), 6.62-6.65 (m, 2H), 5.78 (d, J = 17.3 Hz, 1H), 5.41 (d, J =11.0 Hz, 1H), 3.73-3.77 (m, 1H), 3.46-3.70 (m, 4H), 2.35-2.43 (m, 1H), 2.24-2.31 (m, 1H).</td><td> No Data</td>
<td> C-I-19</td><td> no<sub>2</sub> -φ N 1</td><td> F</td><td> 32</td><td> 7.99 (d, J = 9.2 Hz, 1H), 7.24 (m, 1H), 6.96 (m, 2H), 5.86 (d, J = 18.1 Hz, 1H), 5.44 (d, J = 11.9 Hz, 1H), 4.05 (s, 2H), 3.75 (t, J = 5.2 Hz, 2H), 3.47 (t, J = 5.4 Hz, 2H), 2.91 (s, 3H).</td><td> 262.2</td>
<td> C-I-20</td><td> no<sub>2</sub> 0׳ 1</td><td> F</td><td> 42</td><td> 7.99 (d, J = 9.2 Hz, 1H), 7.22 (m, 1H), 6.96 (m, 2H), 5.85 (m, 1H), 5.44 (d, J= 11.0 Hz, 1H), 4.04 (s, 2H), 3.75 (t, J = 5.2 Hz, 2H), 3.47 (t, J = 5.6 Hz, 2H), 2.92 (s, 3H).</td><td> 262.3</td>
<td> C-I-21</td><td> no<sub>2</sub><sup>n</sup> 1</td><td> F</td><td> 87</td><td> 7.96 (d, J = 9.3 Hz, 1H), 7.23 (dd, J = 17.2 and 10.9 Hz, 1H), 6.84 (m, 2H), 5.76 (d, J = 17.2 Hz, 1H), 5.39 (d, J= 11.0 Hz, 1H), 3.60 (d, J =11.4 Hz, 2H), 3.23 (brs, 2H), 3.03 (d, J = 11.4 Hz, 2H), 2.23 (s, 3H), 1.95 (m, 2H), 1.56 (m, 2H).</td><td> 274.2</td>
<td> C-I-22</td><td> no<sub>2</sub></td><td> F</td><td> 56</td><td> No NMR Data</td><td> 260.2</td>
<td> C-I-23</td><td> no<sub>2</sub></td><td> F</td><td> 95</td><td> 7.96 (d, J = 9.3 Hz, 1H), 7.21 (dd, J = 17.2 and 10.9 Hz, 1H), 7.00 (dd, J = 9.4 and 2.9 Hz, 1H), 6.96 (d, J = 2.8 Hz, 1H), 5.79 (dd, J = 17.2 and 1.2 Hz, 1H), 5.41 (d, J= 11.0 Hz, 1H), 4.15 (d, J= 12.1 Hz, 1H), 3.99 (d, J = 12.6 Hz, 1H), 2.91-3.06 (m, 3H), 2.62 (t, J = 11.2 Hz, 1H), 2.18 (td, J =11.3 and 3.3 Hz, 1H), 2.06 (q, J = 8.7 Hz, 1H), 1.98 (m, 1H), 1.84(m, 1H), 1.63-1.76 (m, 2H), 1.341.42 (m, 1H).</td><td> 274.2</td>
<td> C-I-24</td><td> 0׳ 0</td><td> F</td><td> 100</td><td> 7.96 (d, J = 9.3 Hz, 1H), 7.21 (dd, J = 17.2 and 10.9 Hz, 1H), 7.00 (dd, J = 9.4 and 2.9 Hz, 1H), 6.96 (d, J = 2.8 Hz, 1H), 5.79 (dd, J = 17.2 and 1.2 Hz, 1H), 5.41 (dd, J =11.0 and 1.2 Hz, 1H), 4.15 (d, J = 12.1 Hz, 1H), 3.99 (d, J = 12.6 Hz, 1H), 3.06 (d, J = 11.2 Hz, 1H), 2.923.03 (m, 2H), 2.62 (t, J = 11.2 Hz, 1H), 2.17 (td, J =11.3 and</td><td> 274.2</td>
<td></td><td></td><td></td><td></td><td> 3.3 Hz, 1H), 2.06 (q, J = 8.7 Hz, 1H), 1.98 (m, 1H), 1.84 (m, 1H), 1.63-1.74 (m, 2H), 1.37 (m, 1H).</td><td></td>
<td> C-I-25</td><td> no<sub>2 </sub>Ϋ N 1</td><td> F</td><td> 79</td><td> 7.90 (d, J = 13.6 Hz, 1H), 7.067.15 (m, 2H), 5.83 (d, J = 17.3 Hz, 1H), 5.47 (d, J = 11.0 Hz, 1H), 3.26-3.30 (m, 4H), 2.442.47 (m, 4H), 2.22 (s, 3H).</td><td> 266.2</td>
<td> C-I-26</td><td> no<sub>2</sub> כץ 0 N \</td><td> F</td><td> 75</td><td> 7.98 (d, J = 9.4 Hz, 1H), 7.27 (m, 1H), 6.80 (dd, J = 2.9 and 9.3 Hz, 1H), 6.71 (d, J = 2.3 Hz, 1H), 5.70 (d, J = 18.4 Hz, 1H), 5.39 (d, J = 11.2 Hz, 1H), 3.66 (m, 2H), 3.59 (m, 2H), 2.63 (m, 2H), 2.45 (m, 2H) 2.25 (s, 3H), 1.89 (m, 2H).</td><td> 262.2</td>
<td> C-I-27</td><td> no<sub>2</sub> 0 N Boc</td><td> F</td><td> 92</td><td> 7.98 (d, J = 9.4 Hz, 1H), 7.26 (dd, J = 17.2 and 10.9 Hz, 1H), 6.84 (d, J = 9.6 Hz, 1H), 6.77 (d, J = 9.1Hz, 1H), 5.75 (d, J = 17.2 Hz, 1H), 5.42 (d, J= 11.0 Hz, 1H), 3.52-3.81 (m, 6H), 3.23-3.31 (m, 2H), 1.72-1.90 (m, 2H), 1.22 (s, 9H).</td><td></td>
<td> C-I-28</td><td> 1 no<sub>2</sub> נ־:) N 1</td><td> F</td><td> 57</td><td> 7.93 (d, J = 9.3 Hz, 1H), 6.95 (dd, J = 2.7 and 9.3 Hz, 1H), 6.69 (d, J = 2.7 Hz, 1H), 5.07 (s, 1H), 4.83 (s, 1H), 3.40 (brs, 4H), 2.41 (brs, 4H), 2.21 (s, 3H), 1.82 (s, 3H).</td><td> 262.3</td>
<td> C-I-29</td><td> I NO2 ל: Y</td><td> F</td><td> 88</td><td> 7.93 (d, J = 9.2 Hz, 1H), 6.94 (m, 1H), 6.69 (d, J = 2.0 Hz, 1H), 5.07 (s, 1H), 4.83 (s, 1H), 3.40 (m, 4H), 2.45 (m, 4H), 2.35 (q, J = 6.8 Hz, 2H), 1.98 (s, 3H), 1.02 (t, J = 6.8 Hz, 3H).</td><td> 276.3</td>
<td> C-I-30</td><td> C 1</td><td> F</td><td> 92</td><td> 7.90 (d, J = 9.2 Hz, 1H), 6.94 (d, J = 9.3 Hz, 1H), 6.72 (d, J = 2.2 Hz, 1H), 5.71 (s, 1H), 3.37 (m, 4H), 2.41 (m, 8H), 2.20 (s, 3H), 1.95 (m, 2H).</td><td> 289.2</td>
<td> C-I-31</td><td> NO, Ό N. IN 1</td><td> F</td><td> 91</td><td> 7.97 (d, J = 9.3 Hz, 1H), 7.24 (dd, J = 17.2 and 10.9 Hz, 1H), 6.61 (d, J = 23.0 Hz, 2H), 5.73 (d, J = 17.2 Hz, 1H), 5.38 (d, J = 11.0 Hz, 1H), 4.60 (s, 1H), 3.49 (s, 1H), 3.31 (s, 2H), 2.82 (dd, J = 9.6 and 2.0 Hz, 1H), 2.44 (m, 1H), 2.28 (s, 3H), 1.71-1.90 (m, 2H).</td><td> 260.2</td>
<td> C-I-32</td><td> NO, Ό N % 1</td><td> F</td><td> 63</td><td> No NMR Data</td><td> 262.2</td>
<td> C-I-34</td><td> no<sub>2</sub> 0 N — /</td><td> F</td><td> 74</td><td> No NMR Data</td><td> 262.2</td>
<td> C-I-35</td><td> no<sub>2</sub> Q /</td><td> F</td><td> 63</td><td> No NMR Data</td><td> 262.2</td>
<td> C-I-36</td><td> A <sup>N</sup>°<sup>2</sup> a N 1 Boc</td><td> E</td><td> 89</td><td> 7.90 (d, J = 9.2 Hz, 1H), 6.78 (dd, J = 2.5 and 9.3 Hz, 1H), 6.47 (s, 1H), 4.51 (brm, 2 H), 3.61 (brm, 2 H), 3.05 (brm, 1H), 2.90 (brm, 1H), 1.93 (s, 2H), 1.71 (m, 2H), 1.38 (s, 9H), 0.94 (m, 2 H), 0.75 (m, 2H).</td><td> 396.2 (M+Na+ H<sup>+</sup>).</td>
<td> C-I-37</td><td> a NO<sub>2</sub> ή N 1</td><td> E</td><td> crude</td><td> No data</td><td> 288.2</td>
<td> C-I-38</td><td> A O<sub>2</sub>N N % 1</td><td> E</td><td> 68</td><td> No Data</td><td> 276.2</td>
General Method G: Reduction
Intermediate D-I-l: 2-cyclopropyl (4-methylpiperazin-l-yl) aniline
<img file="IL287787A_D0193.tif" />
[000236] A solution of l-(3-cyclopropyl nitrophenyl) methylpiperazine (C-I-l, 12 g, 46 mmol) in MeOH (60 mL) at 0 °C, was treated with NH4C1 (73 g, 14 mmol) and the reaction mixture was stirred at 0 °C for 10 min. Zinc dust (30 g, 459 mmol) was added slowly (internal temperature increased to 20 °C) into the reaction mixture under an ice-water bath. After 15 minutes of stirring, the reaction mixture was warmed to rt and allowed to stir vigorously at rt for 16 h. The mixture was filtered through a pad of Celite and washed with THF (500 mL). The filtrate was concentrated under reduced pressure to afford 2-cyclopropyl4-(4-methylpiperazin-l-yl) aniline (10 g, 95 %) as a dark brown sticky solid. 1H NMR (400 MHz, DMSO-d6): δ 6.52 (m, 2H), 6.43 (d, J = 2.0 Hz, 1H), 4.52 (brs, 2H), 2.88 (m, 4H), 2.42 (m, 4H), 2.20 (s, 3H), 1.65 (m, 1H), 0.813 (m, 2H), 0.471 (m, 2H); LC-MS (ESI) m/z: 213.2 (M+H+).
General Method H: Reduction
Intermediate D-I-ll: 2-ethyl (4-methylpiperazin-l-yl)aniline
<img file="IL287787A_D0194.tif" />
[000237] A solution of l-methyl (4-nitro vinylphenyl) piperazine (C-I-12, 20 g, 81 mmol) in EtOAc (200 mL) was treated with Pd/C (20 g, 10% w/w, 50 % moisture) under nitrogen atmosphere and the mixture was then stirred under hydrogen balloon pressure at rt for 3h. After general work up, 2-ethyl (4-methylpiperazin-l-yl)aniline (16 g, 90 % yield) was obtained as a brown sticky solid. 1H NMR (400 MHz, DMSO-d6): δ 6.61 (s, 1H), 6.52 (m, 2H), 4.25 (brs, 2H), 2.89 (t, J = 4.4 Hz, 4H), 2.41 (m, 6H), 2.19 (s, 3H), 1.09 (t, J = 7.6 Hz, 3H); LC-MS (ESI) m/z: 219.3 (M+H+).
[000238] Using the General Method G or H for preparing D-Ι-1 or D-Ι-11, the following intermediates in Table D were prepared.
Table D.
<td> Intermediate</td><td> Structure</td><td> Method</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSO-d6): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> D-I-2</td><td> Λ NH2 סי ל: N 1 Boc</td><td> G</td><td> 76</td><td> 6.56 (d, J = 8.6 Hz, 1H), 6.51 (d, J = 8.5 Hz, 1H), 6.45 (s, 1H), 4.53 (s, 2H), 3.39 (s, 4H), 2.80 (s, 4H), 1.63 (s, 1H), 1.39 (s, 9H), 0.80 (d, J = 8.0 Hz, 2H), 0.47 (d, J = 5.2 Hz, 2H).</td><td> No Data</td>
<td> D-I-3</td><td> A <sup>NH</sup>2 0</td><td> G</td><td> 100</td><td> 6.51-6.56 (m, 2H), 6.43 (s, 1H), 4.49 (s, 2H), 3.67 (t, J = 4.6 Hz, 4H), 2.85 (t, J = 4.5 Hz, 4H), 1.65 (m, 1H), 0.80 (m, 2H), 0.46 (m, 2H).</td><td> 219.2</td>
<td> D-I-4</td><td> A NH<sub>2</sub> N 1</td><td> G</td><td> 100</td><td> 6.49 (d, J = 5.1 Hz, 1H), 6.38 (d, J = 5.1 Hz, 1H), 4.85 (s, 2H), 2.80 (s, 4H), 2.40 (s, 4H), 2.18 (s, 3H), 0.80 (m, 2H), 0.44 (m, 2H).</td><td> 250.2</td>
<td> D-I-5</td><td> A <sup>NH2</sup> Ό <sup>N 0</sup> N 1</td><td> G</td><td> 96</td><td> 6.56 (m, 2H), 6.46 (s, 1H), 4.56 (s, 2H), 3.48 (s, 2H), 3.32 (s, 2H), 3.18 (s, 2H), 2.85 (s, 3H), 1.65 (m, 1H), 0.83 (m, 2H), 0.50 (m, 2H).</td><td> 246.1</td>
<td> D-I-6</td><td> A <sup>NH2</sup> Ό 1</td><td> G</td><td> 70</td><td> 6.55 (m, 2H), 6.46 (s, 1H), 4.55 (brs, 2H), 3.48 (s, 2H), 3.32 (s, 2H),3.17(s, 2H), 2.85 (s, 3H), 1.65 (s, 1H), 0.82 (m, 2H), 0.50 (m, 2H).</td><td> 246.2</td>
<td> D-I-7</td><td> A <sup>NH</sup>2 0 <sup>7</sup>-N \</td><td> G</td><td> 74</td><td> 6.63 (m, 1H), 6.46 (m, 1H), 6.27 (s, 1H), 3.54 (brm, 2H), 3.32 (m, 6H) 3.16 (m, 2H), 2.82 (s, 3H), 2.11 (brs, 2H), 1.70 (s, 1H), 0.84 (brm, 2H), 0.51 (brm, 2H).</td><td> 246.2</td>
<td> D-I-8</td><td></td><td> G</td><td> 100</td><td> 6.57 (m, 2H), 6.44 (m, 1H), 4.48 (brs, 2H), 3.40 (m, 1H), 3.26 (m, 1H), 2.96 (m, 2H), 2.56 (m, 1 H), 2.18-2.26 (m, 2H), 2.04 (m, 2H), 1.62-1.80 (m, 4H), 1.32 (m, 1H), 0.81 (m, 2H), 0.45 (m, 2 H).</td><td> 258.2</td>
<td> D-I-9</td><td> N TL 1</td><td> G</td><td> 91</td><td> 6.51 (d, J = 8.6 Hz, 1H), 6.24 (s, 1H), 6.08 (s, 1H), 4.19 (s, 1H), 3.63 (s, 1H), 3.31 (s, 2H), 3.05-3.05 (m, 1H), 2.80 (brs, 2H), 2.39 (s, 3H), 1.91 (s, 1H), 1.81 (s, 1H), 1.66 (brs, 1H), 0.81 (m, 2H), 0.46 (m, 2H).</td><td> 244.2</td>
<td> D-I-10</td><td> Ύ /<sup>N</sup>\</td><td> G</td><td> 100</td><td> No NMR Data</td><td> 232.2</td>
<td> D-I-12</td><td> nh<sub>2 </sub>Φ נ”:ן N A</td><td> H</td><td> 100</td><td> 6.65 (d, 2H), 6.46 (d, J = 8.5 Hz, 2H), 4.53 (s, 2H), 2.83 (t, J = 4.8 Hz, 4H), 2.62 (t, J = 4.8 Hz, 4H), 1.62 (m, 1H), 0.40 (m, 2H), 0.29 (m, 2H).</td><td> 218.2</td>
<td> D-I-13</td><td> nh<sub>2 </sub>A $</td><td> H</td><td> 92</td><td> 6.50 (d, J = 8.0 Hz, 1H), 6.29 (brs, 1H), 6.24 (d, J = 7.6 Hz, 1H), 4.50 (s, 1H), 4.31 (s, 1H), 4.11 (brs, 2H), 3.64 (brs, 2H), 3.39 (m, 1H), 2.79 (d, J = 8.8 Hz, 1H), 2.01 (s, 3H), 1.85 (m, 1H), 1.74 (m, 1H).</td><td> 205.1</td>
<td> D-I-14</td><td> nh<sub>2 </sub>0 0 Boc</td><td> H</td><td> 100</td><td> No NMR Data</td><td> 292.2</td>
<td> D-I-15</td><td> nh<sub>2</sub> 0 N Boc</td><td> H</td><td> 72</td><td> 6.48 (d, J = 8.4 Hz, 1H), 6.40 (d, J = 7.2 Hz, 1H), 6.35 (m, 1H), 4.07 (brs, 2H), 3.333.48 (m,4H), 3.00-3.31 (m, 2H), 2.52-2.71 (m, 1H), 2.00 (s, 3H), 1.431.80 (m, 3H), 1.31 (s, 9H).</td><td> 306.2</td>
<td> D-I-16</td><td> nh<sub>2</sub> 0 N Boc</td><td> H</td><td> 82</td><td> split into two isomers.</td><td> 320.2</td>
<td> D-I-17</td><td> nh<sub>2 </sub>φ u N 1</td><td> H</td><td> 97</td><td> 6.58 (brs, 1H), 6.52 (m, 2H), 4.34 (brs, 2H), 2.88 (m, 4H), 2.49 (m, 4H), 2.19 (s, 3H), 2.01 (s, 3H).</td><td> 206.1</td>
<td> D-I-18</td><td> nh<sub>2</sub> Cj N F</td><td> H</td><td> 100</td><td> 6.58 (s, 1H), 6.48-6.53 (m, 2H), 4.59 (t, J = 4.9 Hz, 1H), 4.50 (t, J = 4.9 Hz, 1H), 4.35 (brs, 2H), 2.89 (t, J = 4.7 Hz, 4H), 2.67 (t, J = 4.7 Hz, 1H), 2.61 (t, J = 4.8 Hz, 1H), 2.55 (t, J = 4.7 Hz, 4H), 2.01 (s, 3H).</td><td> 238.2</td>
<td> D-I-19</td><td> nh<sub>2</sub> 0 N A</td><td> H</td><td> 44</td><td> 6.58 (s, 1H), 6.49 (m, 2H), 4.33 (brs, 2H), 2.84 (brs, 4H), 2.63 (brs, 4H), 2.01 (s, 3H), 1.62 (m, 1H), 0.42 (m, 2H), 0.31 (m, 2H).</td><td> 232.3</td>
<td> D-I-20</td><td> nh<sub>2 </sub>A 0 N 1 Boc</td><td> H</td><td> 99</td><td> No NMR Data</td><td> 292.2</td>
<td> D-I-21</td><td> nh<sub>2 </sub>TJ 0 N 1</td><td> H</td><td> 92</td><td> 6.49 (m, 2H), 6.27 (dd, J = 2.0 and 8.0 Hz, 1H), 4.19 (brs, 2H), 3.73 (s, 3H), 2.93 (m, 4H), 2.42 (m, 4H), 2.20 (s, 3H).</td><td> 222.1</td>
<td> D-I-22</td><td> nh<sub>2 </sub>Y N 1</td><td> H</td><td> 100</td><td> 6.52 (d, J = 8.4 Hz, 1H), 6.46 (m, 1H), 6.28 (m, 1H), 4.46 (m, 1H), 4.25 (brs, 2H), 2.91 (m, 4H), 2.41 (m, 4H), 2.13 (s, 3H), 1.17 (d, J = 8.4 Hz, 6H)</td><td> 250.3</td>
<td> D-I-23</td><td> nh<sub>2 </sub>...A 7 N 1 Boc</td><td> H</td><td> 100</td><td> 6.63 (m, 1H), 6.53 (m, 2H), 4.39 (brs, 2H), 3.41 (brs, 4H), 2.83 (brs, 4H), 2.30 (q, 2H), 1.40 (s, 9H), 1.09 (t, J = 7.4 Hz, 3H).</td><td> 306.2</td>
<td> D-I-24</td><td> 1 NH<sub>2</sub> כ״4 N 1</td><td> H</td><td> 92</td><td> 6.63 (s, 1H), 6.52 (s, 2H), 4.47 (brs, 2H), 2.91 (m, 5H), 2.42 (brs, 4H), 2.19 (s, 3H), 1.12 (d, J = 6.8 Hz, 6H).</td><td> 234.2</td>
<td> D-I-25</td><td> I nh<sub>2</sub> 0</td><td> H</td><td> 93</td><td> 6.63 (s, 1H), 6.51 (m, 2H), 4.37 (brs, 2H), 2.92 (m, 5H), 2.47 (m, 4H), 2.33 (q, J = 7.2 Hz, 2H), 1.12 (d, J = 6.8 Hz, 6H), 1.01 (t, J = 7.2 Hz, 3H).</td><td> 248.3</td>
<td> D-I-26</td><td> nh<sub>2</sub> 0</td><td> H</td><td> 100</td><td> No NMR Data</td><td> 207.2</td>
<td> D-I-27</td><td> nh<sub>2</sub> A.</td><td> H</td><td> 98</td><td> 6.52 (d, J = 8.5 Hz, 1H), 6.26-6.30 (m, 2H), 4.16 (s, 2H), 3.24-3.45 (m,4H), 3.10-3.14 (m, 1H), 2.41 (q, J = 7.8 Hz, 2H), 2.28-2.32 (m, 1H), 2.13-2.17 (m, 1H), 1.10 (t, J = 7.6 Hz, 3H).</td><td> 216.2</td>
<td> D-I-28</td><td> nh<sub>2 </sub>χφ 0 CN</td><td> H</td><td> 95</td><td> 6.52 (d, J = 8.5 Hz, 1H), 6.26-6.30 (m, 2H), 4.16 (s, 2 H), 3.24-3.45 (m,4H), 3.10-3.14 (m, 1H), 2.41 (q, J = 7.8 Hz, 2H), 2.30 (m, 1H), 2.13-2.17 (m, 1H), 1.10 (t, J = 7.6 Hz, 3H).</td><td> 216.2</td>
<td> D-I-29</td><td> nh<sub>2 </sub>xx נ) N 1</td><td> H</td><td> 91</td><td> No NMR Data</td><td> 238.2</td>
<td> D-I-30</td><td> nh<sub>2</sub> 0 N \</td><td> H</td><td> 87</td><td> 6.49 (brs, 1H), 6.40 (m, 2H), 3.48 (m, 6H), 2.57 (m, 2H), 2.45 (m, 4H) 2.30 (s, 3H), 1.85 (m, 2H), 1.09 (t, J = 7.6 Hz, 3H).</td><td> 233.2</td>
<td> D-I-31</td><td> nh<sub>2</sub> N 1</td><td> H</td><td> 100</td><td> No NMR Data</td><td> 246.2</td>
<td> D-I-32</td><td> nh<sub>2</sub> (5</td><td> H</td><td> 97</td><td> 6.45-6.50 (m, 3H), 4.28 (brs, 2H), 3.94 (s, 1H), 2.91 (m, 2H), 2.81 (m, 1H), 2.75 (t, J = 7.5 Hz, 3H), 2.62 (m, 1H), 2.42.5 (m, 1H), 2.39 (q, J = 7.5 Hz, 2H), 1.57 (m, 2H), 1.09 (t, J = 7.5 Hz, 3H).</td><td> 232.2</td>
<td> D-I-33</td><td> +5 %</td><td> H</td><td> 85</td><td> No NMR Data</td><td> 246.2</td>
<td> D-I-34</td><td> nh<sub>2</sub></td><td> H</td><td> 100</td><td> No NMR Data</td><td> 246.2</td>
<td> D-I-35</td><td><sup>a</sup>6 λ N 1</td><td> H</td><td> 76</td><td> 6.66 (m, 2H), 6.51 (s, 1H), 4.57 (brs, 2H), 2.96 (m, 4H), 2.89 (m, 8H), 2.43 (s, 3H), 2.20 (m, 3H), 1.90 (m, 2H).</td><td> 260.3</td>
<td> D-I-36</td><td> nh<sub>2</sub> ...Φ Cy° N 1</td><td> H</td><td> 88</td><td> 6.90 (s, 1H), 6.77 (m, 1H), 6.50 (s, 1H), 4.75 (brs, 2H), 3.98 (s, 2H), 2.82 (s, 4H), 2.16 (m, 2H), 1.95 (m, 1H), 1.88 (m, 1H), 1.81 (m, 1H), 1.32 (t, J = 7.4 Hz, 3H).</td><td> 234.2</td>
<td> D-I-37</td><td> nh<sub>2</sub> נ>... Q 1</td><td> H</td><td> 77</td><td> 6.89 (s, 1H), 6.78 (m, 1H), 6.52(s, 1H), 4.93 (brs, 2H), 3.39 (s, 2H), 2.86 (s, 4H), 2.16 (m, 2H), 1.98 (m, 1H), 1.89 (m, 1H), 1.80 (m, 1H), 1.35 (t, J = 7.5 Hz, 3H).</td><td> 234.2</td>
<td> D-I-38</td><td> nh<sub>2</sub> ....¢ N. 1</td><td> H</td><td> 77</td><td> No NMR Data</td><td> 232.2</td>
<td> D-I-39</td><td> nh<sub>2</sub> !:] N 1</td><td> H</td><td> 90</td><td> 7.56 (s, 1H), 6.48 (s, 1H), 4.33 (brs, 2H), 3.21 (brs, 4H), 2.41 (q, 2H), 2.37 (brs, 4H), 2.19 (s, 3H), 1.11 (t, J = 7.4 Hz, 3H).</td><td> 221.1</td>
<td> D-I-40</td><td> nh<sub>2</sub> 0</td><td> H</td><td> 92</td><td> 7.57 (s, 1H), 6.53 (s, 1H), 4.37 (brs, 2H), 3.67 (brs, 4H), 3.16 (brs, 4H), 2.05 (s, 3H).</td><td> 194.2</td>
<td> D-I-41</td><td> nh<sub>2</sub> ולק c 1</td><td> H</td><td> 96</td><td> 7.55 (s, 1H), 6.52 (s, 1H), 4.33 (brs, 2H), 3.33 (brs, 4H), 2.31 (brs, 4H), 2.19 (s, 3H), 2.02 (s, 3H).</td><td> 207.2</td>
<td> D-I-42</td><td> NH<sub>2</sub><sub>ר</sub> -,</td><td> H</td><td> 93</td><td> No NMR Data</td><td> 232.2</td>
<td></td><td> Λ N 1</td><td></td><td></td><td></td><td></td>
<td> D-I-43</td><td> nh<sub>2</sub> N 1</td><td> H</td><td> 80</td><td> 6.76 (m, 1H), 6.66 (m, 2H), 6.56 (d, J = 8.4 Hz, 1H), 6.47 (d, J = 8.6 Hz, 1H), 4.27 (s, 2H), 3.23 (s, 3H), 2.90 (brs, 4H), 2.41 (brs, 4H), 2.19 (s, 3H).</td><td> 236.3</td>
<td> D-I-44</td><td> nh<sub>2</sub></td><td> G</td><td> 96</td><td> No NMR data</td><td> 226.2</td>
<td></td><td> c 1</td><td></td><td></td><td></td><td></td>
<td> D-I-45</td><td> nh<sub>2</sub></td><td> H</td><td> 100</td><td> No NMR Data</td><td> 234.0</td>
<td></td><td> V <></td><td></td><td></td><td></td><td></td>
<td></td><td> V</td><td></td><td></td><td></td><td></td>
<td> D-I-46</td><td> nh<sub>2 </sub>/φ</td><td> H</td><td> 93</td><td> No NMR Data</td><td> 234.2</td>
<td></td><td> 0 /</td><td></td><td></td><td></td><td></td>
<td> D-I-47</td><td> .'f</td><td> H</td><td> 100</td><td> No NMR Data</td><td> 234.2</td>
<td></td><td> M /</td><td></td><td></td><td></td><td></td>
<td> D-I-48</td><td> Λ NH<sub>2</sub> N 1</td><td> G</td><td> 82</td><td> No NMR Data</td><td> No data</td>
<td> D-I-49</td><td> A NH<sub>2</sub> ft N 1</td><td> G</td><td> 88</td><td> No NMR Data</td><td> 258.2</td>
<td> D-V-l</td><td> nh<sub>2</sub> 1 Boc</td><td> H</td><td> 100</td><td> 6.74 (brm, 1H), 6.71 (m, 1H), 6.49 (m, 1H), 4.57 (brs, 2H), 4.00 (brm, 2H), 2.73 (brm, 2H), 2.33 (m, 1H), 1.99 (s, 3H), 1.83 (m, 2H), 1.38 (s, 9H), 1.32 (m, 2H).</td><td> 313.2 (M+Na+H<sup>+</sup>).</td>
<td> D-V-2</td><td> nh<sub>2</sub> 1</td><td> H</td><td> 100</td><td> 6.99 (brm, 1H), 6.95 (m, 1H), 6.54 (m, 1H), 5.85 (brm, 1H), 4.82 (brs, 2H), 3.92 (brm, 2H),3.16(s, 3H), 2.96 (brm, 2H), 2.54 (m, 2H), 2.38 (m, 2H), 2.03 (s, 3H).</td><td> 185.2</td>
<td> D-V-3</td><td> nh<sub>2</sub> / N-N</td><td> H</td><td> 93</td><td> 7.84 (s, 1H), 7.62 (s, 1H), 7.11 (s, 1H), 7.06 (d, J = 8.0 Hz, 1H), 6.57 (d, J = 8.0 Hz, 1H), 4.76 (brs, 2H), 3.80 (s, 3H), 2.02 (s, 3H).</td><td> 188.4</td>
<td> D-V-4</td><td> nh<sub>2 </sub>Xj NN ^<sup>N</sup>\</td><td> H</td><td> 93</td><td> 7.51 (s, 1H), 7.32 (s, 1H), 7.26 (m, 2H), 6.57 (d, J = 8.1 Hz, 1H), 4.78 (brs, 2H), 3.64 (s, 3H), 2.07 (s, 3H).</td><td> 264.2</td>
<td> D-V-5</td><td> \ / NH2 <sup>HO</sup> 1ןץ 0 N 1</td><td> Grignard</td><td> crude</td><td> No NMR Data</td><td> 250.2</td>
Intermediate D-V-6: 2-ethyl (l-methylpyrrolidin yl)aniline
<img file="IL287787A_D0195.tif" />
A solution of tert-butyl 3-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan yl)-2,5-dihydroIH-pyrrole-l-carboxylate (0.25 g, 0.85 mmol),4-bromo ethylaniline (0.121 g, 0.60 mmol) in a mixture of 1,4-dioxane (5 mL) and water (1 mL) was treated with K2CO3 (0.251 g, 1.8 mmol). The mixture was degassed with Ar for 2 min and then bis(triphenylphosphine)palladium(II) dichloride (0.042 g, 0.06 mmol) was added. The reaction mixture was heated at 95 °C overnight under microwave. The reaction mixture was cooled to rt and the mixture extracted with EtOAC (2x). The combined organic extracts were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to obtain the crude. The crude was purified by silica gel column chromatography (0 to 60 % EtOAc/hexanes, 15CVs) to give tert-butyl 3-(4-amino ethylphenyl)-2,5-dihydro-lHpyrrole carboxylate (0.12 g, 70 % yield) which was carried forward without further purification. LC-MS m/z: 289.2 (M+H+).
A solution of tert-butyl 3-(4-amino ethylphenyl)-2,5-dihydro-lH-pyrrole-lcarboxylate (0.12 g, 0.42 mmol) in MeOH (20 mL) was treated with Pd-C (0.040 g, 0.0424 mmol). The reaction mixture was under a balloon overnight. The mixture was filtered through a pad of celite and the filtrate was concentrated under reduced pressure to give tertbutyl 3-(4-amino ethylphenyl)pyrrolidine-l-carboxylate (0.12 g, 97 % yield) as a colorless sticky oil. 1H NMR (400 MHz, DMSO-ife): d 6.81 (s, 1H), 6.80 (m, 1H), 6.53 (d, J = 8.0 Hz, 1H), 4.68 (s, 2H), 3.57 (m, 1H), 3.41 (m, 1H), 3.11-3.29 (m, 2H), 3.04 (m, 1H), 2.40 (q, J = 7.5 Hz, 2H), 2.08 (brm, 1H), 1.75 (brm, 1H), 1.39 (s, 9H), 1.09 (t, J = 7.5 Hz, 3H); LC-MS m/z: 313.2 (M+H+Na+).
A solution of tert-butyl 3-(4-amino ethylphenyl)pyrrolidine-l-carboxylate (0.12 g, 0.40 mmol) in a biphasic mixture of EtOAc (25 mL) and Sat’d NaHCO3 (aq) (25 mL) was treated with benzyl chloroformate (0.086 mL, 0.60 mmol). The mixture was stirred at rt overnight. The mixture was partitioned between EtOAc and sat’d NaHCO3 and extracted EtOAc (2 x 25 mL). The combined organic extracts were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to obtain tert-butyl 3-(4(((benzyloxy)carbonyl)amino) ethylphenyl)pyrrolidine-l-carboxylate (0.18 g, 100 % yield) which was carried forward without further purification. LC-MS m/z: 447.2 (M+H+Na+).
A solution of tert-butyl 3-(4-(((benzyloxy)carbonyl)amino)-3ethylphenyl)pyrrolidine-l-carboxylate (0.18 g, 0.44 mmol) in DCM (3 mL) was treated with TFA (2 mL). The mixture was stirred for Ih at rt. The solvent was removed to give the crude TFA salt. The crude was suspended in DCM and TEA (1mL) was added. The solvent was removed under reduced pressure and dried under vacuum. The resulting mixture was suspended in DCM and AcOH (3 drops). Formaldehyde (5 drops) was added and the mixture was stirred at rt for 1 h. Sodium triacetoxyborohydride (0.37 g, 1.7 mmol) was added and the mixture was stirred overnight at rt.
The mixture was partitioned between DCM and sat’d NaHCO3 and stirred for Ih. The mixture was extracted with DCM (2 x 25 mL). The combined organic extracts were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give benzyl (2ethyl (l-methylpyrrolidin yl)pheny!)carbamate (0.14 g, 94 % yield) which was carried forward without further purification. LC-MS m/z: 339.2 (M+H+).
A solution of benzyl (2-ethyl (l-methylpyrrolidin yl)phenyl)carbamate (0.14 g, 0.41 mmol) in EtOAc (20 mL) was flushed with Ar. Palladium on carbon (0.022 g, 0.02 mmol) was added and the mixture was hydrogenated under a balloon overnight at rt. The mixture was filtered through a pad of celite and the filtrate was concentrated under reduced pressure to give (2-ethyl (l-methylpyrrolidin yl)aniline (0.10 g, 119 % yield) which was carried forward without further purification. LC-MS m/z: 205.2 (M+H+).
General method of alkylation of Z lactams and deprotection of Boc group: Intermediate H-VII-1.
^^n/^/^'nh2hci 0Y
[000239] A solution of 1, 4-oxazepan one (10 g, 87 mmol) in dry THF (400 mL) at 0 °C was treated with sodium hydride (3.0 g, 130 mmol) portion wise under nitrogen atmosphere. The reaction mixture was stirred for 15 min at 0 °C then tert-butyl (3bromopropyl) carbamate (21 g, 87 mmol) was added. The solution was continued stirred from 0 °C rt for 16 h. The reaction mixture was quenched with saturated solution of NH4C1 (200 mL) and then the solution was extracted with EtOAc (2 x 150 mL). The combined organic extract was washed with brine (150 mL), dried over anhydrous Na2SO4, and filtered under reduced pressure. The crude was purified by silica gel column chromatography (40 to 50 % EtOAc/hexane, 15 CV’s) to obtain tert-butyl (3-(5-oxo-l,4-oxazepan yl)propyl carbamate (12 g, 50 % yield) as yellow liquid. The product was dissolved in DCM (50 mL) and treated with 4 N HC1 in 1,4-dioxane (4 eq). The mixture was stirred at rt for 3 h and concentrated, dried under high vacuum to obtain 4-(3-aminopropyl)-l,4-oxazepan one HC1 salt (100 % yield). 1H NMR (400 MHz, DMSO-d6): δ 8.09 (brs, 3H), 3.62 (m, 4H), 3.49 (m, 2H), 3.35 (t, J = 6.8 Hz, 2H), 2.73 (m, 2H), 2.62 (t, J = 4.8 Hz, 2H), 1.78 (m, 2H); MS (ESI) m/z: 173.2 (M+H+).
[000240] Using the General Method for the preparation of H-VIL1, the following intermediates H-II-1 through H-VL1 in Table E were prepared.
Table E.
<td> Intermediate</td><td> Structure</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSO-d6): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> H-I-l</td><td> “P<sup>7</sup>־ TFA</td><td> crude</td><td> No Data</td><td> 157.2</td>
<td> H-II-1</td><td> O HCI</td><td> 52</td><td> Boc: 4.17 (m, 2H), 3.26 (m, 2H), 2.52 (m, 2H), 2.23 (m, 2H), 1.80 (m, 2H), 1.71 (m, 2H), 1.39 (s, 6H), 1.17 (s, 9H).</td><td> 171.2</td>
<td> H-III-1</td><td> o</td><td> 36</td><td> Boc: 6.76 (t, J = 5.7 Hz, 1H), 3.20 (m, 4H), 2.86 (m, 2H), 2.17 (m, 2H), 1.67 (m, 4H), 1.53 (m, 2H), 1.35 (s, 9H).</td><td> 157.2</td>
<td> H-IV-1</td><td> 0 Λ O N^^NH<sub>2</sub>HCI</td><td> 64</td><td> Boc: 4.14 (m, 2H), 3.25 (m, 2H), 3.18 (m, 2H), 2.92 (m, 2H), 1.92 (m, 2H), 1.62 (m, 2H), 1.36 (s, 9H).</td><td> 159.2</td>
<td> H-XIII-1</td><td> 0</td><td> 84</td><td> Boc: 3.99 (m, 2H), 3.48 (m, 2H), 3.30 (m, 4H), 2.91 (m, 2H), 1.58 (m, 2H), 1.36 (s, 9H).</td><td> 159.2</td>
<td></td><td></td><td></td><td></td><td></td>
<td> H-VL1</td><td> 0 N N H<sub>2</sub>H C1</td><td> 57</td><td> Boc: 6.73 (s, 1H), 4.08 (s, 2H), 3.73 (t, J = 5.5 Hz, 2H), 3.46 (m, 2H), 3.25 (m, 2H), 2.88 (q, J = 6.5 Hz, 2H), 1.98 (s, 1H), 1.78 (m, 2H), 1.53 (m, 2H), 1.36 (s, 9H).</td><td> 173.2</td>
<td> H-IV-2</td><td> 0 X hci</td><td> crude</td><td> No NMR Data</td><td> 187.2</td>
<td> H-VII-2</td><td> / N NH<sub>2</sub>HCI 0^^</td><td> crude</td><td> No NMR Data</td><td> 201.2</td>
Intermediate H-XIV: l-(3-aminopropyl) azepan one. Ο
[000241] A suspension of DBU (22 g, 145 mmol) in MeOH: H2O (1:1) (130 mL) was treated with KOH (12 g, 217 mmol) at 0 °C under N2 atmosphere and the reaction mixture was stirred at rt for 16 h. The reaction mixture was evaporated under reduced pressure and the residue was diluted with water (200 mL). The solution was extracted with 10% MeOH in DCM (3 x 250 mL) and the combined organic extracts were dried over anhydrous sodium sulphate, filtered and concentrated under reduced pressure to obtain l-(3-aminopropyl) azepan one (21 g, 85 % yield) as a liquid oil. 1H NMR (400 MHz, CDC13): δ 3.45 (t, J = 3.5 Hz, 2H), 3.31 (t, J = 4.4 Hz, 2H), 2.68 (t, J = 6.5 Hz, 2H), 2.51 (t, J = 5.8 Hz, 2H), 1.70 (m, 2H), 1.65 (m, 8H);LC-MS (ESI) m/z: 171.4 (M+H+).
Intermediate L-III-1: 2-chloro cyclopropyl (methylsulfonyl)pyrimidine.
<img file="IL287787A_D0196.tif" />
[000242] (A) A suspension of 5-bromo chloro (methylthio) pyrimidine (25.0 g, 105 mmol) and cyclopropylboronic acid (13.7 g, 158 mmol) in toluene : H2O (9:1) (650 mL) was treated with K3PO4 (66.7 g, 315 mmol) was added. The reaction mixture was purged with nitrogen for 20 min and then added tricyclohexyl phosphine (5.9 g, 21 mmol) and Pd(OAc)2 (2.35 g, 10.50 mmol). The reaction mixture was stirred at 90 °C for 16h. The reaction mixture was diluted with water (200 mL) and extracted with EtOAc (3 x 300 mL). The combined organic extracts were washed with brine (200 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. The crude was purified by silica gel column chromatography (0 tol0% EtOAc/hexane) to obtain 2-chloro cyclopropyl (methylthio) pyrimidine (14.0 g, 66 % yield) as a yellow oil. 1H NMR (400 MHz, DMSO+fc): δ 7.92 (s, 1H), 2.58 (s, 3H), 1.67 (m, 1H), 1.03 (m, 2H), 0.67 (m, 2H); LC-MS (ESI) m/z: 201.0 (M+H+).
[000243] (B) A solution of 2-chloro cyclopropyl (methylthio) pyrimidine (4.0 g, 20 mmol) in DCM (60 mL) at 0 °C was treated with m-CPBA (4.8 g, 28 mmol). The reaction mixture was warmed to rt and stirred for 3 h. The reaction mixture was washed with saturated aq. NaHCO3 (2 x 40 mL). The organic layer was dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to obtain 2-chloro cyclopropyl-4(methylsulfony!)pyrimidine (3.6 g, 86 % yield) as a yellow solid. 1H NMR (400 MHz, DMSO-ife): δ 8.57 (s, 1H), 2.89 (s, 3H), 2.16 (m, 1H), 1.16 (m, 2H), 0.93 (m, 2H); LC-MS (ESI) m/z: 217.0 (M+H+).
Intermediate L-I-2: 4-chloro (methylthio)-5(trifluoromethyl)pyrimidine.
<img file="IL287787A_D0197.tif" />
[000244] A solution of 2,4-dichloro (trifluoromethyl) pyrimidine (100 g, 0.46 mol) in diethyl ether (2 L) was treated with ZnC12 (1.0 N in ether) (555 mL, 0.56 mol) dropwise at 0 °C and the reaction mixture was stirred for 2h. Sodium thiomethoxide (49 g, 0.94 mol) was added at 0 °C and the reaction mixture was warmed to rt and stirred for 48 h. The reaction mixture was quenched with 2 N HC1 under an ice-water bath and then the solution was extracted with Et2O (3 x 500 mL). The combined organic extracts were washed with water (500 mL), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure at 35 °C to obtain 4-chloro (methylthio) (trifluoromethyl)pyrimidine (100 g, 95 % yield) as a colorless liquid. 1H NMR (400 MHz, DMSO-ifo): δ 9.01 (s 1H), 2.62 (s 3H).
General Method for substitution reaction:
Intermediate J-7: 4-(3-((2-(methylthio) (trifluoromethyl) pyrimidin yl)amino)propyl)l,4-oxazepan one
<img file="IL287787A_D0198.tif" />
[000245] A solution of 4-(3-aminopropyl) l,4-oxazepan one hydrochloride (H-VII-1, 3.0 g, 17.4 mmol) in DMF (60 mL) was treated with DIEA (15.5 ml, 87.2 mmol) at 0 °C and stirred for 15 min. Then 4-chloro (methylthio) (trifluoromethyl) pyrimidine (L-I-2, 6.0 g, 26.2 mmol) was added and stirring continued from 0 °C to rt for 16 h. The reaction mixture was quenched with ice water (120 mL) and extracted with ethyl acetate (3 x 50 mL). The combined organic extracts were washed with brine (50 mL), dried over anhydrous Na2SO4, and filtered. The filtrate was concentrated under reduced pressure and the crude was purified by silica gel column chromatography (40 to 50 % EtOAc/hexane, 15 CV’s) to obtain 4-(3((2-(methylthio) (trifluoromethyl) pyrimidin yl)amino)propyl)-l,4-oxazepan one (3.0 g, 47 % yield) as yellow liquid. 1H NMR (400 MHz, DMSO-ifc): δ 8.25 (s, 1H), 7.52 (bs, 1H), 3.64 (m, 4H), 3.47 (m, 2H), 3.42 (m, 2H), 3.32 (m, 2H), 2.63 (t, J = 4.8 Hz, 2H), 2.47 (s, 3H), 1.68 (m, 2H); LC-MS (ESI) m/z: 365.3 (M+H+).
[000246] Using the General Method for preparation of Intermediate J-7, the following intermediates of Table F were prepared.
Table F.
<td> Intermediate</td><td> Structure</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSO-d6): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> K-l</td><td> axYt cr n n n'N</td><td> 31</td><td> No NMR Data</td><td> 323.2</td>
<td> K-2</td><td> O 0Υν^Ν'^־־׳<sup>ΧΧ</sup>νΥ <sup>h</sup> o</td><td> 82</td><td> 7.69 (s, 1H), 7.51 (t, J = 5.9 Hz, 1H), 3.34 (t, J = 6.4 Hz, 3H), 3.24 (m, 2H), 2.22 (t, J =6.3 Hz, 2H), 1.68-1.73 (m, 6H), 1.461.56 (m, 2H), 0.86-0.90 (m, 2H), 0.54 (m, 2H).</td><td> 309.2</td>
<td> K-3</td><td> αΎλ CI^N O <sup>H</sup> Y-J</td><td> 47</td><td> 7.69 (s, 1H), 7.43 (s, 1H), 4.17 (m, 2H), 3.39 (m, 2H), 3.29 (m, 4H), 1.94 (m, 2H), 1.77 (m, 2H), 1.48 (m, 1H), 0.89 (m, 2H), 0.56 (m, 2H).</td><td> 311.3</td>
<td> K-4</td><td><sup>Η</sup> k /</td><td> 42</td><td> 7.69 (s, 1H), 7.45 (s, 1H), 3.66 (m, 4H), 3.56 (brs, 2H), 3.35 (m, 4H), 2.64 (m, 2H), 1.69 (m, 2H), 1.50 (m, 1H), 0.88 (m, 2H), 0.56 (m, 2H).</td><td> 325.3</td>
<td> Κ-5</td><td> 0 Α Λ /χ/χ X Cr Ν Ν— Ν \ <sup>Η</sup> ΧΑ</td><td> 51</td><td> 7.70 (s, 1H), 7.45 (brs, 1H), 4.12 (s, 2H), 3.76 (t, J = 5.2 Hz, 2H), 3.50 (m, 2H), 3.37 (m, 4H), 1.85 (m, 2H), 1.72 (m, 2H), 1.51 (m, 1H), 0.89 (m, 2H), 0.55 (m, 2H).</td><td> 325.1</td>
<td> Κ-6</td><td> ν׳Ύ' 0 cAn^</td><td> 37</td><td> 8.15 (s, 1H), 7.94 (m, 1H), 3.35 (m, 2H), 3.30 (m, 2H), 3.25 (m, 2H), 2.21 (m, 2H), 1.72 (m, 6H).</td><td> 303.20</td>
<td> Κ-7</td><td> nA’ <sup>0</sup> Λ A 1 Cl Ν Ν'^^'Ν 0 <sup>Η</sup> a</td><td> 64</td><td> 8.15 (s, 1H), 7.90 (brs, 1H), 4.16 (m, 2H), 3.37 (m, 2H), 3.27 (m, 4H), 1.94 (m, 2H), 1.77 (m, 2H).</td><td> 305.2</td>
<td> Κ-8</td><td> ν-Α a cAa^A η η 0ρ</td><td> 47</td><td> 8.20 (s, 1H), 7.88 (m, 1H), 4.11 (s, 2H), 3.76 (m, 2H), 3.50 (m, 2H), 3.36 (m, 4H), 1.84 (m, 2H), 1.72 (m, 2H).</td><td> 319.1</td>
<td> Κ-9</td><td> ,Α<sup>1</sup> ?\ Λ J zx/^ A CI'^^N \ H I I 0</td><td> 51</td><td> 8.15 (s, 1H), 7.91 (brs, 1H), 3.65 (m, 4H), 3.48 (m, 2H), 3.35 (m, 4H), 2.63 (m, 2H), 1.66 (m, 2H).</td><td> 319.0</td>
<td> Κ-10</td><td> νΑ<sup>Βγ</sup> Ο cAA^^tAj</td><td> 39</td><td> 8.23 (s, 1H), 7.58 (brs, 1H), 3.33 (m, 2H), 3.31 (m, 2H), 3.25 (m, 2H), 2.22 (m, 2H), 1.71 (m, 6H).</td><td> 347.1</td>
<td> Κ-11</td><td> N^A <sup>0</sup> C AA^^nA <sup>H</sup> 0x</td><td> 56</td><td> 8.23 (s, 1H), 7.72 (brs, 1H), 4.16 (m, 2H), 3.36 (m, 2H), 3.28 (m, 4H), 1.95 (m, 2H), 1.76 (m, 2H).</td><td> 349.0</td>
<td> Κ-12</td><td><sub>ν</sub>α<sup>βγ</sup> 1 cAuA'A <sup>h</sup> k y</td><td> 48</td><td> 8.23 (s, 1H), 7.72 (m, 1H), 4.11 (s, 2H), 3.76 (m, 2H), 3.49 (m, 2H), 3.33 (m, 4H), 1.83 (m, 2H), 1.71 (m, 2H).</td><td> 363.0</td>
<td> Κ-13</td><td> ν^<sup>βγ</sup> K CI^N^ Η I / o</td><td> 50</td><td> 8.23 (s, 1H), 7.74 (brs, 1H), 3.66 (brs, 4H), 3.48 (m, 2H), 3.34 (m, 4H), 2.63 (m, 2H), 1.67 (m, 2H).</td><td> 363.2</td>
<td> J-1</td><td> inr<sup>CF3 0 </sup>ναΛ-^ιΖ,</td><td> 100</td><td> 7.53 (t, J = 5.7 Hz, 1H), 3.40 (q, J = 6.5 Hz, 2H), 3.34 (t, J = 7.0 Hz, 2H), 3.19 (t, J = 6.8 Hz, 2H), 2.46 (s, 3H), 2.21 (t, J = 8.1</td><td> 335.2</td>
<td></td><td></td><td></td><td> Hz, 2H), 1.91 (p, J = 7.5 Hz, 2H), 1.71 (m, 2H).</td><td></td>
<td> J-2</td><td> n׳V<sup>CF3</sup> 0</td><td> 91</td><td> 8.24 (s, 1H), 7.58 (t, J = 5.8 Hz, 1H), 3.40 (q, J = 6.5 Hz, 2H), 3.21-3.28 (m, 4 H), 2.46 (s, 3H), 2.21 (t, J = 6.2 Hz, 2H), 1.651.75 (m, 6H).</td><td> 349.2</td>
<td> J-3</td><td> O <sup>H</sup></td><td> 65</td><td> 8.25 (d, J= 1.1 Hz, 1H), 7.51 (t, J = 5.8 Hz, 1H), 4.15 (t, J = 5.3 Hz, 2H), 3.44 (q, J = 6.6 Hz, 2H), 3.22-3.27 (m, 4H), 2.46 (s, 3H), 1.89-1.95 (m, 2H), 1.731.80 (m, 2H).</td><td> 351.2</td>
<td> J-4</td><td> n״־V<sup>CF3</sup> 0 <sup>H</sup> Λ</td><td> 77</td><td> 8.25 (s, 1H), 1.54 (t, J = 5.2 Hz, 1H), 4.02 (s, 2H), 3.82 (t, J = 5.2 Hz, 2H), 3.44 (q, 2H), 3.34 (m, 4H), 2.47 (s, 3H), 1.77 (m, 2H).</td><td> 351.1</td>
<td> J-5</td><td> AT‘ λ <sup>h</sup> o</td><td> 65</td><td> 8.26 (s, 1H), 7.53 (m, 1H), 3.45 (m, 2H), 3.34 (m, 4H), 2.48 (s, 3H), 2.43 (m, 2H), 1.66 (m, 4H), 1.52 (m,4H).</td><td> 363.2</td>
<td> J-6</td><td> ΐΤ λ η ς_p</td><td> 64</td><td> 8.25 (s, 1H), 7.52 (brs, 1H), 4.11 (s, 2H), 3.75 (t, J = 5.6 Hz, 2H), 3.48 (m, 2H), 3.45 (m, 2H), 3.34 (m, 2H), 2.47 (s, 3H), 1.82 (m, 2H), 1.72 (m, 2H).</td><td> 365.3</td>
<td> J-7</td><td> n<sup>CF3</sup> k ^0</td><td> 47</td><td> 8.25 (s, 1H), 7.52 (bs, 1H), 3.64 (m, 4H), 3.47 (m, 2H), 3.42 (m, 2H), 3.32 (m, 2H), 2.63 (t, J = 4.8 Hz, 2H), 2.47 (s, 3H), 1.68 (m, 2H).</td><td> 365.3</td>
<td> J-8</td><td><sub>Ν|</sub>Ύ<sup>ν</sup> 0 k<sub>0</sub></td><td> 89</td><td> 8.25 (s, 1H), 7.51 (t, J = 5.8 Hz, 1H), 3.64 (m, 4H), 3.46 (m, 2H), 3.42 (q, J = 6.5 Hz, 2H), 3.31 (m, 2H), 2.62 (m, 2H), 2.46 (s, 3H), 1.68 (m, 2H).</td><td> 322.2</td>
<td> J-A</td><td> υΧυ,τ η Ar—</td><td> 81</td><td> 8.26 (s, 1H), 7.53 (t, J = 5.7 Hz, 1H), 3.39 (m, 2H), 3.09 (m, 2H), 3.06 (s, 2H), 2.46 (s, 3H), 1.74 (m, 2H), 1.17 (s, 6H).</td><td> 349.2</td>
<td> J-B</td><td> H</td><td> 0</td><td> crude</td><td> No NMR Data</td><td> 379.2</td>
<td> J-C</td><td> H</td><td> -+</td><td> crude</td><td> No NMR Data</td><td> 393.2</td>
General method of Pd coupling reaction:
Intermediate M-l: 4-(3-((2-(methylthio) (trifluoromethyl) pyrimidin yl)amino)propyl)1,4-oxazepan one
<img file="IL287787A_D0199.tif" />
[000247] A solution of l-(3-aminopropyl) piperidin one hydrochloride (H-III-1, 9.0 g, 29.3 mmol) and 2-chloro iodo (trifluoromethyl) pyridine (6.19 g, 32.2 mmol) in toluene (180 mL) was treated with cesium carbonate (23.9 g, 73.2 mmol). The mixture was purged with Ar for 15 min. Then, PdC12(dppf)&#1523; DCM (2.39 g, 2.93 mmol) was added and the mixture was purged with Ar for a further 5 min. The seal tube was closed and conventionally heated in a pre-heated oil bath at 90 °C for 16 h. The reaction mixture was cooled to rt, poured into water (100 mL). The solution was extracted with EtOAc (3 x 100 mL). The combined organic extracts were washed with brine, dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (40 to 45% EtOAc/hexane, 12 CV’s) to obtain l-(3-((2-chloro (trifluoromethyl) pyridin yl) amino) propyl) piperidin one (2.6 g, 26 % yield) as brown solid. 1H NMR (400 MHz, DMSO-0Z6): δ 8.18 (s, 1H), 6.98 (t, J = 6 Hz, 1H), 6.88 (s, 1H), 3.29 (m, 2H), 3.15 (m, 4H), 2.22 (t, J = 6.4 Hz, 2H), 1.67 (m, 6H); LC-MS (ESI) m/z: 336.1 (M+H+).
[000248] Using the General Method for preparation of Intermediate M-l, the following intermediates of Table G were prepared.
Table G.
<td> Intermediate</td><td> Structure</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSO-d6): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> M-2</td><td> n-V<sup>cf</sup>= 0 1/1 A CI<sup>/X/</sup>^N^<sup>/</sup>^N O <sup>H</sup> 11</td><td> 26</td><td> 8.18 (s, 1H), 6.90 (s, 1H), 6.87 (brs, 1H), 4.16 (m, 2H), 3.25 (m, 6H), 1.92 (m, 2H), 1.72 (m, 2H).</td><td> 338.2</td>
<td> M-3</td><td> כ>־ U Z1 o</td><td> 27</td><td> 8.18 (s, 1H), 6.90 (brs, 2H), 3.64 (brs, 4H), 3.48 (m, 2H), 3.26 (m, 4H), 2.63 (m, 2H), 1.63 (m, 2H).</td><td> 351.1</td>
<td> M-4</td><td> N״Y׳<sup>CI</sup> O Cl <sup>H</sup> 1 /</td><td> 19</td><td> 7.99 (s, 1H), 6.75 (s, 2H), 3.62 (m, 4H), 3.49 (m, 2H), 3.35 (m, 2H), 3.20 (m, 2H), 2.94 (brs, 2H), 1.65 (m, 2H).</td><td> 318.2</td>
General Method of oxidation to sulfinyl intermediates:
Intermediate J-14: 4-(3-((2-(methylsulfinyl) (trifluoromethyl)pyrimidin-4 yl)amino)propyl)-1,4-oxazepan-5 -one
<img file="IL287787A_D0200.tif" />
[000249] A solution of 4-(3-((2-(methylthio) (trifluoromethyl)pyrimidin-4yl)amino)propyl)-l,4-oxazepan one (J-7, 3.0 g, 8.2 mmol) in DCM (60 mL) at 0 °C, mCPBA (2.0 g, 11.5 mmol) was added and stirred from 0 °C to room temperature for 3 h. The reaction mixture was washed with saturated aq. sodium bicarbonate (2 x 90 mL). Organic layer was dried over anhydrous Na2SO4 and filtered. The filtrate was concentrated under reduced pressure to obtain mixture of 4-(3-((2-(methylsulfinyl) (trifluoromethyl)pyrimidin4-yl)amino)propyl)-l,4-oxazepan one and 4-(3-((2-(methylsulfony 1)-5(trifluoromethyl)pyrimidin yl)amino)propyl)-L4-oxazepan one (3.0 g, 95%, 9:1) as light yellow semi-solid. 1H NMR (400 MHz, DMSO-0Z6): δ 8.59 (s, 1H), 7.94 (brs, 1H),3.6O (m, 4H), 3.45 (m, 4H), 3.36 (m, 2H), 2.88 (s, 3H), 2.63 (m, 2H), 1.70 (m, 2H); LC-MS (ESI) m/z: 381.3 (M+H+).
[000250] Using the General Method for preparation of Intermediate J-14, the following intermediates of Table H were prepared.
Table H.
<td> Intermediate</td><td> Structure</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSO-d6): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> J-8-A</td><td> ^<sup>CF3 0 </sup>nA 1 <sup>H</sup> A?</td><td> 90</td><td> 8.58 (s, 1H), 8.01 (s, 1H), 3.46 (m, 2H), 3.35 (m, 2H), 3.20 (m, 2H), 2.83 (s, 3H), 2.22 (m, 2H), 1.96 (m, 2H), 1.71 (m, 2H).</td><td> 351.2</td>
<td> J-9</td><td><sup>N</sup>!^<sup>CF3 0 </sup>8 <sup>H</sup> O</td><td> 96</td><td> 8.58 (s, 1H), 8.06 (s, 1H), 3.46 (m, 2H), 3.35 (m, 2H), 3.24 (m, 2H), 2.72 (s, 3H), 2.23 (m, 2H), 1.73 (m, 6H).</td><td> 365.3</td>
<td> J-10</td><td> n' o O. A Λ ζχ- A S N N N O <sup>1 H</sup> kJ</td><td> 92</td><td> 8.58 (s, 1H), 7.99 (brs, 1H), 4.16 (m, 2H), 3.48 (m, 2H), 3.26 (m, 4H), 2.83 (s, 3H), 1.92 (m, 2H), 1.78 (m, 2H).</td><td> 367.2</td>
<td> J-ll</td><td> n'^%t<sup>CF3</sup> o <sup>0</sup>'S'^'N^N'^^'N A <sup>H</sup> o></td><td> 96</td><td> 8.59 (s, 1H), 8.00 (brs, 1H), 4.03 (s, 2H), 3.84 (m, 2H), 3.48 (m, 2H), 3.35 (m, 4H), 2.84 (s, 3H), 1.79 (m, 2H).</td><td> 367.1</td>
<td> J-12</td><td> n^A<sup>f</sup>0 ־ AAn<sup>zx/</sup>''n<sup>/</sup>\ ° H</td><td> 83</td><td> 8.58 (s, 1H), 8.02 (brs, 1H), 3.45 (m, 2H), 3.34 (m, 4H), 2.83 (s, 3H), 2.43 (m, 2H), 1.69 (m, 4H), 1.56 (m, 4H).</td><td> 379.4</td>
<td> J-13</td><td> 0 <sub>x</sub> 11 Ά S N N N \ 8 <sup>H</sup></td><td> 96</td><td> 8.58 (s, 1H), 7.98 (s, 1H), 4.12 (s, 2H), 3.74 (m, 2H), 3.48 (m, 4H), 3.34 (m, 2H), 2.83 (s, 3H), 1.77 (m, 2H), 1.73 (m, 2H).</td><td> 381.3</td>
<td> J-14</td><td> Ν׳γ<sup>ρ</sup>־ o αΑΑ^-׳Ά׳Α O <sup>H</sup> I ) א—o</td><td> 95</td><td> 8.59 (s, 1H), 7.94 (brs, 1H),3.6O (m, 4H), 3.45 (m, 4H), 3.36 (m, 2H), 2.88 (s, 3H), 2.63 (m, 2H), 1.70 (m, 2H).</td><td> 381.3</td>
<td> J-15</td><td><sub>N|V</sub> a ץ<sup>,</sup> n''''''׳-א'''''A^+A ° <sup>H</sup> A</td><td> 100</td><td> No NMR Data</td><td> 338.2</td>
<td> J-16</td><td> A<sup>CF2</sup> o AnA^! ΰ <sup>H</sup> Ap</td><td> crude</td><td> No NMR Data</td><td> 365.2</td>
<td> J-17</td><td> νΆ^ΑΗ o AAn'^Ao 0 <sup>H</sup></td><td> crude</td><td> No NMR Data</td><td> 395.2</td>
<td> J-18</td><td> nA» q , AIn-^nA 0 <sup>H</sup> I /</td><td> crude</td><td> No NMR Data</td><td> 409.2</td>
[000251] Exemplary compounds: Using the methods described above the following compounds of Formula I-A and Formula I-B were prepared. Exemplary compounds of Formula I-A and Formula I-B are shown below in Table I. Exemplary methods for the preparation of the compounds are also provided below.
General method I: Substitution Reaction
Example 23: l-(3-((5-bromo ((2-ethyl (4-methylpiperazin-lyl)phenyl)amino)pyrimidin yl)amino)propyl)piperidin one
<img file="IL287787A_D0201.tif" />
[000252] A solution of l-(3-((5-bromo chloropyrimidin yl)amino)propyl)piperidin2-one (K-10, 4.0 g, 11.6 mmol) in 2-butanol (80 mL) at rt was treated with 2-ethyl (4methylpiperazin-l-yl)aniline (D-I-ll, 2.53 g, 11.6 mmol). The reaction mixture was treated with 4N HCI in 1,4-dioxane (3.5 mL, 13.9 mmol) and stirred at 95 °C for 72 h. The reaction mixture was cooled to rt and then basified with sat’d aqueous NaHCO3. The solution was extracted with DCM (3 x 50 mL) and the combined organics were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. The crude was purified silica gel column chromatography (4 to 5 % MeOH/DCM, 10 CV’s). The product was dissolved in DCM (200 mL) and added QuadraSil-MP resin (w/w) in order to remove residual palladium. The solution was stirred for 4 h and filtered. The filtrate was evaporated to obtain 1-(3-((5bromo ((2-ethyl (4-methylpiperazin-l-yl)phenyl)amino)pyrimidin-4yl)amino)propyl)piperidin one (1.70 g, 28 % yield) as off white solid. 1H NMR (400 MHz, DMSO-ifc): δ 8.09 (s, 1H), 7.81 (s, 1H), 7.13 (d, J = 8.5 Hz, 1H), 6.80 (m, 1H), 6.74 (m, 1H), 6.71 (m, 1H), 3.21 (m, 4H), 3.14 (m, 2H), 3.07 (m, 5H), 2.43 (m, 5H), 2.21 (s, 5H), 1.67 (s, 4H), 1.61 (m, 2H), 1.05 (t, J = 7.4 Hz, 3H); LC-MS (ESI) m/z: 530.3 (M+H+).
General Method J: Substitution Reaction tert-butyl 4-(4-((4-((3-(2-oxopiperidin-l-yl)propyl)amino) (trifluoromethyl)pyrimidin-2yl)amino)phenyl)-1,4-diazepane-1 -carboxyl
<img file="IL287787A_D0202.tif" />
Boc
[000253] A solution of tert-butyl 4-(4-aminophenyl)-1,4-diazepane-1 -carboxylate (D-I12, 0.21 g, 0.57 mmol) and l-(3-((2-(methylsulfinyl) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one (J-9, 0.17 g, 0.57 mmol) in DMF (3.0 mL) was sealed and heated at 90 °C for 12 h. The mixture was concentrated and the crude was purified by silica gel column chromatography (0 to 4% MeOH/DCM, 12 CV’s) to provide product tert-butyl 4(4-((4-((3-(2-oxopiperidin-l-yl)propyl)amino) (trifluoromethyl)pyri midin-2yl)amino)pheny 1)-1,4-diazepane carboxylate (0.20 g, 60 % yield). LC-MS (ESI) m/z: 592.4 (M+H+).
General Method K: Deprotection of Boc group of R4 moieties
Example 9: l-(3-((2-((4-(l,4-diazepan-l-yl)phenyl)amino) (trifluoromethyl)pyrimidin-4yl)amino)propyl)piperidin one
<img file="IL287787A_D0203.tif" />
[000254] A solution of tert-butyl 4-(4-((4-((3-(2-oxopiperidin-l-yl)propyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)phenyl)-l,4-diazepane-l-carboxylate (0.20 g, 0.34 mmol) in DCM (3 mL) was treated with 4 N HC1 in 1,4-dioxane (1.0 mL). Hie mixture was stirred at rt for 2 h. The solution was concentrated and the residue was dissolved in water (1.0 mL) and acetonitrile (1 mL), frozen and lyophilized to obtain 1-(3-((2-((4-(1,4-diazepan-lyl)phenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one hydrochloride (0.12 g, 67 % yield). 1H NMR (400 MHz, DMS0-&): δ 9.23 (brs, 1H), 8.27 (s, 1H, FA), 8.08 (s, 1H), 7.47 (d, J = 8.5 Hz, 2H), 7.06 (s, 1H), 6.67 (d, J = 8.5 Hz, 2H), 3.51 (t, J = 5.0 Hz, 2H), 3.47 (t, J = 6.2 Hz, 3H), 3.34-3.37 (m, 3H), 3.30 (t, J = 6.9 Hz, 3H), 3.20 (s, 3H), 2.98 (t, J = 4.9 Hz, 2H), 2.80 (t, J = 5.6 Hz, 2H), 2.21(1, J = 6.0 Hz, 2H), 1.87-1.90 (m, 2H), 1.69-1.75 (m, 7H); LC-MS (ESI) m/z: 492.4 (M+H+).
General Method L: Reductive Alkylation of R4 moieties
Example 10: l-(3-((2-((4-(4-ethyl-l,4-diazepan-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one
<img file="IL287787A_D0204.tif" />
[000255] A solution of 1-(3-((2-((4-(1,4-diazepan-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one (9, 0.10 g, 0.20 mmol)) in methanol (0.5 mL) was treated with acetaldehyde (0.1 mL 1.8 mmol), and acetic acid (2 drops). Sodium cyanoborohydride (0.026 g, 0.41 mmol) was added and the mixture was stirred at rt 6 h. The solution was treated with brine and then extracted with EtOAc (3x15 mL). The combined organics were dried over anhydrous Na2SO4, filtered and concentrated. The crude was purified by reverse-phase column chromatography (0% to 20% CH3CN/H2O (0.1% FA), 15 CV’s) to obtain l-(3-((2-((4-(4-ethyl-l,4-diazepan-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one (56 mg, 49 % yield). 1H NMR (400 MHz, DMSO-ifc): δ 9.21 (brs , 1H), 8.17 (s, 1H, FA), 8.08 (s, 1H), 7.45 (d, J = 8.3 Hz, 2H), 7.05 (s, 1H), 6.63 (d, J = 8.7 Hz, 2H), 3.47 (t, J = 4.9 Hz, 3H), 3.36-3.42 (m, 5H), 3.30 (t, J = 6.9 Hz, 3H), 3.19 (s, 3H), 2.72 (t, J = 4.7 Hz, 2H), 2.53-2.56 (m, 4H), 2.21 (t, J = 5.9 Hz, 2H), 1.83-1.88 (m, 2H), 1.68-1.73 (m, 7H), 0.98 (t, J = 7.1 Hz, 3H); MS (ESI) m/z: 520.4 (M+H+).
General method of Acylation of R4 moieties:
Example 36: l-(3-((2-((4-(4-acetylpiperazin-l-yl) cyclopropylphenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one
<img file="IL287787A_D0205.tif" />
[000256] A solution of l-(3-((2-((2-cyclopropyl (piperazin-l-yl)phenyl)amino)-5(trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one (34, 0.21 g, 0.40 mmol) in 2.5 mL of 30% MeCN : water was treated with acetic anhydride (1.0 eq) at rt. The reaction mixture was stirred at rt for 30 min and the solution was diluted with water (15 mL). The solution was extracted with EtOAc (3 x 20 mL) and the combined organics were washed with sat’d NaHCO3 (15 mL). The organic layer was dried with MgSO4, filtered and concentrated under reduced pressure. The crude was purified by silica gel column chromatography (0 to 10% DCM/MeOH, 25CV) to yield l-(3-((2-((4-(4-acetylpiperazin-l-yl)-2cyclopropylphenyl)amino) (trifluoromethyl)pyrimidin yl)amino)propyl)piperidin one (0.13 g, 57 % yield) as a clear glassy solid. 1H NMR (400 MHz, DMSO-ifc): δ 8.64 (brs, 1H), 8.04 (s, 1H), 7.27 (s, 1H), 7.05 (brs, 1H), 6.75 (d, 1H), 6.46 (s, 1H), 3.54 (d, 4H), 3.01-3.24 (m, 10 H), 2.18-2.19 (m, 2H), 2.02 (s, 3H), 1.91-1.96 (m, 1H), 1.61-1.67 (m, 6 H), 0.82 (d, 2H), 0.58 (d, 2H); LC-MS (ESI) m/z: 560.4 (M+H+).
General Method M: Pd Coupling Reaction
Example 97: l-(3-((2-((5-(4-methylpiperazin-l-yl)pyridin yl)amino)-5(trifluoromethyl)pyri din yl)amino)propyl)piperidin one
<img file="IL287787A_D0206.tif" />
[000257] A mixture of commercially available 5-(4-methylpiperazin-l-yl)pyridin-2amine (0.13 g, 0.66 mmol) and l-(3-((2-chloro (trifluoromethyl)pyridin-4yl)amino)propyl)piperidin one (M-l, 0.20 g, 0.60 mmol) in 1,4-dioxane (3 mL) was treated with cesium carbonate (0.39 g, 1.2 mmol). The solution was sparged with Ar and treated with Pd2(dba)3 (0.055 g, 0.06 mmol) and Xantphos (0.069 g, 0.12 mmol). The mixture was sparged again with Ar, capped tightly and heated at 90 °C 15 h. The mixture was cooled to rt, diluted with DCM (20 mL) and water (10 mL). The black solid was filtered off and then the filtrate was treated with brine. The solution was extracted with additional DCM (3 x 25 mL). The combined organics were dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to obtain l-(3-((2-((5-(4-methylpiperazin-l-yl)pyridin yl)amino)-5(trifluoromethyl)pyridin yl)amino)propyl)piperidin one (0.18 g, 57 % yield) as an orange solid. 1H NMR (400 MHz, DMSO-ifc): δ 9.35 (s, IH), 8.01 (s, IH), 7.90 (d, J = 3.0 Hz, IH), 7.55 (d, J = 9.1 Hz, IH), 7.37 (dd, J = 9.1 and 3.1 Hz, IH), 7.11 (s, IH), 6.19-6.21 (m, IH), 3.31-3.35 (m, 2H), 3.22-3.26 (m, 2H), 3.13 (q, J = 6.5 Hz, 2H), 3.05-3.10 (m, 4H), 2.44-2.49 (m, 4H), 2.20-2.23 (m, 5H), 1.66-1.76 (m, 6H); LC-MS (ESI) m/z: 492.2 (M+H+).
Table I. Exemplary compounds.
<td> Example Number</td><td> Product</td><td> Method</td><td> Yield (%)</td><td><sup>1</sup>H NMR (400 MHz, DMSOd<sub>6</sub>): δ</td><td> LC-MS (m/z: (M+H<sup>+</sup>)</td>
<td> 1</td><td><sup>0</sup> Η N ^N N N A ¢3 <sup>H</sup> A 0 A</td><td> I</td><td> 20</td><td> 8.58 (IH, s), 8.14 (s, IH), 7.56 (m, 3H), 6.89 (t, J = 6.0 Hz, IH), 6.81 (d, J = 8.7 Hz, 2H), 3.43 (m, 2H), 3.16 (t, 2H, J = 7.2 Hz), 2.96 (d, J = 5.3 Hz, 4H), 2.65 (t, J = 4.8 Hz, 4H), 2.26 (t, J = 7.8 Hz, 2H), 1.77 (t, J = 7.8 Hz, 2H), 1.72 (m, 2H), 1.63 (m, IH), 1.43 (m, IH), 1.16 (s, 6H), 0.80 (m, 2H), 0.43 (m, 4H), 0.32 (m, 2H).</td><td> 504.4</td>
<td> 2</td><td> n<sup>c</sup> Y. 1 HN N X) <sup>H 0</sup> ל) N 1</td><td> J</td><td> 20</td><td> 8.32 (s, IH), 8.03 (s, IH), 7.20 (d, J = 8.6 Hz, IH), 6.77 (brs, IH), 6.74 (m, IH), 6.63 (m, IH), 3.26 (m, 4H), 3.13 (m, 6H), 2.56 (brs, 4H), 2.31 (s, 3H), 2.20 (m, 2H), 2.16 (s, 3H), 1.90 (m, 2H), 1.64 (m, 2H).</td><td> 492.4</td>
<td></td><td></td><td></td><td></td><td></td><td></td>
<td> 3</td><td> nr 7 <sup>0</sup> ־ Ό C' H</td><td> J</td><td> 22</td><td> 9.72 (s, 1H), 9.24 (brs, 1H), 8.26 (s, 1H), 7.89 (brs, 1H), 7.32 (d, J = 8.6 Hz, 1H), 6.91 (brs, 1H), 6.86 (dd, J = 2.4, 8.7 Hz, 1H), 3.41 (m, 4H), 3.32 (m, 2H), 3.27 (m, 2H), 3.21 (brs, 4H), 3.12 (m, 2H), 2.23 (s, 3H), 2.20 (m, 2H), 1.90 (m, 2H), 1.67 (m, 2H).</td><td> 478.4</td>
<td> 4</td><td> υγ I HN N Y ax <sup>h</sup> V לש N 1</td><td> J</td><td> 64</td><td> 8.60 (brs, 1H), 8.02 (brs, 1H), 7.09 (d, J = 8.4 Hz, 1H), 6.86 (m, 1H), 6.76 (brs, 1H), 6.72 (dd, J = 2.5 and 8.5 Hz, 1H), 3.21 (brs, 4H), 3.09 (brs, 6H), 2.49 (m, 2H), 2.44 (m, 4H), 2.19 (m, 5H), 1.87 (m, 2H), 1.57 (brs, 2H), 1.05 (t, J = 7.4 Hz, 3H).</td><td> 506.4</td>
<td> 5</td><td> nA' 0 X X X ΗΝ Ν Ν'^^Ή^Υ 'i? H</td><td> I&K</td><td> 47</td><td> 8.32 (s, 1H, FA), 8.20 (s, 1H), 7.80 (s, 1H), 7.44 (d, J = 8.2 Hz, 1H), 7.06 (t, J = 6.1 Hz, 1H), 7.00 (s, 1H), 6.97 (m, 1H), 3.24-3.32 (m, 6H), 3.18 (m, 2H), 2.90 (m, 2H), 2.71 (m 2H), 2.20 (m, 2H), 2.18 (s, 3H), 1.86 (m, 2H), 1.76 (m, 2H), 1.67 (m, 6H).</td><td> 457.4</td>
<td> 6</td><td> nA<sup>0</sup>' 0 1 X X HN N N'^<sup>x</sup>^N<sup>x</sup>X ל. 1</td><td> I</td><td> 65</td><td> 8.20 (brs, 1H, FA), 8.16 (s, 1H), 7.79 (s, 1H), 7.40 (d, J = 8.2 Hz, 1H), 7.04 (t, J = 6.1 Hz, 1H), 7.01 (s, 1H), 6.98 (m, 1H), 3.24-3.30 (m, 4H), 3.17 (m, 2H), 2.98 (m, 2H), 2.43 (m, 1H), 2.29 (m, 3H), 2.13-2.20 (m, 4H), 2.17 (s, 3H), 1.6-1.8 (m, 10H).</td><td> 471.4</td>
<td> 7</td><td> n+V 0 Λ 1 U HN N Γ H</td><td> J&K</td><td> 80</td><td> 8.74 (s, 1H), 8.32 (s, 1H, FA), 8.06 (s, 1H), 7.36 (d, J = 8.0 Hz, 1H), 6.9-7.1 (m, 2H), 3.19-3.32 (m, 6H), 3.15 (m, 2H), 2.90 (m, 2H), 2.73 (m, 1H), 2.18 (s, 3H), 2.18-2.20 (m, 2H), 2.18 (s, 3H), 1.86 (m, 2H), 1.76 (m,2H), 1.60-1.70 (m, 6H).</td><td> 491.4</td>
<td> 8</td><td> n^Y<sup>CF3</sup> 0 Η N l\r^ NN'ר A י 1</td><td> J</td><td> 42</td><td> 8.71 (s, 1H), 8.20 (s, 1H, FA), 8.05 (s, 1H), 7.33 (d, J = 8.1 Hz, 1H), 7.04 (s, 1H), 7.03 (d, J = 8.4 Hz, 1H), 7.00 (m, 1H), 3.19-3.25 (m, 4H), 3.15 (m, 2H), 2.97 (m, 2H), 2.44 (m, 1H), 2.29 (s, 3H), 2.1-2.2 (m,4H), 2.17 (s, 3H), 1.6-1.8 (m, 10H).</td><td> 505.4</td>
<td> 11</td><td> nV*<sup>3</sup> 0 ην<sup>λ</sup>ν%<sup>/χ/χ</sup>νΑ 0 ״ 0</td><td> J</td><td> 7</td><td> 8.60 (s, 1H), 8.34 (s, 1H: FA), 8.01 (s, lH),7.10(m, 1H), 6.95 (m, 1H), 6.76 (s, 1H), 6.70 (m 1H), 3.1-3.4 (brm, 6H), 3.09 (m, 2H), 2.50 (m, 3H), 2.44 (m, 5H), 2.21 (s, 3H), 2.20 (m, 2H), 1.65 (brm, 4H), 1.54 (brm, 2H), 1.06 (t, J = 7.4 Hz, 3H).</td><td> 520.4</td>
<td> 12</td><td><sup>0</sup> u ״ (/ ΰ N</td><td> J, K& L</td><td> 5</td><td> 8.60 (brs, 1H), 8.01 (brs, 1H), 7.10 (brm, 1H), 6.95 (t, 1H, J = 5.8 Hz), 6.76 (m, 1H), 6.72 (m, 1H), 3.19 (brs, 4H), 3.05-3.10 (m, 6H), 2.50 (m, 4H), 2.48 (m, 6H), 2.33-2.37 (m, 2H), 2.18 (m, 2H), 1.66 (brm, 4H), 1.58 (brm, 2H), 1.06 (t, J = 7.4 Hz, 3H), 1.01 (t, J = 7.2 Hz, 3H).</td><td> 534.4</td>
<td> 13</td><td> nV<sup>CF3</sup> 0 Λ V V <sub>Λ</sub> HN N N^^ N ן ύ ״ 0</td><td> J, K& L</td><td> 20</td><td> 8.57 (s, 1H), 8.03 (s, 1H), 7.24 (brm, 1H), 6.98 (d, J = 6.3 Hz, 1H), 6.71 (d, J = 8.9 Hz, 1H), 6.43 (s, 1H), 3.22 (brm, 4H), 3.12 (brm, 2H), 3.09 (brm, 4H), 2.41 (brm, 4H), 2.35 (brm, 3H), 2.18-</td><td> 546.4</td>
<td></td><td></td><td></td><td></td><td> 2.19 (m, 2H), 1.93 (m, 1H), 1.66 (brm, 4H), 1.60 (brm, 2H), 1.02 (brm, 3H), 0.81 (m, 2H), 0.57 (m, 2H).</td><td></td>
<td> 14</td><td> N-y<sup>CF</sup>0 ־ . HN'A'' N'' ^ :</td><td> J</td><td> 29</td><td> 8.57 (s, 1H), 8.17 (s, 1H, FA), 8.03 (s, 1H), 7.24 (brm, 1H), 6.98 (m, 1H), 6.71 (m, 1H), 6.42 (d, J = 2.7 Hz, 1H), 3.12-3.24 (m, 10H), 3.06 (t, J = 4.8 Hz, 4H), 2.43 (m, 4H), 2.182.20 (m, 5H), 1.94 (m, 1H), 1.66 (brm, 4H), 1.60 (brm, 2H), 0.81 (m, 2H), 0.56 (m, 2H).</td><td> 578.4</td>
<td> 15</td><td> N^<sup>Br 0</sup> I hn<sup>a</sup>n<sup>a</sup>n'^<sup>/x</sup>n־+ Λα <sup>h</sup> λ V ל: N 1</td><td> I</td><td> 6</td><td> 8.10 (s, 1H), 7.79 (s, 1H), 7.03 (d, J = 8.6 Hz, 1H), 6.78 (m, 2H), 6.70 (dd, J = 2.2 and 8.6 Hz, 1H), 3.19 (m, 4H), 3.09 (m, 7H), 2.45 (brs, 4H), 2.21 (s, 3H), 2.19 (m, 2H), 1.67 (brs, 4H), 1.59 (m, 2H), 1.09 (d, J = 6.8 Hz, 6H).</td><td> 544.4 546.4</td>
<td> 16</td><td> zz^z^A h<sup>־</sup> ’ IZ o \ )=°</td><td> J</td><td> 68</td><td> 10.18 (brs, 1H), 9.26 (brs, 2H), 8.50 (brs, 1H), 7.32 (t, J = 8.56 Hz, 1H), 6.94 (s, 1H), 6.89 (d, J = 8.56 Hz, 1H), 3.38 (brs, 4H), 3.20 (brs, 10H), 2.21 (brs, 5H), 1.63 (brs, 6H).</td><td> 492.4</td>
<td> 17</td><td> n^<sup>cf</sup>0 ־ X) <sup>H 0 </sup>0</td><td> J, K& L</td><td> 26</td><td> 8.62 (s, 1H), 8.03 (s, 1H), 7.17 (brs, 1H), 6.98 (s, 1H), 6.75 (m, 2H), 3.21 (brs, 4H), 3.14 (brs, 2H), 3.06 (brm, 4H), 2.55 (m, 2H), 2.20 (brm, 2H), 2.14 (s, 3H), 1.63 (m, 7H), 1.19 (brm, 2H), 1.00 (brm, 6H).</td><td> 534.5</td>
<td> 18</td><td> N^^<sup>3</sup> 0 X <sup>H 0 </sup>0 F</td><td> J</td><td> 43</td><td> 8.60 (s, 1H), 8.02 (s,lH), 7.13-7.20 (m, 1H), 6.97 (t, J = 5.8 Hz, 1H), 6.77 (s, 1H), 6.72 (d, J = 8.9 Hz, 1H), 4.61 (t, J = 4.9 Hz, 1H), 4.51 (t, J = 4.9 Hz, 1H), 3.11-3.25 (m, 6H), 3.063.10 (m,4H), 2.68 (t, J = 4.9 Hz, 1H), 2.62 (t, J = 4.9 Hz, 1H), 2.57 (t, J = 4.7 Hz, 4H), 2.19-2.20 (m, 2H), 2.13 (s, 3H), 1.59-1.66 (m, 6H).</td><td> 538.4</td>
<td> 19</td><td> ν'Ύ''<sup>3</sup> 0 X) <sup>H 0 </sup>0 N</td><td> J, K& L</td><td> 26</td><td> 8.61 (s, 1H), 8.03 (s, 1H), 7.16 (d, J = 7.0 Hz, 1H), 6.98 (brs, 1H), 6.76 (s, 1H), 6.72 (d, J = 8.4 Hz, 1H), 3.20 (brs, 4H), 3.14 (brs, 2H), 3.08 (brs, 4H), 2.49 (m, 4H), 2.34 (m, 2H), 2.19 (brs, 2H), 2.13 (s, 3H), 1.63 (m, 6H), 1.02 (t, J = 7.0 Hz, 3H).</td><td> 520.5</td>
<td> 20</td><td> nV<sup>CF3</sup> 0 Λ Λ X X) <sup>H 0</sup> 0 1</td><td> J</td><td> 30</td><td> 8.60 (s, 1H), 8.03 (s, 1H), 7.16 (d, J = 7.9 Hz, 1H), 6.96 (brs, 1H), 6.77 (s, 1H), 6.72 (d, J = 8.6 Hz, 1H), 3.20 (brs, 4H), 3.14 (brs, 2H), 3.08 (brs, 4H), 2.43 (brs, 4H), 2.20 (brs, 5H), 2.13 (s, 3H), 1.63 (m, 6H).</td><td> 506.4</td>
<td> 21</td><td> n״V<sup>CF3</sup> 0 jK I X) <sup>H 0</sup> ל] N 6</td><td> J, K& L</td><td> 12</td><td> 8.30 (s, 1H), 8.03 (s, 1H), 7.20 (d, J = 8.6 Hz, 1H), 6.76 (s, 1H), 6.71 (m, 2H), 3.27 (m, 4H), 3.15 (m, 2H), 3.10 (brs, 4H), 2.81 (m, 1H), 2.41 (brs, 4H), 2.20 (m, 2H), 2.16 (s, 3H), 2.00 (m, 2H), 1.85 (m, 2H), 1.66 (m, 8H).</td><td> 546.5</td>
<td> 22</td><td><sup>N</sup>^<sup>CF3 0</sup><sup>0 H</sup> ס' 0 Λ</td><td> J, K& L</td><td> 19</td><td> 8.61 (s, 1H), 8.02 (s, 1H), 7.15 (brs, 1H), 6.97 (brs, 1H), 6.76 (s, 1H), 6.71 (d, J = 7.8 Hz, 1H), 3.21 (m, 5H), 3.04 (brs, 4H), 2.65 (brs, 4H), 2.19 (brs, 2H), 2.13 (s, 3H), 1.67 (m, 8H), 0.42 (m, 2H), 0.33 (m, 2H).</td><td> 532.4</td>
<td> 24</td><td> 0 <sup>H 0</sup> 0 \</td><td> J</td><td> 16</td><td> 8.52 (s, 1H), 8.02 (s, 1H), 7.11 (brs, 1H), 6.96 (s, 1H) 6.47 (d, J = 6.8 Hz, 1H), 6.13 (s, 1H), 3.46 (brs, 2H), 3.37 (m, 2H), 3.17 (m, 8H), 2.58 (brs, 2H), 2.43 (brs, 2H), 2.25 (s, 3H), 2.19 (s, 2H), 1.87 (m, 1H), 1.58 (m, 6H), 0.79 (m, 2H), 0.54 (m, 2H).</td><td> 546.6</td>
<td> 25</td><td><sub>n</sub>^CF3 <sub>o</sub> a ב 1 HN N Ν'^'^Ν 0 ״ י Ό ל/ N 1</td><td> J</td><td> 72</td><td> 8.67 (brs, 1H), 8.12 (s, 1H, FA), 8.03 (brs, 1H), 7.23 (d, J = 8.6 Hz, 1H), 6.91 (brm, 1H), 6.84 (s, 1H), 6.79 (d, J = 8.9 Hz, 1H), 4.13 (t, J = 5.2 Hz, 2H), 3.10-3.40 (m, 14H), 2.76 (brs, 3H), 2.15 (s, 3H), 1.87-1.92 (m, 2H), 1.62-1.69 (brm, 2H).</td><td> 508.2</td>
<td> 26</td><td> 0 :</td><td> I</td><td> 6</td><td> 8.02 (s, 1H), 7.85 (s, 1H), 7.35 (d, J = 8.72 Hz, 1H), 6.86 (t, J = 5.76 1H), 6.71 (dd, J = 2.5 and 8.7 Hz, 1H), 6.44 (d, J = 2.4 Hz, 1H), 3.25 (m, 4H), 3.15 (m, 2H), 3.05 (brs, 4H), 2.44 (brs, 4H), 2.20 (m, 5H), 1.94 (m, 1H), 1.65 (m, 6H), 0.82 (m, 2H), 0.56 (m, 2H).</td><td> 544.3 546.3</td>
<td> 27</td><td> N^<sup>1</sup> 0 λ HN־'' N<sup>־</sup>' n'' <sup>Z</sup> N<sup>Z </sup>- . :</td><td> I</td><td> 13</td><td> 8.02 (s, 1H), 7.78 (s, 1H), 7.35 (d, J = 8.72 Hz, 1H), 7.03 (t, 1H), 6.70 (dd, J = 2.5 and 8.8 Hz, 1H), 6.44 (d, J = 2.44 Hz, 1H), 3.24 (m, 4H), 3.15 (m, 2H), 3.04 (brs, 4H), 2.42 (brs, 4H), 2.42 (m, 5H), 1.94 (m, 1H),</td><td> 498.4</td>
<td></td><td></td><td></td><td></td><td> 1.66 (m, 6Η), 0.82 (m, 2Η), 0.56 (m, 2Η).</td><td></td>
<td> 28</td><td> Y<sup>CF</sup>0 ־ A “ <sup>0 </sup>0</td><td> J</td><td> 18</td><td> 8.30 (s, 1H), 8.01 (s, 1H), 7.08 (d, J = 8.6 Hz, 1H), 6.80 (d, J = 2.6 Hz, 1H) 6.72 (dd, J = 2.6 and 8.6 Hz, 1H), 6.66 (m, 1H), 3.23 (m, 4H), 3.12 (brs, 8H), 2.50 (m, 3H), 2.39 (m, 2H), 2.19 (m, 2H), 1.69 (t, J = 3.4 Hz, 4H), 1.59 (t, J = 6.8 Hz, 2H), 1.13 (d, J = 6.8 Hz, 6H), 1.04 (t, J = 7.1 Hz, 3H).</td><td> 548.5</td>
<td> 29</td><td> Νγ<sup>01</sup> 0 γ “ <sup>ΰ</sup> 0</td><td> I</td><td> 10</td><td> 8.08 (s, 1H), 7.72 (s, 1H), 7.03 (d, J = 8.6 Hz, 1H), 6.94 (t, J = 5.7 Hz, 1H), 6.78 (d, J = 2.4 Hz, 1H), 6.69 (dd, J =2.4 and 8.6 Hz, 1H), 3.16(m, 14H), 2.35 (m, 2H), 2.19 (d, J = 5.8 Hz, 2H), 1.8 (m, 1H), 1.62 (m, 6H),1.09 (d, J = 6.8 Hz, 6H), 1.03 (t, J = 7.1 Hz, 3H).</td><td> 514.5</td>
<td> 30</td><td> N״V<sup>Br</sup> 0 χ ב 1 ן HN Ν Ν — nN Αα <sup>η</sup> Ο V ל: Ν</td><td> I</td><td> 9</td><td> 8.09 (s, 1H), 7.79 (s, 1H), 7.03 (d, J = 8.6 Hz, 1H), 6.78 (brs, 2H), 6.67 (dd, J = 8.5 and 16.6 Hz, 1H), 3.15 (m, 14H), 2.47 (m, 1H), 2.36 (q, 2H), 2.19 (brs, 2H), 1.62 (m, 6H), 1.09 (d, J = 6.8 Hz, 6H), 1.03 (t, J = 7.0 Hz, 3H).</td><td> 558.4 560.4</td>
<td> 31</td><td> nA<sup>cf</sup>’ 0 ΗΝ —'*'־νΆ /-Λ <sup>Η</sup> Ο V Ο \</td><td> J, κ& L</td><td> 6</td><td> 8.24 (brs, 1H), 8.00 (s, 1H), 7.05 (d, J = 8.3 Hz, 1H), 6.69 (brs, 1H), 6.53 (s, 1H), 6.50 (m, 1H), 3.50 (m, 2H), 3.43 (m, 2H), 3.23 (m, 4H), 3.09 (m, 4H), 2.68 (m, 2H), 2.53 (m, 2H), 2.31 (s, 3H), 2.20 (m, 2H), 1.91 (m, 2H), 1.64 (m, 6H), 1.08 (t, J = 7.4 Hz, 3H).</td><td> 534.4</td>
<td> 32</td><td> 1Λ <sub>Λ Λ</sub> I <sup>H</sup> X V 0 N 1</td><td> I</td><td> 50</td><td> 11.4 (brs, 1H), 10.10 (s, 1H), 8.75 (s, 1H), 8.19 (brs, 1H), 7.30 (brs, 1H), 6.866.90 (m, 2H), 3.81 (d, J = 11.3 Hz, 2H), 3.43 (d, J = 10.4 Hz, 2H), 3.2-3.05 (m, 10 H), 2.75 (d, J = 4.4 Hz, 3H), 2.54 (d, J = 8.6 Hz, 2H), 2.15 (s, 2H), 1.63 (s, 6 H), 1.08 (t, J = 7.5 Hz, 3H).</td><td> 486.2</td>
<td> 33</td><td> 0 ן ΗΝ'<sup>Λ</sup>'Ν<sup><</sup>^Ν'^—^'N'Y ΑΧ <sup>H</sup> X V ל: N 1</td><td> J</td><td> 11</td><td> 8.30 (s, 1H), 8.01 (s, 1H), 7.08 (d, J = 8.6 Hz, 1H), 6.80 (d, J = 2.4 Hz, 1H), 6.72 (dd, J = 2.5 and 8.6 Hz, 1H), 6.66 (brs, 1H), 3.24 (m, 5H), 3.14 (m, 8H), 2.50 (m, 2H), 2.25 (s, 3H), 2.20 (m, 2H), 1.69 (m, 4H), 1.61 (m, 2H), 1.13 (d, J = 6.8 Hz, 6H).</td><td> 534.5</td>
<td> 34</td><td> n-B<sup>f</sup><sub>S o</sub><sub>Λ</sub> HN % : H</td><td> I&K</td><td> 49</td><td> 8.59 (s, 1H), 8.03 (s, 1H), 7.25 (s, 1H), 6.99 (s, 1H), 6.72 (d, J = 8.9 Hz, 1H), 6.43 (s, 1H), 3.10-3.25 (m, 7H), 3.06 (t, 4H), 2.93 (m, 4H), 2.18 (m, 2H), 1.911.95 (m, 1H), 1.59-1.70 (m, 6H), 0.81 (m, 2H), 0.57 (m, 2H).</td><td> 518.2</td>
<td> 35</td><td> n^t<sup>cf</sup>0 ־ n<sup>></sup>S^^׳'n+'n+׳׳hn . / :</td><td> I</td><td> 39</td><td> 8.63 (s, 1H), 8.11 (s, 1H), 7.45 (d, J = 14.4 Hz, 1H), 7.15 (s, 1H), 6.55 (d, J = 9.6 Hz, 1H), 3.28 (s, 1H), 3.22 (m, 2H), 3.15 (s, 3H), 3.01 (brs, 4H), 2.19 (m, 2H), 1.92-1.98 (m, 1H), 1.66 (m, 6 H), 0.85 (m, 2H), 0.57 (m, 2H).</td><td> 550.2</td>
<td> 37</td><td> N^V<sup>0</sup>^ 0 Λ J I HN N 0 M - Λ N H</td><td> J&K</td><td> 48</td><td> 10.3 (brs, 1H), 9.37 (brs, 1H), 8.49 (brs, 1H), 7.37 (brs, 1H), 6.94 (s, 1H), 6.89 (d, J = 9.0 Hz, 1H), 4.094.15 (m, 2H), 3.55 (brs, 4H), 3.35-3.42 (m, 4H), 3.08-3.23 (m, 6H), 2.22 (s,</td><td> 494.2</td>
<td></td><td></td><td></td><td></td><td> 3Η), 1.85-1.92 (m, 2Η), 1.62-1.73 (brm, 2Η).</td><td></td>
<td> 38</td><td> Νγ 0 <sub>Λ</sub> HN'<sup>A</sup>'N'<sup>־>k</sup>N'^׳<sup>/</sup>^N''\ <sup>Η</sup></td><td> J</td><td> 30</td><td> 8.60 (s, 1Η), 8.04 (s, 1H), 7.25 (d, J = 8.0 Hz, 1H), 6.98 (d, J = 5.6 Hz, 1H), 6.73 (d, J = 8.0 Hz, 1H), 6.44 (d, J = 2.0 Hz, 1H), 3.23 (brs, 6H), 3.12 (brs, 4H), 2.59 (brs, 4H), 2.39 (d, J = 9.6 Hz, 2H), 2.33 (brs, 3H), 1.94 (m, 1H), 1.58 (m, 8H), 0.81 (m, 2H), 0.59 (m, 2H).</td><td> 546.5</td>
<td> 39</td><td> N+f<sup>3</sup> 0 1 1 <sub>Λ Λ</sub> ϊ ΗΝ N N N O ל: N 1</td><td> J</td><td> 29</td><td> 8.67 (s, 1H), 8.02 (s, 1H), 7.15 (d, J = 8.4 Hz, 1H), 6.89 (s, 1H), 6.76-6.81 (m, 2H), 4.12 (t, J = 5.2 Hz, 2H), 3.25-3.38 (m, 7H), 3.13 (brs, 4H), 2.97 (brs, 4H), 2.51-2.59 (m, 4H), 1.88 (t, J = 6.1 Hz, 2H), 1.63 (brs, 2H), 1.06 (t, J = 7.5 Hz, 3H).</td><td> 522.4</td>
<td> 40</td><td> Ν' 0 '<sup>6</sup>׳ ϊ J Π <sub>Λ</sub> ΗΝ Ν Ν ' Ν 0 </td><td> I</td><td> 12</td><td> 8.05 (s, 1H), 7.86 (s, 1H), 7.34 (d, J = 8.5 Hz, 1H), 6.82 (m, 1H), 6.71 (d, J = 8.2 Hz, 1H), 6.44 (s, 1H), 4.12 (s, 2H), 3.27 (m, 2H), 3.17 (brs, 4H), 3.04 (brs, 4H), 2.42 (brs, 4H), 2.20 (s, 3H), 1.91 m, 2H), 1.69 (brs, 2H), 1.03 (m, 1H), 0.82 (m, 2H), 0.57 (m, 2H).</td><td> 544.5</td>
<td> 41</td><td> 0 ל J ϊ <sub>Λ</sub> ΗΝ Ν Ν 0 :</td><td> J</td><td> 13</td><td> 8.25 (s, 1H), 8.05 (s, 1H), 7.34 (d, J = 8.7 Hz, 1H), 6.73 (dd, J = 2.6 and 8.7 Hz, 1H), 6.65 (brs, 1H), 6.49 (d, J = 2.5 Hz, 1H), 4.13 (t, J = 5.2 Hz, 2H), 3.33 (q, J = 6.4 Hz, 2H), 3.19 (m, 4H), 3.09 (m, 4H), 2.45 (m, 4H), 2.23 (s, 3H), 1.92 (m, 3H), 1.71 (m, 2H), 0.84 (m, 2H), 0.59 (m, 2H).</td><td> 534.2</td>
<td> 41</td><td> Ν' 0 ϊ A A <sub>Λ</sub> HN N N^^^N 0 :</td><td> J</td><td> 44</td><td> 10.6 (brs, 1H), 7.32 (brs, 1H), 6.84 (d, J = 8.8 Hz, 1H), 6.54 (s, 1H), 4.12 (s, 2H), 3.79-3.82 (m, 2H), 3.48-3.45 (m, 2H), 3.30 (brs, 2H), 2.99-3.14 (m, 8H), 2.80 (s, 3H), 1.87-1.94 (m, 4H), 1.68 (brs, 1H), 0.87 (m, 2H), 0.65 (m, 2H).</td><td> 534.2</td>
<td> 42</td><td> n^<sup>CF3</sup> 0 Λ Λ A <sub>Λ</sub> HN N Ν^'Ά 0 ־ <</td><td> J</td><td> 6</td><td> 8.58 (s, 1H), 8.04 (s, 1H), 7.23 (s, 1H), 6.90 (s, 1H), 6.73 (dd, J = 8.8 and 2.7 Hz, 1H), 6.43 (d, J = 2.7 Hz, 1H), 4.11 (m, 2H), 3.69 (m, 1H), 3.55 (m, 1H), 3.29 (m, 1H), 3.13 (s,4H), 3.02 (d, 2H), 2.66 (m, 1H), 2.32 (m, 1H), 2.20 (m, 1H), 1.702.07 (brm, 11H), 1.35 (m, 1H), 0.81 (m, 2H), 0.57 (m, 2H).</td><td> 560.3</td>
<td> 43</td><td> /A. /<sup>C</sup> A A /A /A A ύ N 1</td><td> I</td><td> 7</td><td> 8.08 (s, 1H), 7.74 (s, 1H), 7.13 (d, J = 8.5 Hz, 1H), 6.92 (m, 1H), 6.74 (d, J = 2.3 Hz, 1H), 6.71 (dd, J = 2.5 and 8.6 Hz, 1H), 4.12 (t, J = 5.1 Hz, 2H), 3.25 (m, 2H), 3.16(m, 4H), 3.07 (m, 4H), 2.52 (m, 2H), 2.43 (m, 4H), 2.21 (s, 3H), 1.88 (m, 2H), 1.67 (m, 2H), 1.05 (t, J = 7.2 Hz, 3H).</td><td> 488.2</td>
<td> 44</td><td> n 0 1 1 <sub>Λ Λ</sub> I HN N N N O A N 1</td><td> I</td><td> 9</td><td> 7.83 (s, 1H), 7.74 (s, 1H), 7.20 (d, J = 8.6 Hz, 1H), 6.75 (d, J = 2.6 Hz, 1H), 6.71 (dd, J = 2.7 and 8.6 Hz, 1H), 6.49 (m, 1H), 4.14 (t, J = 5.3 Hz, 2H), 3.29 (m, 2H), 3.21 (m, 4H), 3.11 (m, 4H), 2.56 (m, 2H), 2.46 (m, 4H), 2.24 (s, 3H), 1.93 (m, 2H), 1.71 (m, 2H), 1.10 (t, J = 7.5 Hz, 3H).</td><td> 532.2 534.2</td>
<td> 45</td><td> 11/^1 Η Ν Ν Ν Ν0 <sup>״</sup> ' ל C 1</td><td> I</td><td> 11</td><td> 7.71 (brs, 1H), 7.43 (s, 1H), 7.24 (d, J = 8.6 Hz, 1H), 6.72 (m, 3H), 4.13 (m, 2H), 3.3 (m, 4H), 3.21 (m, 4H), 3.09 (brs, 4H), 2.53 (m, 4H), 2.26 (s, 3H), 1.90 (m, 2H), 1.71 (m, 2H), 1.38 (m, 1H), 1.06(1, J = 8.6 Hz, 3H), 0.77 (m, 2H), 0.39 (m, 2H).</td><td> 494.5</td>
<td> 46</td><td> n׳V<sup>CF3</sup> ο Λ Λ <sub>Λ Λ</sub> Λ ΗΝ Ν Ν Ν Ο ץ <sup>Η</sup> Γ 1 ψ ל: Ν Η</td><td> J&K</td><td> 49</td><td> 10.1 (brs, 1H), 9.28 (brs, 2H), 8.36 (brs, 1H), 7.31 (brs, 1H), 6.88-6.92 (m, 2H), 4.12 (brs, 2H), 2.963.46 (m, 12H), 2.52-2.61 (m, 2H), 2.50-2.52 (m, 2H), 1.88 (s, 2H), 1.69 (brs, 2H), 1.11 (t, J = 7.5 Hz, 3H).</td><td> 508.2</td>
<td> 47</td><td> n״-<sup>cf</sup>' 0 <sub>Λ</sub> ΗΝ Ν'''Ν^ 'Ν<sup>Ζ</sup>S . :</td><td> J</td><td> 52</td><td> 8.25 (s, 1H), 8.05 (s, 1H), 7.33 (d, J = 8.7 Hz, 1H), 6.73 (dd, J = 2.6 and 8.7 Hz, 1H), 6.68 (brs, 1H), 6.49 (d, J = 2.4 Hz, 1H), 4.00 (s, 2H), 3.79 (t, J = 5.0 Hz, 2H), 3.25 (m, 6H), 3.08 (m, 4H), 2.46 (m, 4H), 2.23 (s, 3H), 1.94 (m, 1H), 1.71 (m, 2H), 0.84 (m, 2H), 0.58 (m, 2H).</td><td> 534.3</td>
<td> 47</td><td> Ν'' <sup>CF;</sup> 0 ϊ J <sub>Λ Λ</sub> ϊ ״ ΗΝ Ν Ν Ν Υ . :</td><td> J</td><td> 55</td><td> 10.5 (brs, 1H), 8.65 (s, 1H), 8.11 (s, 1H), 7.40 (d,J = 8.7 Hz, 1H), 7.00 (brs, 1H), 6.81 (dd, J = 2.6 and 8.6 Hz, 1H), 6.56 (d, J = 2.6 Hz, 1H), 4.00 (s, 2H), 3.80 (m, 2H), 3.74 (brs, 2H), 3.46 (brs, 6H), 3.33 (m, 2H), 3.28 (m, 4H), 2.82 (s, 3H), 1.96 (m, 1H), 1.72 (m, 2H), 0.87 (m, 2H), 0.63 (m, 2H).</td><td> 534.3</td>
<td> 48</td><td> 0 <sup>3</sup>^/*־־׳N Ν'''''־'־־'''־ Η /-Λ <sup>Η</sup> V Q CN</td><td> J</td><td> 24</td><td> 8.66 (brs, 1H), 8.01 (brs, 1H), 7.06 (brs, 2H), 6.406.43 (m, 2H), 3.51-3.56 (m, 2H), 3.25-3.48 (m, 7H), 3.03.2 (brm, 4H), 2.32-2.38 (m, 1H), 2.17-2.24 (m, 3H),</td><td> 516.2</td>
<td></td><td></td><td></td><td></td><td> 1.57-1.66 (m, 6H), 1.06 (t, J = 7.5 Hz, 3H).</td><td></td>
<td> 49</td><td><sup>n</sup>7<sup>CFs 0</sup> ״ ην'^ν^ν'^^'νΆ 7 0 a</td><td> J</td><td> 33</td><td> 8.62 (s, 1H), 8.04 (s, 1H), 7.27 (d, J = 7.3 Hz, 1H), 7.01 (brs, 1H), 6.73 (dd, J = 2.2, 8.6 Hz, 1H), 6.43 (d, J = 2.0 Hz, 1H), 3.69 (s, 2H), 3.41 (brs, 4H), 3.20 (m, 4H), 3.07 (brs, 2H), 2.88 (s, 3H), 2.19 (brs, 2H), 1.94 (m, 1H), 1.61 (brs, 6H), 0.82 (m, 2H), 0.61 (m, 2H).</td><td> 546.5</td>
<td> 50</td><td> nY<sup>CF3</sup> 0 HN'^'N^'N'^X<sup>/</sup>^N<sup>z</sup>7 w ״ 0</td><td> J</td><td> 36</td><td> 8.62 (s, 1H), 8.02 (s, 1H), 7.13 (m, 1H), 6.90 (m, 1H), 6.76 (m, 1H), 6.72 (m, 1H), 4.08 (s, 2H), 3.74 (m, 6H), 3.35 (brm, 2H), 3.20 (brm, 4H), 3.06 (m, 4H), 2.50 (m, 2H), 1.76 (brm, 2H), 1.57 (brm, 2H,), 1.06(1, J = 7.5 Hz, 3H).</td><td> 523.4</td>
<td> 51</td><td> o7<sub>>־</sub> H ΤΣ o</td><td> J</td><td> 48</td><td> 8.59 (s, 1H), 8.04 (s, 1H), 7.27 (m, 1H), 6.94 (brm, 1H), 6.74 (m, 1H), 6.44 (m, 1H), 4.08 (s, 2H), 3.74 (m, 6H), 3.36 (brm, 2H), 3.23 (brm, 4H), 3.05 (m, 4H), 1.96(m, 1H), 1.76 (brm, 2H), 1.60 (brm, 2H,), 0.82 (m, 2H), 0.60 (m, 2H).</td><td> 535.4</td>
<td> 52</td><td> nV<sup>F3 0 </sup>. ΗΝ^'Ν<sup>ΐ</sup>^Ν'<sup>χ</sup>*^<sup>/Χ</sup>^'Ν'^Α V7 ״ 7 0</td><td> J</td><td> 37</td><td> 8.57 (s, 1H), 8.18 (s, 1H, FA), 8.04 (s, 1H), 7.24 (m, 1H), 6.93 (m, 1H), 6.73 (m, 1H), 6.43 (m, 1H), 4.08 (s, 2H), 3.2-3.7 (m, 6H), 3.20 (brm, 2H), 3.06 (m, 4H), 2.44 (m, 4H), 2.20 (s, 3H), 1.95 (m, 1H), 1.75 (brm, 2H), 1.60 (brm, 2H), 0.82 (m, 2H), 0.59 (m, 2H).</td><td> 594.4</td>
<td> 52</td><td> n^y<sup>cf</sup>0 ־ :</td><td> J</td><td> 36</td><td> 11.1 (brs, 1H), 10.23 (brs, 1H), 8.46 (brs, 1H), 7.36 (brs, 1H), 6.87 (d, J = 8.8 Hz, 1H), 6.56 (s, 1H), 4.08 (s, 2H), 3.83 (d, J = 8.8 Hz, 2H), 3.70-3.76 (m, 2H), 3.09-3.45 (brm, 12H), 2.78 (d, J = 4.4 Hz, 3H), 1.93 (brs, 1H), 1.75 (s, 2H), 1.63 (brs, 2H), 0.90 (m, 2H), 0.69 (m, 2H).</td><td> 594.4</td>
<td> 53</td><td><sub>Ν</sub>׳'/θΡ<sub>0</sub> ־ HY U 1 <sup>H</sup> ( 0 :</td><td> J</td><td> 7</td><td> 10.6 (brs, 1H), 9.69 (brs, 1H), 8.10 (brs, 3H), 6.93 (s, 1H), 4.39 (d, J= 13.7 Hz, 2H), 4.09 (s, 2H), 3.75 (d, J = 5.0 Hz, 2H), 3.49 (d, J = 11.3 Hz, 2H), 3.40 (brs, 2H), 3.24 (m, 6H), 3.07 (m, 2H), 2.80 (s, 3H), 2.54 (m, 2H), 1.77 (brs, 2H), 1.59 (brs, 2H), 1.12 (t, J = 7.5 Hz, 3H).</td><td> 537.55</td>
<td> 54</td><td> Η N N'''''''-'י'''־'N''Λ כ/ 0</td><td> J</td><td> 53</td><td> 8.60 (s, 1H), 8.17 (s, 1H, FA), 8.01 (m, 1H), 7.10 (m, 1H), 6.90 (m, 1H), 6.74 (m, 1H), 6.73 (m, 1H), 4.08 (s, 2H), 3.74 (m, 2H), 3.40 (brm, 2H), 3.20 (brm, 4H), 3.06 (m, 4H), 2.4-2.6 (m, 6H), 2.21 (s, 3H), 1.75 (brm, 2H), 1.57 (brm, 2H,), 1.07 (t, J = 7.5 Hz, 3H).</td><td> 536.4</td>
<td> 55</td><td> -θΛ־ Cr</td><td> I</td><td> 32</td><td> 10.6 (brs, 1H), 8.19 (brs, 1H), 7.82 (s, 1H), 7.42 (d, J = 8.6 Hz, 1H), 7.13 (brs, 1H), 6.77 (dd, J = 2.3 and 8.7 Hz, 1H), 6.51 (d, J = 2.1 Hz, 1H), 4.09 (s, 2H), 3.74 (t, J = 5.2 Hz, 2H), 3.41 (m, 2H), 3.32 (m, 3H), 3.28 (m, 5H), 3.01 (brs, 4H), 2.79 (s, 3H), 1.96 (m, 1H), 1.77 (m, 2H), 1.66 (m, 2H), 0.84 (m, 2H), 0.60 (m, 2H).</td><td> 514.4</td>
<td> 56</td><td> 0 ׳ + χ גר ΗΝ Ν Ν'^^Ν 0 cr Ν 1</td><td> j</td><td> 14</td><td> 8.65 (s, 1Η), 8.02 (s, 1Η), 7.14 (d, J = 8.0 Hz, IH), 6.88 (brs, IH), 6.77 (m, 2H), 4.12 (m, 2H), 3.72 (s, 2H), 3.42 (m, 4H), 3.30 (m, 2H), 3.14 (brs, 4H), 2.89 (s, 3H), 2.50 (m, 2H), 1.89 (d, J = 7.2 Hz, 2H), 1.63 (brs, 2H), 1.07 (t, J = 7.2 Hz, 3H).</td><td> 536.43</td>
<td> 57</td><td> N^<sup>CI</sup> ° Η Ν Ν Ν 7 η f 9 A 0</td><td> I</td><td> 36</td><td> 8.07 (s, IH), 7.74 (s, IH), 7.16 (d, J = 8.6 Hz, IH), 6.94 (t, J = 5.9 Hz, IH), 6.76 (s, IH), 6.71-6.73 (m, IH), 4.08 (s, 2H), 3.71-3.74 (m, 6 H), 3.37-3.39 (m, 2H), 3.21-3.26 (m, 4H), 3.033.07 (m, 4H), 2.51-2.55 (m, 2H), 1.74-1.77 (m, 2H), 1.59-1.65 (m, 2H), 1.06 (t, J = 7.5 Hz, 3H).</td><td> 489.4</td>
<td> 58</td><td> ίΎ A A 0</td><td> I</td><td> 25</td><td> 8.14 (s, IH, FA), 8.05 (s, IH), 7.74 (s, IH), 7.14(d, J = 8.6 Hz, IH), 6.93 (t, J = 5.9 Hz, IH), 6.75 (d, J = 2.7 Hz, IH), 6.71 (dd, J = 8.7 and 2.7 Hz, IH), 4.08 (s, 2H), 3.73 (t, J = 5.5 Hz, 2H), 3.37-3.39 (m, 2H), 3.21-3.25 (m, 4H), 3.08 (t, J = 4.8 Hz, 4H), 2.51-2.52 (m, 2H), 2.47 (s, 4H), 2.23 (s, 3H), 1.76 (t, J = 5.6 Hz, 2H), 1.63 (m, 2H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 502.4</td>
<td> 59</td><td> ־A Ο ΖΙ & F^Xv</td><td> I</td><td> 40</td><td> 8.02 (s, IH), 7.78 (s, IH), 7.38 (d, J = 8.8 Hz, IH), 7.00 (t, J = 5.8 Hz, IH), 6.72 (dd, J = 8.8, 2.7 Hz, IH), 6.46 (d, J = 2.7 Hz, IH), 4.08 (s, 2H), 3.70-3.74 (m, 6H), 3.39-3.41 (m, 2H), 3.26 (q, J = 7.0 Hz, 4H), 3.02 (t, J = 4.6 Hz, 4H), 1.93 (m, IH), 1.76 (t, J = 5.6 Hz, 2H), 1.65 (p, J = 6.9</td><td> 502.4</td>
<td></td><td></td><td></td><td></td><td> Hz, 2H), 0.82 (m, 2H), 0.56 (m, 2H).</td><td></td>
<td> 60</td><td> nA׳<sup>CF3</sup> 0 ΗΝ'^Ν<sup>ί</sup>^'Ν'^<sup>/Χ</sup>Ν'^Χ 11 <sup>H</sup> l O :</td><td> J</td><td> 29</td><td> 8.61 (s, 1H), 8.00 (s, 1H), 7.03 (d, J = 8.1 Hz, 1H), 6.88 (m, 1H), 6.80 (d, J = 2.4 Hz, 1H), 6.71 (dd, J = 2.4 and 8.7 Hz, 1H), 4.08 (s, 2H), 3.73 (m, 2H), 3.34 (m, 2H), 3.19 (brs, 4H), 3.10 (brs, 6H), 2.92 (m, 1H), 2.35 (m, 2H), 1.90 (s, 2H), 1.76 (m, 2H), 1.56 (m, 2H), 1.10 (d, J = 6.9 Hz, 6H), 1.03 (t, J = 7.1 Hz, 3H).</td><td> 564.6</td>
<td> 61</td><td> 0 Λ A X HN N N N \ A <sup>H</sup> I <sup>0</sup> A A N 1</td><td> I</td><td> 9</td><td><sup>1</sup>H NMR (400 MHz, DMSO-d6 at HT): 7.74 (brs, 1H), 7.44 (s, 1H), 7.32 (d, J = 8.6 Hz, 1H), 6.78 (m, 2H), 6.74 (dd, J = 2.4, 8.6 Hz, 1H), 4.11 (s, 2H), 3.75 (t, J = 5.6 Hz, 2H), 3.42 (m, 2H), 3.35 (m, 4H), 3.16 (m, 4H), 2.65 (m, 4H), 2.54 (m, 2H), 2.37 (s, 3H), 1.82 (m, 2H), 1.72 (m, 2H), 1.45 (m, 1H), 1.11 (t, J = 7.4 Hz, 3H), 0.82 (m, 2H), 0.46 (m, 2H).</td><td> 508.3</td>
<td> 62</td><td> nA<sup>CF3</sup> 0 . ην<sup>λ</sup>Ήν<sup>ζχ/</sup>''ν<sup>?</sup>1 γ ״ 0 H</td><td> J&K</td><td> 72</td><td> 8.58 (s, 1H), 8.04 (s, 1H), 7.25 (s, 1H), 6.94 (s, 1H), 6.72 (d, J = 9.0 Hz, 1H), 6.43 (s, 1H), 4.08 (s, 3H), 3.74 (m, 2H), 3.16 (d, 3H), 3.03 (m, 4H), 2.88 (s, 4H), 1.90-1.95 (m, 1H), 1.76 (s, 2H), 1.60 (s, 2H), 0.80 (m, 2H), 0.56 (m, 2H).</td><td> 534.2</td>
<td> 63</td><td> nA׳<sup>CF3</sup> 0 Η N NN'''X 1 <sup>H</sup> 1 <sup>c</sup> A ל1 \</td><td> J, K& L</td><td> 23</td><td> 8.20 (s, 1H), 8.01 (s, 1H), 7.06 (d, J = 8.4 Hz, 1H), 6.60 (m, 1H), 6.52 (m, 2H), 4.09 (s, 2H), 3.74 (t, J = 5.5 Hz, 2H), 3.49 (m, 2H), 3.44 (m, 2H), 3.38 (m, 2H), 3.24 (m, 4H), 2.64 (m, 2H), 2.54 (m, 2H), 2.28 (s, 3H), 1.90 (m, 4H), 1.80 (m, 2H), 1.64</td><td> 550.4</td>
<td></td><td></td><td></td><td></td><td> (q, J = 6.4 Hz, 2H), 1.09 (t, J = 7.5 Hz, 3H).</td><td></td>
<td> 64</td><td> 0 ϊ H 10 X% ל: N 1</td><td> J</td><td> 33</td><td> 8.74 (s, 1H), 8.07 (s, 1H), 7.19(d, J = 14.2 Hz, 1H), 7.01 (s, 1H), 6.82 (d, J = 9.8 Hz, 1H), 4.08 (s, 2H), 3.73 (s, 2H), 3.20-3.42 (m, 7 H), 3.00 (s, 4H), 2.51-2.5 (m, 4H), 2.26 (brs, 3H), 1.76 (brs, 2H), 1.61 (brs, 2H), 1.05 (t, J = 7.8 Hz, 3H).</td><td> 554.2</td>
<td> 65</td><td><sub>Ν</sub>׳׳' Α + <sub>0</sub> J J L HN N N'^'^N \ X <sup>H 0 </sup>0</td><td> J</td><td> 30</td><td> 8.61 (brs, 1H), 8.15 (s, 1H, FA), 8.03 (brs, 1H), 7.16 (brm, 1H), 6.92(brm, 1H), 6.77 (s, 1H), 6.72 (m, 1H), 3.57-3.63 (m, 4H), 3.323.40 (m, 3H), 3.17-3.28 (m, 3H), 3.08 (m, 4H), 2.572.65 (m, 2H), 2.42-2.52 (m, 4H), 2.23 (s, 3H), 2.13 (s, 3H), 1.55 (brm, 2H).</td><td> 522.4</td>
<td> 66</td><td><sub>Ν|Ύ</sub>- I Ή ΆN ^Λ״<sup>,</sup> Η N A 0 1</td><td> J</td><td> 42</td><td> 8.62 (s, 1H), 8.02 (s, 1H), 7.11 (brs, 1H), 6.92 (m, 1H), 6.77 (m, 1H), 6.73 (d, J = 8.6 Hz, 1H), 3.60 (brs, 4H), 3.20 (brs, 4H), 3.09 (brs, 5H), 2.60 (brs, 3H), 2.36 (brs, 6H), 2.21 (s, 3H), 1.54 (m, 2H), 1.05 (t, J = 7.4 Hz, 3H).</td><td> 536.2</td>
<td> 67</td><td><sub>N</sub>^Yp<sup>CF</sup>3 0 1 ל Λ HN N N'^^'N \ <sup>H</sup> k / Y<sup>n</sup> ל: N 1</td><td> J</td><td> 10</td><td> 10.8 (brs, 1H), 9.12 (s, 1H), 8.14 (s, 1H), 8.09 (s, 1H), 7.30 (brs, 1H), 6.86 (s, 1H), 4.36 (m, 2H), 3.63 (m, 4H), 3.50 (m, 4H), 3.40 (m, 2H), 3.24 (m, 4H), 3.08 (brs, 2H), 2.82 (s, 3H), 2.60 (m, 4H), 1.62 (m, 2H), 1.14 (t, J = 7.5 Hz, 3H).</td><td> 537.6</td>
<td> 68</td><td> 0 ΗΝ''' Ν<sup>־:</sup>' ν''' '<sup>Χ</sup> /%Α <sup>Η 1</sup>Υ τ 0 Ν 1</td><td> J</td><td> 48</td><td> 8.59 (s, 1 Η), 7.99 (s, 1Η), 7.07 (brs, 1Η), 6.94 (s, 1H), 6.64 (brs, 2H), 2.62-3.28 (m, 12H), 1.95-2.38 (s, 8H), 1.50-1.80 (m, 9H), 1.04 (t, J = 7.5 Hz, 3H).</td><td> 546.4</td>
<td> 69</td><td> A J A ΗΝ Ν Ν 0 7 Η II ψι ύ Ν 1</td><td> J</td><td> 41</td><td> 11.0 (brs, 1H), 10.10 (brs, 1H), 8.36 (brs, 1H), 7.30 (brd, J = 16.6 Hz, 1H), 6.83 (t, J = 10.0 Hz, 2H), 3.924.19 (m, 4H), 3.70 (brd, 2H), 3.05-3.54 (brm, 7 H), 2.72 (d, J = 4.8 Hz, 3H), 2.56 (brs, 2H), 2.16-2.21 (m, 3H), 1.64-1.93 (brm, 6H), 1.10 (t, J = 7.5 Hz, 3H).</td><td> 548.3</td>
<td> 70</td><td> λΎ 1 λ ΗΝ Ν Ν^^^Ν \ ' . :</td><td> J</td><td> 18</td><td> 11.2 (brs, 1H), 10.3 (brs, 1H), 8.52 (brs, 1H), 7.31 (brm, 1H), 6.88 (d, J = 8.8 Hz, 1H), 6.56 (s, 1H), 3.783.87 (m, 2H), 3.0-3.7 (m, 16H), 2.78 (s, 3H), 2.552.64 (m, 2H), 1.88-1.97 (m, 1H), 1.5-1.7 (m, 2H), 0.90 (m, 2H), 0.70 (m, 2H).</td><td> 548.4</td>
<td> 71</td><td> ο 1 J JL ״ ΗΝ Ν \ <sup>0</sup> ״ γ<sup></sup>0</td><td> J</td><td> 56</td><td> 8.59 (s, 1H), 8.04 (s, 1H), 7.26 (d, J = 8.6 Hz, 1H), 6.92-6.93 (m, 1H), 6.72 (dd, J = 8.8, 2.6 Hz, 1H), 6.44 (s, 1H), 3.71 (t, J = 4.5 Hz, 4H), 3.56-3.64 (m, 4H), 3.32-3.39 (m, 2H), 3.173.29 (m, 4H), 3.04 (t, J = 4.5 Hz, 4H), 2.58-2.62 (m, 2H), 1.90-1.96 (m, 1H), 1.51-1.62 (m, 2H), 0.81 (m, 2H), 0.58 (m, 2H).</td><td> 535.4</td>
<td> 72</td><td> γΓ A ΗΝ Ν Ν'^<sup>/</sup>^Ν \ Α <sup>Η</sup> 0</td><td> J</td><td> 34</td><td> 8.62 (s, 1H), 8.02 (s, 1H), 7.13 (d, J = 8.5 Hz, 1H), 6.90 (t, J = 5.7 Hz, 1H), 6.78 (d, J = 2.7 Hz, 1H), 6.73 (m, 1H), 3.72 (t, J = 4.6 Hz, 4H), 3.55-3.64 (m, 4H), 3.32-3.39 (m, 2H), 3.12-3.28 (m, 4H), 3.06 (t, J</td><td> 523.4</td>
<td></td><td></td><td></td><td></td><td> = 4.6 Hz, 4Η), 2.56-2.64 (m, 2Η), 2.52 (q, J = 7.5 Hz, 2H), 1.54 (brm, 2H), 1.06 (t, J = 7.5 Hz, 3H).</td><td></td>
<td> 73</td><td> nV<sup>F3 0</sup> Λ A <sub>Λ Λ</sub> κ I HN Ν \</td><td> J</td><td> 16</td><td> 8.62 (s, 1H), 8.00 (s, 1H), 7.03 (d, J = 8.0 Hz, 1H), 6.88 (m, 1H), 6.81 (d, J = 1.8 Hz, 1H), 6.72 (d, J = 8.6 Hz, 1H), 3.60 (brs, 4H), 3.31 (s, 2H), 3.19 (brs, 5H), 3.10 (s, 6H), 2.60 (brs, 2H), 2.36 (d , J = 6.8 Hz, 4H), 1.52 (brs, 2H), 1.09 (d, J = 6.8 Hz, 6H), 1.03 (t, J = 7.5 Hz, 3H).</td><td> 564.1</td>
<td> 74</td><td> α/Γ V _ 1 <sup>Η</sup> < / χ! ° ή Ν 1</td><td> J</td><td> 51</td><td> 8.62 (s, 1H), 8.02 (s, 1H), 7.11 (brs, 1H), 6.92 (s, 1H), 6.67 (m, 2H), 3.42-3.70 (m, 7H), 2.61-3.39 (brm, 12H), 1.5-2.4 (m, 10H), 1.07 (t, J = 7.5 Hz, 3H).</td><td> 562.4</td>
<td> 75</td><td> nV<sup>0 3</sup><sup>0</sup>׳ 11 /κ κ HN Ν \ <sup>0</sup> ״ / 0 Η</td><td> J&K</td><td> 81</td><td> 10.2 (brs, 1H), 9.26 (brs, 1H), 8.42 (brs, 1H), 7.33 (brs, 1H), 6.94 (s, 1H), 6.89 (brd, J = 8.7 Hz, 1H), 3.13.7 (brm, 18H), 2.57-2.65 (brm, 2H), 2.21 (s, 3H), 1.50-1.65 (m, 2H).</td><td> 508.2</td>
<td> 76</td><td><sub>Ν</sub>-Αγ<sup>ΒΓ</sup> 0 ΐ J 1 HN Ν \ a ״ 0</td><td> I</td><td> 5</td><td> 8.10 (s, 1H), 7.81 (s, 1H), 7.13 (d, J = 8.6 Hz, 1H), 6.69-6.80 (m, 3H), 3.60 (t, J = 6.8 Hz, 4H), 3.37 (s, 3H), 3.12-3.25 (m, 8H), 2.522.61 (m, 6H), 2.27 (s, 3H), 1.57 (t, J = 7.1 Hz, 2H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 546.4</td>
<td> 77</td><td> λ I ΗΝ Ν Ν״^^Ν \ Ν 1</td><td> I</td><td> 8</td><td> 8.09 (s, 1H), 7.80 (s, 1H), 7.04 (d, J = 8.6 Hz, 1H), 6.76 (m, 2H), 6.70 (dd, J = 2.5, 8.7 Hz, 1H), 4.08 (s, 2H), 3.74 (m, 2H), 3.36 (m, 2H), 3.22 (m, 4H), 3.09 (m, 4H), 2.53 (m, 1H), 2.44 (m, 4H), 2.21 (s, 3H), 1.76 (m,</td><td> 560.5 562.5</td>
<td></td><td></td><td></td><td></td><td> 2H), 1.59 (m, 2H), 1.09 (d, J = 6.8 Hz, 6H).</td><td></td>
<td> 78</td><td> IT’ I HN N \ <sup>H 0</sup></td><td> J</td><td> 20</td><td> 9.58 (brs, 1H), 8.18 (s, 1H), 7.90 (s, 1H), 7.17 (d, J = 8.5 Hz, 1H), 6.54 (s, 1H), 6.50 (d, J = 8.5 Hz, 1H), 4.61 (s, 1H), 4.53 (s, 1H), 3.77 (d, J = 7.1 Hz, 1H), 3.69 (d, J = 7.2 Hz, 1H), 3.62 (m, 4H), 3.48 (d, J = 9.2 Hz, 1H), 3.37 (m, 4H), 3.25 (m, 2H), 3.01 (d, J = 9.2 Hz, 1H), 2.61 (m, 2H), 2.18 (s, 3H), 1.92 (m, 1H), 1.85 (m, 1H), 1.65 (m, 2H).</td><td> 521.4</td>
<td> 79</td><td> jl A 1 HN N N''''''''''''N''\ <sup>H</sup> k / A/ +° O N \</td><td> J, K& L</td><td> 14</td><td> 8.25 (s, 1H), 8.01 (s, 1H), 7.11 (d, J = 8.3 Hz, 1H), 6.57 (m, 3H), 3.62 (m, 6H), 3.47 (t, J = 6.0 Hz, 2H), 3.38 (m, 2H), 3.26 (m, 4H), 3.13 (brs, 4H), 2.65 (s, 3H), 2.61 (m, 2H), 2.53 (m, 2H), 2.10 (m, 2H), 1.61 (q, J = 6.7 Hz, 2H), 1.10(1, J = 7.4 Hz, 3H).</td><td> 550.5</td>
<td> 80</td><td> O 1 J <sub>Λ Λ</sub> A HN N \ <sup>0</sup> ״ ¢- 0 1</td><td> I</td><td> 52</td><td> 8.14 (s, 1H,FA), 8.05 (s, 1H), 7.73 (s, 1H), 7.13 (d, J = 8.6 Hz, 1H), 6.93 (t, J = 5.9 Hz, 1H), 6.75 (d, J = 2.8 Hz, 1H), 6.71 (dd, J = 8.7 and 2.8 Hz, 1H), 3.58-3.63 (m, 4H), 3.36-3.39 (m, 2H), 3.21-3.27 (m, 4H), 3.09 (m, 4H), 2.59 (m, 2H), 2.512.54 (m, 6H), 2.24 (s, 3H), 1.55-1.62 (m, 2H), 1.05 (t, J = 5.3 Hz, 3H).</td><td> 502.4</td>
<td> 81</td><td><sub>Ν</sub>׳^γ<sup>ΒΓ</sup> o A A /A <sub>Λ</sub> HN N N'N \ <sup>0</sup> ״ 0</td><td> I</td><td> 34</td><td> 8.14 (s, 1H,FA), 8.02 (s, 1H), 7.85 (s, 1H), 7.34 (d, J = 8.7 Hz, 1H), 6.83 (t, J = 5.9 Hz, 1H), 6.70 (d, J = 8.9 Hz, 1H), 6.44 (s, 1H), 3.60 (brs, 4H), 3.38 (brs, 2H), 3.26 (t, J = 7.4 Hz, 4H), 3.04-3.04 (m, 4H), 2.592.62 (m, 2H), 2.43 (brs,</td><td> 556.2</td>
<td></td><td></td><td></td><td></td><td> 4Η), 2.21 (s, 3Η), 1.89-1.93 (m, 1Η), 1.56-1.64 (m, 2H), 0.81 (m, 2H), 0.56 (m 2H).</td><td></td>
<td> 82</td><td> nV' ο 1 Λ A » ΗΝ N NνΆ :: 1</td><td> 1</td><td> 44</td><td> 8.15 (s, 1H, FA), 8.00 (s, 1H), 7.78 (s, 1H), 7.35 (d, J = 8.7 Hz, 1H), 6.99 (t, J = 5.9 Hz, 1H), 6.70 (dd, J = 8.8, 2.7 Hz, 1H), 6.44 (d, J = 2.7 Hz, 1H), 3.61 (m, 4H), 3.38 (m, 2H), 3.28 (bm, 4H), 3.04 (4H, m), 2.592.61 (m, 2H), 2.45 (t, J = 4.8 Hz, 4H), 2.22 (s, 3H), 1.92 (m, 1H), 1.59-1.65 (m, 2H), 0.81 (m, 2H), 0.55 (m, 2H).</td><td> 514.2</td>
<td> 83</td><td> Ο ΗΝ^Ν^ Ν־׳^'Ν'Α ° 0 Ν 1</td><td> I</td><td> 32</td><td> 9.65 (s, 1H), 8.36 (s, 1H), 7.34 (brs, 1H), 7.22 (d, J = 8.3 Hz, 1H), 6.95 (s, 1H), 6.90 (m, 1H), 3.87 (m, 4H), 3.61 (brs, 4H), 3.53 (m, 2H), 3.41 (brs, 2H), 3.36 (brs, 2H), 3.29 (brs, 2H), 3.14 (m, 2H), 2.94 (m, 2H), 2.88 (s, 3H), 2.61 (m, 2H), 1.65 (m, 2H), 1.49 (m, 1H), 1.10 (t, J = 7.4 Hz, 3H), 0.89 (m, 2H), 0.54 (m, 2H).</td><td> 508.3</td>
<td> 84</td><td> 0JJ Ο ΖΙ</td><td> J&K</td><td> 95</td><td> 8.59 (s, 1H), 8.01 (s, 1H), 7.10 (s, 1H), 6.90 (t, J = 5.7 Hz, 1H), 6.75 (s, 1H), 6.71 (d, J = 8.9 Hz, 1H), 3.573.64 (m, 4H), 3.32-3.41 (m, 2H), 3.10-3.27 (m, 4H), 2.99 (t, J = 4.8 Hz, 4H), 2.81 (t, J = 4.7 Hz, 4H), 2.56-2.63 (m, 2H), 2.502.54 (m, 2H), 1.54 (brs, 2H), 1.05 (t, J = 7.5 Hz, 3H) [Note: spectrum as free base, one NH missing]</td><td> 522.2</td>
<td> 85</td><td> αΎ λ <sub>Λ</sub> HN Ν Ν \ Η</td><td> J&K</td><td> 86</td><td> 10.2 (brs, 1Η), 9.29 (brs, 1Η), 8.50 (brs, 1H), 7.35 (brs, 1H), 6.86 (d, J = 8.7 Hz, 1H), 6.56 (s, 1H), 3.553.64 (m, 6H), 3.35-3.43 (m, 6H), 3.15-3.23 (m, 6H), 2.54-2.64 (m, 2H), 1.881.96 (m, 1H), 1.52-1.65 (m, 2H), 0.85-0.93 (m, 2H), 0.68 (m, 2H).</td><td> 534.2</td>
<td> 86</td><td><sup>0</sup> Λ X L HN Ν Ν'^^'Ν Λ Άχ. <sup>ν</sup>° ύ<sup>Ρ </sup>Ν 1</td><td> J</td><td> 10</td><td> 8.77 (s, 1H), 8.09 (s, 1H), 7.22 (d, J= 14.1 Hz, 1H), 7.04 (t, J = 5.8 Hz, 1H), 6.86 (d, J = 9.8 Hz, 1H), 3.63 (d, J = 8.9 Hz, 5H), 3.36-3.43 (m, 2H), 3.233.32 (m, 4H), 2.92-3.05 (brm, 4H), 2.61-2.65 (m, 4H), 2.54-2.59 (m, 2H), 2.37 (brs, 4H), 1.60(1, J = 7.3 Hz, 2H), 1.25 (s, 1H), 1.08 (t, J = 7.5 Hz, 3H).</td><td> 554.3</td>
<td> 87</td><td> ϊ X 11 0 ״ A 0</td><td> I</td><td> 26</td><td> 8.10 (s, 1H), 7.79 (s, 1H), 7.03 (d, J = 8.6 Hz, 1H), 6.78 (m, 2H), 6.69 (dd, J = 2.5, 8.6 Hz, 1H), 3.61 (brs, 4H), 3.36 (brs, 2H), 3.21 (m, 4H), 3.09 (m, 5H), 2.60 (m, 2H), 2.44 (m, 4H), 2.21 (s, 3H), 1.56 (m, 2H), 1.09 (d, J = 6.8 Hz, 6H).</td><td> 560.5 562.5</td>
<td> 88</td><td> A <sup>Η </sup>ό Ν 1</td><td> I</td><td> 10</td><td> 8.08 (s, 1H), 7.72 (s, 1H), 7.03 (d, J = 8.6 Hz, 1H), 6.92 (brs, 1H), 6.78 (d, J = 2.3 Hz, 1H), 6.69 (dd, J = 2.4 and 8.8 Hz, 1H), 3.61 (brs, 4H), 3.36 (brs, 2H), 3.23 (brs, 4H), 3.08 (brs, 5H), 2.60 (m, 2H), 2.44 (brs, 4H), 2.21 (s, 3H), 1.57 (m, 2H), 1.09 (d, J = 6.8 Hz, 6H).</td><td> 516.4</td>
<td> 89</td><td> Ν' 0 '<sup>33</sup>׳ Ϊ J 1 <sub>Λ</sub> HN Ν \ <sup>0</sup> 0 Η</td><td> Ι&Κ</td><td> 10</td><td> 9.12 (brs, 2Η), 8.67 (brs, 1Η), 7.94 (s, 1H), 7.28 (brs, 1H), 6.85(d, J = 8.8 Hz, 1H), 6.55 (s, 1H), 3.70 (m, 2H), 3.66 (m, 2H), 3.573.63 (m, 4H), 3.49 (m, 2H), 3.46 (m, 2H), 3.25-3.36 (m, 2H), 3.16-3.23 (m, 4H), 2.57-2.63 (m, 2H), 1.88 (m, 1H), 1.65 (m, 2H), 0.88 (m, 2H), 0.67 (m, 2H).</td><td> 500.2</td>
<td> 90</td><td> n^<sup>cf;</sup> 0 A X ϊ χ! <sup>Η 0</sup> 0</td><td> J</td><td> 12</td><td> 8.44 (s, 1H), 8.02 (d, J = 7.4 Hz, 2H), 6.74 (m, 1H), 6.67 (s, 1H), 3.70 (m, 4H), 3.41 (m, 4H), 3.25 (m, 4H), 3.16 (m, 2H), 2.21 (m, 2H), 2.14 (s, 3H), 1.65 (m 6H).</td><td> 494.34</td>
<td> 91</td><td> n^t<sup>CF3</sup> 0 HN ־'''''-'''''Ν ר־ A <sup>0</sup> 0 1</td><td> J</td><td> 21</td><td> 8.70 (s, 1H), 8.03 (s, 1H), 7.96 (s, 1H), 7.02 (s, 1H), 6.70 (s, 1H), 3.42 (brs, 4H), 3.15 (brs, 5H), 2.38 (brs, 4H), 2.20 (s, 5H), 2.11 (s, 3H), 1.62 (m, 7H).</td><td> 507.4</td>
<td> 92</td><td> ^Ά<sup>εΡ3 0</sup> ΗΝ'<sup>>χ</sup>Α'<sub>Ν</sub>-׳\^<sub>Ν</sub>Ά <sup>Η</sup> < <sup>7</sup> qi <sup>0</sup> Π Ν 1</td><td> Μ</td><td> 25</td><td> 8.07 (s, 1H), 7.86 (s, 1H), 7.07 (d, J = 8.5 Hz, 1H), 6.80 (s, 1H), 6.75 (m, 1H), 5.94 (brs, 1H), 5.57 (s, 1H), 3.61 (m, 4H), 3.39 (m, 2H), 3.27 (m, 2H), 3.10 (m, 4H), 2.98 (m, 2H), 2.60 (m, 2H), 2.54 (m, 2H), 2.44 (brs, 4H), 2.21 (s, 3H), 1.57 (m, 2H), 1.06 (t, J = 7.4 Hz, 3H).</td><td> 535.5</td>
<td> 93</td><td> n^<<sup>CF3</sup> 0 ΐ Λ ״ I HN Ν Ν'Α <sup>Η</sup> V <sup>-</sup>CN</td><td> J</td><td> 31</td><td> 8.05 (s, 1H), 7.09 (brs, 1H), 6.42-6.45 (m, 2H), 3.153.57 (m, 13H), 2.42-2.46 (m, 2H), 2.32-2.37 (m, 1H), 2.18-2.25 (m, 3H), 1.641.67 (s, 6H), 1.07 (t, J = 7.5 Hz, 3H).</td><td> 516.2</td>
<td> 94</td><td> . . ΖΖ ο ^z \ k°</td><td> Μ</td><td> 21</td><td> 8.12 (s, 1Η), 7.88 (s, 1Η), 7.10 (d, J = 8.6 Hz, 1H), 6.71 (dd, J = 2.4 and 8.6 Hz, 1H), 6.38 (d, J = 2.2 Hz, 1H), 5.97 (brs, 1H), 5.63 (s, 1H), 3.24 (m, 2H), 3.15 (brs, 2H), 3.07 (brs, 4H), 2.97 (m, 2H), 2.44 (brs, 4H), 2.21 (s, 3H), 2.19 (m, 2H), 1.91 (m, 1H), 1.63 (m, 6H), 0.82 (m, 2H), 0.60 (m, 2H).</td><td> 531.3</td>
<td> 95</td><td> %°־ ιζ ο t—Z. \ )=°</td><td> Μ</td><td> 18</td><td> 8.14 (s, 1H), 7.95 (s, 1H), 7.86 (s, 1H), 6.72 (s, 1H), 6.03 (brs, 1H), 5.65 (s, 1H), 3.42 (brs, 4H), 3.27 (m, 2H), 3.18 (m, 2H), 3.01 (m, 2H), 2.38 (m, 4H), 2.20 (brs, 5H), 2.09 (s, 3H), 1.68 (m, 6H).</td><td> 506.5</td>
<td> 96</td><td> n0 ^׳ <sup>0</sup> ־ ־χ 0</td><td> Μ</td><td> 11</td><td> 8.18 (s, 1H), 7.98 (s, 1H), 7.86 (s, 1H), 6.73 (s, 1H), 6.05 (brs, 1H), 5.68 (s, 1H), 3.69 (m, 4H), 3.38 (m, 4H), 3.27 (m, 2H), 3.19 (m, 2H), 3.02 (m, 2H), 2.20 (m, 2H), 2.11 (s, 3H), 1.67 (m, 6H).</td><td> 493.4</td>
<td> 98</td><td> Ο״ k <sub>Λ</sub> ΗΝ Ν \ ־.> ״ γ 0 \</td><td> I</td><td> 17</td><td> 7.98 (s, 1 H), 7.81 (s, 1H), 7.29 (d, J = 8.7 Hz, 1H), 6.78 (t, J = 5.9 Hz, 1H), 6.66 (dd, J = 8.8 and 2.8 Hz, 1H), 6.39 (d, J = 2.8 Hz, 1H), 4.04 (s, 2H), 3.68 (t, J = 5.5 Hz, 2H), 3.34 (m, 2H), 3.21(m, 4H), 3.00 (t, J = 4.8 Hz, 4H), 2.38 (t, J = 4.8 Hz, 4H), 2.15 (s, 3H), 1.84-1.9 (m, 1H), 1.70-1.73 (m, 2H), 1.59 (m, 2H), 0.75-0.79 (m, 2H), 0.49-0.52 (m, 2H).</td><td> 546.2 548.2</td>
<td> 99</td><td> % 0 ϊ J A <sub>Λ</sub> ΗΝ Ν 0 : Η</td><td> J&K</td><td> 41</td><td> 9.24 (brs, 2H), 6.85 (dd, J = 8.8 and 2.7 Hz, 1H), 6.55 (d, J = 2.7 Hz, 1H), 4.12 (brs, 2H), 3.33-3.40 (brs, 6H), 3.06-3.26 (m, 9 H), 1.89 (brs, 3H), 1.68 (brs,</td><td> 520.2</td>
<td></td><td></td><td></td><td></td><td> 2H), 0.89 (d, J = 8.0 Hz, 2H), 0.67 (m, 2H).</td><td></td>
<td> 100</td><td> 1T k HN N \ Ϊ h ( o 0 N 1</td><td> I</td><td> 34</td><td> 8.07 (s, 1H), 7.80 (s, 1H), 7.12 (d, J = 8.6 Hz, 1H), 6.68-6.77 (m, 3H), 4.07 (s, 2H), 3.72 (t, J = 5.5 Hz, 2H), 3.37(m, 2H), 3.24(m, 4H), 3.07 (t, J = 4.8 Hz, 4H), 2.52 (m, 2H), 2.43 (t, J = 4.8 Hz, 4H), 2.20 (s, 3H), 1.75 (t, J = 5.6 Hz, 2H), 1.60 (m, 2H), 1.03 (t, J = 6.4 Hz, 3H).</td><td> 546.2 548.2</td>
<td> 101</td><td> n^<<sup>cf</sup>0 ־ 0 ־ ל] N 1</td><td> j</td><td> 26</td><td> 8.15 (s, 1H), 7.88 (s, 1H), 7.10 (d, J = 8.4 Hz, 1H), 6.71 (d, J = 7.4 Hz, 1H), 6.38 (s, 1H), 5.95 (brs, 1H), 5.62 (s, 1H), 3.60 (brs, 4H), 3.39 (m, 2H), 3.27 (m, 2H), 3.03 (m, 6H), 2.60 (m, 2H), 2.43 (m, 4H), 2.21 (s, 3H), 1.91 (m, 1H), 1.58 (m, 2H), 0.82 (m, 2H), 0.62 (m, 2H).</td><td> 547.6</td>
<td> 102</td><td> n-V<sup>cf</sup>0 ־ Λ 1 <sub>Λ Λ</sub> A ....ל ό N 1</td><td> M</td><td> 23</td><td> 8.77 (s, 1H), 7.97 (s, 1H), 7.39 (d, J = 8.8 Hz, 2H), 6.86 (d, J = 8.9 Hz, 2H), 5.95 (m, 2H), 4.15 (m, 2H), 3.25 (m, 4H), 3.13 (m, 2H), 3.06 (m, 4H), 2.54 (m, 4H), 2.27 (s, 3H), 1.92 (m, 2H), 1.76 (m, 2H).</td><td> 493.4</td>
<td> 103</td><td> n^<sup>CF3</sup> o <sup>0</sup> ל 0 1</td><td> M</td><td> 12</td><td> 8.74 (s, 1H), 7.96 (s, 1H), 7.37 (d, J = 8.9 Hz, 2H), 6.86 (d, J = 8.9 Hz, 2H), 6.06 (m, 1H), 5.93 (s, 1H), 3.30 (m, 2H), 3.22 (m, 2H), 3.05 (m, 6H), 2.44 (m, 4H), 2.22 (m, 5H), 1.70 (m, 6H).</td><td> 491.4</td>
<td> 104</td><td> NJ O</td><td> M</td><td> 5</td><td> 7.67 (s, 1H), 7.64 (s, 1H), 7.16 (d, J = 8.6 Hz, 1H), 6.69 (dd, J = 2.4, 8.6 Hz, 1H), 6.38 (d, J = 2.3 Hz, 1H), 5.93 (m, 1H), 5.72 (s, 1H), 3.61 (brs, 4H), 3.41 (brs, 2H), 3.31 (m, 2H),</td><td> 513.5</td>
<td></td><td></td><td></td><td></td><td> 3.05 (brs, 4Η), 2.98 (m, 2Η), 2.60 (m, 2H), 2.43 (brs, 4H), 2.20 (s, 3H), 1.92 (m, 1H), 1.62 (m, 2H), 0.82 (m, 2H), 0.59 (m, 2H).</td><td></td>
<td> 105</td><td> n־^Y<sup>CF3</sup> 0 Λ Λ JA ΗΝ Ν Ν'^^'Ν \ Α <sup>ν</sup>° ></td><td> J</td><td> 45</td><td> 8.59 (s, 1H), 8.01 (s, 1H), 7.10 (s, 1H), 6.89 (t, J = 5.7 Hz, 1H), 6.78 (d, J = 2.8 Hz, 1H), 6.73 (dd, J = 8.7 and 2.8 Hz, 1H), 3.73 (d, J = 11.0 Hz, 1H), 3.53-3.62 (m, 5 H), 3.34-3.45 (brm, 2H), 3.03-3.29 (brm, 6H), 2.662.71 (m, 1H), 2.57-2.62 (m, 2H), 2.51-2.53 (m, 2H), 2.35 (t, J = 10.6 Hz, 1H), 2.21 (td, J= 11.1 and 3.2 Hz, 1H), 2.00-2.07 (m, 2H), 1.78-1.83 (m, 1H), 1.601.73 (m, 2H), 1.54 (brs, 2H), 1.30-1.40 (m, 1H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 562.4</td>
<td> 106</td><td> nV<sup>CF3</sup> 0 υι ι ΗΝ Ν Ν^^Ή Ο 11 η ץ</td><td> J</td><td> 41</td><td> 8.60 (s, 1H), 8.01 (s, 1H), 7.10 (d, 1H), 6.86 (t, 1H), 6.78 (d, J = 2.8 Hz, 1H), 6.74 (dd, J = 8.7 and 2.8 Hz, 1H), 4.12 (t, J = 5.2 Hz, 2H), 3.73 (d, J = 11.0 Hz, 1H), 3.58 (d, J = 11.6 Hz, 1H), 2.99-3.27 (m, 8H), 2.68 (dt, J = 11.6 and 3.2 Hz, 1H), 2.51-2.53 (m, 2H), 2.33-2.37 (m, 1H), 2.20 (td, J = 11.1 and 3.2Hz, 1H), 1.99-2.07 (m, 2H), 1.751.88 (m, 3H), 1.61-1.73 (m, 4H), 1.30-1.40 (m, 1H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 548.4</td>
<td> 107</td><td> AT λ A “ <sup>0</sup> A</td><td> J</td><td> 40</td><td> 8.58 (s, 1H), 8.04 (s, 1H), 7.25 (s, 1H), 6.94 (s, 1H), 6.74 (d, J = 8.7 Hz, 1H), 6.45 (s, 1H), 3.57-3.68 (m, 5 H), 3.35 (brs, 2H), 3.193.26 (m, 4H), 3.08 (brs, 1H), 2.59 (m, 2H), 1.911.94 (m, 1H), 1.57-1.90 (m,</td><td> 574.3</td>
<td></td><td></td><td></td><td></td><td> 2H), 0.81 (m, 2H), 0.59 (m, 2H).</td><td></td>
<td> 108</td><td> ν'- <sup>0</sup> hn'' n<sup>־־</sup>' / N-N \</td><td> J</td><td> 27</td><td> 8.77 (s, 1H), 8.08 (s, 1H), 8.06 (s, 1H), 7.80 (s, 1H), 7.41 (d, J = 7.6 Hz, 2H), 7.34 (d, J = 8.0 Hz, 1H), 7.05 (m, 1H), 3.85 (s, 3H), 3.23 (m, 4H), 3.12 (brs, 2H), 2.22 (s, 3H), 2.18 (m, 2H), 1.64 (m, 6H).</td><td> 488.3</td>
<td> 109</td><td> n' A 0 ! J L HN N N'^<sup>/</sup>^N \ \</td><td> J</td><td> 35</td><td> 8.76 (s, 1H), 8.08 (s, 1H), 7.58 (d, J = 6.7 Hz, 2H), 7.51 (d, J = 7.0 Hz, 2H), 7.40 (d, J = 8.3 Hz, 1H), 6.99 (t, J = 5.7 Hz, 1H), 3.66 (s, 3H), 3.54- 3.63 (m, 5H), 3.46-3.47 (m, 1H), 3.19-3.28 (m, 4H), 2.572.63 (m, 2H), 2.22 (s, 3H), 1.60 (m, 2H).</td><td> 504.4</td>
<td> 110</td><td> Xj δ zi</td><td> M</td><td> 24</td><td> 8.76 (brs, 1H), 7.97 (brs, 1H), 7.39 (d, J = 8.8 Hz, 2H), 6.87 (d, J = 8.8 Hz, 2H), 6.00 (brs, 1H), 5.93 (s, 1H), 3.62 (brs, 4H), 3.46 (brs, 2H), 3.35 (m, 2H), 3.09(t, J = 6.8 Hz, 6H), 2.63 (m, 2H), 2.55 (brs, 4H), 2.29 (brs, 3H), 1.67 (t, J = 6.4 Hz, 2H).</td><td> 507.3</td>
<td> 111</td><td> nV<sup>Fs</sup> 0 Il A Χφ “ <sup>u</sup> ל; N 1</td><td> J</td><td> 28</td><td> 8.62 (s, 1H), 8.02 (s, 1H), 7.05 (d, J = 8.08 Hz, 1H), 6.86 (brs, 1H), 6.81 (d, J = 2.4 Hz, 1H), 6.73 (d, J =2.4, 1H), 4.12 (t, J = 4.7 Hz, 2H), 3.10 (brs, 15H), 2.25 (s, 3H), 1.88 (brs, 4H), 1.61 (brs, 2H),1.54(m, 6H).</td><td> 562.3</td>
<td> 112</td><td> 1ΎΑ x A “ <sup>0 </sup>0</td><td> J</td><td> 16</td><td> 8.59 (brs, 1H), 8.01 (brs, 1H), 7.06 (d, J = 8.4 Hz, 1H), 6.89 (m, 1H), 6.79 (brs, 1H), 6.73 (dd, J = 8.8 Hz & 2.32 Hz, 1H), 3.60 (m, 4H), 3.16 (m, 4H), 3.08 (m, 4H), 3.01 (M, 3h), 2.59 (t, J = 6.8 Hz, 2H), 2.44 (m,</td><td> 576.3</td>
<td></td><td></td><td></td><td></td><td> 4H), 2.21 (s, 3H), 1.88 (t, J = 8.8 Hz, 2H), 1.73 (m, 2H), 1.52 (m, 6H).</td><td></td>
<td> 113</td><td> ν+Β<sup>3</sup> 0 X <sup>ΰ </sup>0</td><td> J</td><td> 21</td><td> 8.61 (s, 1H), 8.01 (s, 1H), 7.06 (d, J = 7.6 Hz, 1H), 6.95 (t, J = 5.4 Hz, 1H), 6.79 (s, 1H), 6.73 (d, J = 8.6 Hz, 1H), 3.00 (brs, 13H), 2.24 (s, 3H), 2.18 (brs, 2H), 1.88 (brs, 2H), 1.69 (m, 6H), 1.51 (m, 8H).</td><td> 560.4</td>
<td> 114</td><td> nV<sup>CF3</sup> 0 Ϊ J χ HN N 0 Q ^N׳^O 1</td><td> J</td><td> 16</td><td> 8.65 (brs, 1H), 8.02 (brs, 1H), 7.14 (d, J = 8.0 Hz, 1H), 6.88 (m, 1H), 6.76 (dd, J = 8.8 and 2.4 Hz, 2H), 4.12 (t, J = 5.2 Hz, 2H), 3.72 (s, 2H), 3.42 (dd, J = 9.6 Hz & 4.4 Hz, 4H), 3.25 (m, 5H), 3.14 (brs, 2H), 2.89 (s, 2H), 2.55 (d, J = 7.6 Hz, 2H), 1.88 (t, J = 5.2 Hz, 2H), 1.63 (brs, 2H), 1.08 (m, 3H).</td><td> 536.2</td>
<td> 115</td><td> IT<sup>3</sup> A HN N \ 1 <sup>H</sup> A <sup>v</sup>° Λ <sup>k</sup>N<sup>A</sup>O</td><td> J</td><td> 9</td><td> 8.65 (brs, 1H), 8.03 (brs, 1H), 7.15 (d, J = 7.2 Hz, 1H), 6.92 (m, 1H), 6.81 (s, 1H), 6.76 (dd, J= 11.2 and 2.4 Hz, 1H), 3.73 (s, 2H), 3.60 (m, 4H), 3.43 (m, 4H), 3.32 (m, 2H), 3.22 (brs, 4H), 2.90 (s, 3H), 2.59 (brs, 2H), 2.53 (brs, 2H), 1.56 (brs, 2H), 1.08 (t, J = 7.5 Hz, 3H).</td><td> 550.3</td>
<td> 116</td><td> XT<sup>3</sup> A A <sup>0</sup> N FT 1</td><td> J</td><td> 54</td><td> 8.52 (s, 1H), 8.02 (s, 1H), 7.10 (brs, 1H), 6.89 (s, 1H), 6.36 (dd, J = 8.6 and 2.6 Hz, 1H), 6.03 (s, 1H), 4.26 (s, 1H), 3.59 (t, J =11.8 Hz, 4H), 3.34-3.35 (m, 3H), 3.15-3.26 (brs, 4 H), 3.10 (d, J = 9.1 Hz, 1H), 2.77 (d, J = 9.4 Hz, 1H), 2.59 (s, 2H), 2.27 (s, 3H), 1.86-1.92 (m, 2H), 1.75 (s, 1H), 1.55</td><td> 560.4</td>
<td></td><td></td><td></td><td></td><td> (brs, 2H), 0.79 (m, 2H), 0.55 (m, 2H).</td><td></td>
<td> 117</td><td> ג ״ HN N N O k ״ <sup>m</sup> N JA 1</td><td> J</td><td> 48</td><td> 8.54 (s, 1H), 8.02 (s, 1H), 7.12 (brs, 1H), 6.86 (s, 1H), 6.38 (d, J = 8.6 Hz, 1H), 6.04 (s, 1H), 4.29 (s, 1H), 4.12 (t, J = 5.3 Hz, 2H), 3.09-3.28 (m, 6H), 2.80 (s, 1H), 2.32 (brs, 3H), 1.90 (m, 4H), 1.78 (brs, 1H), 1.64 (brs, 2H), 0.80 (m, 2H), 0.55 (m, 2H).</td><td> 546.2</td>
<td> 118</td><td> 'z^k'7~ / Vk ZZ CD Z</td><td> I</td><td> 14</td><td> 8.01 (t, J = 1.0 Hz, 1H), 7.82 (s, 1H), 7.19 (d, J = 8.5 Hz, 1H), 6.82 (t, J = 6.0 Hz, 1H), 6.19 (m, 1H), 5.92 (d, J = 2.6 Hz, 1H), 3.84 (t, J = 7.0 Hz, 2H), 3.44 (t, J = 6.5 Hz, 2H), 3.22 (t, J = 7.0 Hz, 3H), 3.13 (m, 3H), 2.19 (t, J = 6.1 Hz, 2H), 2.07 (s, 6H), 1.90 (m, 1H), 1.61-1.68 (m, 6H), 0.80 (m, 2H), 0.53 (m, 2H).</td><td> 542.2 544.4</td>
<td> 119</td><td> aT<sup>3</sup> k HN N \ k <sup>v</sup>° N 4A 1</td><td> J</td><td> 19</td><td> 8.53 (s, 1H), 8.00 (s, 1H), 7.01 (brs, 1H), 6.87 (s, 1H), 6.37-6.39 (m, 2H), 4.27 (s, 1H), 3.60 (brs, 5H), 3.43 (brs, 4H), 3.13-3.24 (brm, 4H), 2.78 (brs, 1H), 2.592.62 (m, 3H), 2.15-2.47 (m, 5H), 1.53-1.88 (brm, 4H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 548.4</td>
<td> 120</td><td> n^A<sup>F3</sup> 0 ר A λ HN N N^^'N 0 1 <sup>H</sup> ί 1 Up N AT 1</td><td> J</td><td> 12</td><td> 8.53 (s, 1H), 8.00 (s, 1H), 7.01 (s, 1H), 6.83-6.87 (m, 1H), 6.37-6.39 (m, 2H), 4.26 (s, 1H), 4.09-4.15 (m, 2H), 3.36-3.48 (brm, 2H), 3.12-3.27 (m, 6H), 2.78 (s, 1H), 2.45-2.47 (m, 3H), 2.28 (brs, 3H), 1.61-1.88 (brm, 7H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 534.2</td>
<td> 121</td><td> A b zi Έ ץ Y</td><td> J</td><td> 40</td><td> 8.60 (s, IH), 8.01 (s, IH), 7.10 (s, IH), 6.86 (s, IH), 6.78 (d, J = 2.7 Hz, IH), 6.74 (dd, J = 8.8 and 2.8 Hz, IH), 4.12 (t, J = 5.2 Hz, 2H), 3.73 (d, J = 11.0 Hz, IH), 3.58 (d, J = 11.6 Hz, IH), 3.23 (brs, 3 H), 2.973.17 (br m, 6H), 2.63-2.71 (m, IH), 2.50-2.53 (m, 2H), 2.35 (t, J = 10.6 Hz, IH), 2.21 (t, J= 11.1 Hz, IH), 2.02-2.08 (m, 2H), 1.851.91 (m, 2H), 1.77-1.85 (m, IH), 1.56-1.75 (m, 4H), 1.31-1.39 (m, IH), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 548.2</td>
<td> 122</td><td> N׳' O X X + HN N \ <sup>H</sup> k / <sup>0</sup> A</td><td> J</td><td> 29</td><td> 8.59 (s, IH), 8.01 (s, IH), 7.10 (s, IH), 6.90(1, J = 5.7 Hz, IH), 6.78 (d, J = 2.8 Hz, IH), 6.74 (dd, J = 8.7 and 2.8 Hz, IH), 3.73 (d, J = 11.0 Hz, IH), 3.54-3.64 (m, 5 H), 3.32-3.37 (m, 2 H), 3.13-3.27 (m, 4H), 2.983.04 (m, 2H), 2.68 (d, J = 11.6 Hz, IH), 2.56-2.63 (m, 2H), 2.49-2.55 (m, 2H), 2.35 (t, J = 10.6 Hz, IH), 2.21 (t, J= 11.1Hz, IH), 2.02-2.07 (m, 2H), 1.791.85 (m, IH), 1.65-1.73 (m, 2H), 1.54 (brs, 2H), 1.321.40 (m, IH), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 562.2</td>
<td> 123</td><td> XX X HN N 0 ό N 1</td><td> J</td><td> 17</td><td> 8.52 (s, IH), 8.00 (s, IH), 7.00 (brs, IH), 6.83 (s, IH), 6.37 (m, 2H), 4.23 (s, IH), 4.11 (s, 2H), 3.31-3.40 (m, 2H), 2.91-3.29 (m, 8H), 2.74 (d, J = 9.3 Hz, IH), 2.45 (m, 2H), 2.23 (s, 3H), 1.80-1.93 (m, 3H), 1.73 (d, J = 9.3 Hz, IH), 1.43-1.70 (brm, 2H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 534.2</td>
<td> 124</td><td> ΠΥ A HN N N N \ zaA <sup>״</sup> k / A לש N 1</td><td> J</td><td> 23</td><td> 8.52 (s, 1H), 8.00 (s, 1H), 7.01 (brs, 1H), 6.87 (s, 1H), 6.37-6.39 (m, 2H), 4.25 (s, 1H), 3.60 (brs, 4H), 3.333.51 (m, 3H), 2.99-3.27 (m, 5H), 2.73-2.80 (m, 1H), 2.51-2.64 (m, 3H), 2.43 (m, 2H), 2.26 (s, 3H), 1.81-1.90 (m, 1H), 1.75 (d, J = 9.4 Hz, 1H), 1.52 (brs, 2H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 548.2</td>
<td> 125</td><td> AT A <sub>Λ</sub> HN N N'^'^N \ A ״ <sup>Q</sup> 0 1</td><td> J</td><td> 57</td><td> 8.51 (s, 1H), 8.05 (d, J = 16.2 Hz, 1H), 7.10 (brs, 1H), 6.89 (s, 1H), 6.36 (dd, J = 8.6 and 2.6 Hz, 1H), 6.02 (d, J = 2.6 Hz, 1H), 4.23 (s, 1H), 3.60 (d, J = 12.3 Hz, 4H), 3.35 (brs, 3H), 3.15-3.29 (m, 5H), 3.08 (m, 1H), 2.73 (d, J = 9.3 Hz, 1H), 2.58 (m, 2H), 2.44 (d, J= 10.1 Hz, 1H), 2.22 (s, 3H), 1.86-1.93 (m, 1H), 1.82 (d,J = 9.2 Hz, 1H), 1.71 (d, J = 9.2 Hz, 1H), 1.55 (brs, 2H), 0.79 (m, 2H), 0.54 (m, 2H).</td><td> 560.4</td>
<td> 126</td><td><sup>N</sup>|A<sup>CF3</sup> ° A “ <sup>0</sup> ל /<sup>,</sup>A</td><td> J</td><td> 14</td><td> 8.55 (s, 1H), 8.02 (s, 1H), 7.12 (s, 1H), 6.95(1, J = 5.8 Hz, 1H), 6.21 (dd, J = 8.5 and 2.5 Hz, 1H), 5.91 (d, J = 2.5 Hz, 1H), 3.85 (t, J = 7.0 Hz, 2H), 3.45 (t, J = 6.5 Hz, 2H), 3.13 (m, 4 H), 2.19 (m, 2H), 2.07 (s, 6H), 1.90 (m, 1H), 1.67 (m,4H), 0.80 (t, J = 8.1 Hz, 2H), 0.54 (m, 2H).</td><td> 531.4</td>
<td> 127</td><td> nA<sup>3</sup> 0 A J 1 -^A <sup>H</sup> < / ון^ך 0 לש N 1</td><td> J</td><td> 7</td><td> 8.49 (s, 1H), 8.07 (s, 1H), 7.45 (d, J = 9.0 Hz, 1H), 7.02 (t, J = 5.4 Hz, 1H), 6.92 (d, J = 2.5 Hz, 1H), 6.87 (dd, J = 2.5 and 8.80 Hz, 1H), 4.39 (s, 2H), 3.62 (m, 4H), 3.37 (s, 2H), 3.32 (m, 3H), 3.27 (s, 2H), 3.09 (m, 4H), 2.61 (m, 2H), 2.49</td><td> 552.3</td>
3&#1512;\
<td></td><td></td><td></td><td></td><td> (m, 4H), 2.24 (s, 3H), 1.91 (s, 2H), 1.59 (m, 2H).</td><td></td>
<td> 128</td><td> n-V<sup>CF3</sup> 0 1 A <sub>Λ</sub> A HN N N N O f Η Γ 1 Α,ν ל: N 1</td><td> J</td><td> 16</td><td> 8.71 (brs, 1H), 8.10 (brs, 1H), 7.93 (brs, 1H), 6.93 (brs, 1H), 6.69 (s, 1H), 4.13 (m, 2H), 3.46 (m, 4H), 3.16 (m, 6H), 2.54 (m, 2H), 2.44 (m, 4H), 2.26 (brs, 3H), 1.89 (m, 2H), 1.57 (m, 2H), 1.07 (t, J = 7.5 Hz, 3H).</td><td> 523.3</td>
<td> 129</td><td> XT x HN N N^׳׳־^N \ Αφ <sup>Vo</sup> A N 1</td><td> J</td><td> 45</td><td> 8.77 (s, 1H), 8.09 (s, 1H), 7.22 (d, J = 14.1Hz, 1H), 7.04 (t, J = 5.8 Hz, 1H), 6.86 (d, J = 9.8 Hz, 1H), 3.63 (d, J = 8.9 Hz, 5H), 3.40 (m, 2H), 3.23-3.32 (m, 4H), 2.92-3.05 (brm, 4H), 2.63 (m, 4H), 2.57 (m, 2H), 2.37 (brs, 4H), 1.60(1, J = 7.3 Hz, 2H), 1.25 (s, 1H), 1.08 (t, J = 7.5 Hz, 3H).</td><td> 493.3</td>
<td> 130</td><td> AT<sup>3</sup> I ״ HN N N^^N^ <sup>0</sup> ״ A<sup></sup>0</td><td> J</td><td> 27</td><td> 8.52 (s, 1H), 8.03 (s, 1H), 7.13 (brm, 1H), 6.96 (brm, 1H), 6.58 (d, J = 8.7 Hz, 1H), 6.27 (s, 1H), 4.16 (s, 2H), 3.05-3.27 (m, 7H), 2.42 (m, 2H), 2.21 (m, 4H), 2.04 (s, 3H), 1.82 (m, 4H), 1.59-1.66 (m, 7H), 0.79 (m, 2H), 0.55 (m, 2H).</td><td> 558.4</td>
<td> 131</td><td> כס -ΑΆα ״a TZ o ־A</td><td> J</td><td> 30</td><td> 8.64 (s, 1H), 8.06 (s, 1H), 7.34 (d, J = 8.8 Hz, 1H), 7.13 (d, J = 2.7 Hz, 1H), 7.00 (t, J = 5.8 Hz, 1H), 6.94 (dd, J = 2.8 and 8.9 Hz, 1H), 3.60-3.62 (m, 4H), 3.37 (m, 2H) 3.15-3.29 (m, 4H), 3.12(1, J = 4.8 Hz, 4H), 2.60 (m, 2H), 2.42 (1, J = 4.8 Hz, 4H), 2.20 (s, 3H), 1.56 (s, 2H).</td><td> 586.2 588.2</td>
<td> 132</td><td> °Λ> Q ZI A Q</td><td> J</td><td> 44</td><td> 8.68 (s, 1H), 8.06 (s, 1H), 7.38 (d, J = 8.8 Hz, 1H), 7.01 (1, J = 5.9 Hz, 1H), 6.98 (d, J = 2.8 Hz, 1H), 6.90 (dd, J = 2.8 and 8.9 Hz, 1H), 3.61 (m, 4H), 3.38 (s,</td><td> 542.2</td>
<td></td><td></td><td></td><td></td><td> 2H), 3.14-3.25 (m, 8H), 2.60 (m, 2H), 2.45 (brs, 4H), 2.23 (s, 3H), 1.57 (t, J = 7.4Hz, 2H).</td><td></td>
<td> 133</td><td> 1Y<sup>F3</sup> λ <sub>Λ</sub> ΗΝ Ν Ν״^^Ν \ <sup>0</sup> ״ A<sup></sup>0</td><td> J</td><td> 29</td><td> 8.52 (s, 1H), 8.03 (s, 1H), 7.13 (s, 1H), 6.90 (s, 1H), 6.59 (d, J = 8.7 Hz, 1H), 6.27 (s, 1H), 4.17 (s, 2H), 3.60 (s, 4H), 3.36 (s, 2H), 3.22 (brm, 4H), 2.59 (s, 2H), 2.42 (d, J = 10.7 Hz, 2H), 2.24 (d, J = 10.6 Hz, 2H), 2.04 (s, 3H), 1.79-1.90 (m, 5H), 1.55 (brm, 2H), 0.79 (m, 2H), 0.54 (m, 2H).</td><td> 574.3</td>
<td> 134</td><td> 1/1 A“ “ ״% A N 1</td><td> J</td><td> 4</td><td> 9.70 (brs, 1H), 8.09 (s, 1H), 7.98 (brs, 1H), 7.1 (m, 1H), 6.83 (m, 2H), 5.8 (s, 1H), 3.63 (m, 4H),3.41 (m, 2H), 3.36 (m, 4H), 3.06 (m, 4H), 2.63 (m, 2H), 2.46 (m, 4H), 2.21 (s, 3H), 1.68 (m, 2H), 1.50 (s, 6H).</td><td> 566.3</td>
<td> 135</td><td> j J I , HN N 0 A ״ C/ 1</td><td> J</td><td> 7</td><td> 9.71 (brs, 1H), 8.09 (s, 1H), 8.00 (d, J = 5.7 Hz, 1H), 7.0 (brs, 1H), 6.85 (brs, 1H), 6.83 (s, 1H), 5.8 (s, 1H), 4.13 (t, J = 5.1 Hz, 2H), 3.37 (m, 2H), 3.23 (m, 4H), 3.06 (m, 4H), 2.44 (m, 4H), 2.21 (s, 3H), 1.89 (m, 2H), 1.76 (m, 2H), 1.50 (s, 6H).</td><td> 552.3</td>
<td> 136</td><td> 0 <sub>Λ</sub> ην'<sup>α</sup>'ν<sup><α</sup>'ν'^<sup>/</sup>^'ν<sup>?</sup> \ A “ <sup>Q</sup> N Ϋ /<sup>N</sup>\</td><td> J</td><td> 25</td><td> 8.61 (s, 1H), 8.07 (s, 1H), 7.18 (s, 1H), 6.95(1, J = 5.8 Hz, 1H), 6.27 (dd, J = 2.6 and 8.5 Hz, 1H), 5.97 (d, J = 2.6 Hz, 1H), 3.92 (t, J = 7.0 Hz, 2H), 3.65 (d, J = 10.9 Hz, 4H), 3.54 (t, J = 6.5 Hz, 2H), 3.40 (m, 2H), 3.25 (m, 5H), 2.65 (m, 2H), 2.17 (s, 6H), 1.94 (m, 1H), 1.60 (brs, 2H), 0.85 (m, 2H), 0.57 (m, 2H).</td><td> 548.4</td>
<td> 137</td><td> nr k ״ HN N N'' <sup>Z</sup>N \ k ״ <sup>Q</sup> A N \</td><td> J</td><td> 18</td><td> 8.61 (s, 1H), 8.07 (s, 1H), 7.18 (s, 1H), 6.95 (s, 1H), 6.27 (m, 1H), 5.95 (d, J = 2.6 Hz, 1H), 3.95 (t, J = 7.4 Hz, 2H), 3.66 (d, J = 9.4 Hz, 4H), 3.49 (t, J = 6.6 Hz, 2H), 3.35-3.45 (m, 7H), 2.98 (m, 2H), 2.90 (brm, 2H), 2.65 (m, 2H), 2.44 (s, 6H), 1.95 (m, 1H), 1.61 (brs, 2H), 0.85 (m, 2H), 0.58 (m, 2H).</td><td> 562.4</td>
<td> 138</td><td> A b zi A AO</td><td> J</td><td> 30</td><td> 8.54 (s, 1H), 8.01 (s, 1H), 7.02 (d, J = 8.4Hz, 1H), 6.88 (t, J = 5.8 Hz, 1H), 6.64 (d, J = 2.6 Hz, 1H), 6.59-6.63 (m, 1H), 4.18 (s, 2H), 4.07 (s, 2H), 3.73 (t, J = 5.4Hz, 2H), 3.19 (brs, 4H), 2.40-2.47 (m, 4H), 2.29 (m, 2H), 2.04 (s, 3H), 1.74-1.87 (m, 6H), 1.55 (brs, 2H), 1.04 (t, J = 7.5 Hz, 3H).</td><td> 562.4</td>
<td> 139</td><td> IT<sup>3</sup> A HN N H A-A-— np N 1</td><td> J</td><td> 50</td><td> 8.53 (s, 1H), 8.02 (s, 1H), 7.00 (d, J = 8.4 Hz, 1H), 6.87 (brm, 1H), 6.64 (s, 1H), 6.60 (d, J = 8.7 Hz, 1H), 4.18 (s, 2H), 3.21 (m, 4H), 2.92 (brs, 2H), 2.44 (m, 4H), 2.28 (m, 2H), 2.05 (m, 3H), 1.84 (m, 4H), 1.59 (brs, 2H), 1.13 (s, 6H), 1.04 (t, J = 7.5 Hz, 3H).</td><td> 546.4</td>
<td> 140</td><td> νΆ<sup>3 0</sup> M I ΗΝ^Ν^Ν-'^^Ν^Ο i η Γ 1 A ft N 1</td><td> J</td><td> 53</td><td> 8.53 (s, 1H), 8.01 (s, 1H), 7.02 (s, 1H), 6.87 (s, 1H), 6.64 (s, 1H), 6.60 (d, J = 8.8 Hz, 1H), 4.18 (s, 2H), 3.15 (m, 6H), 2.43 (m, 4H), 2.28 (m, 2H), 2.05 (s, 3H), 1.83 (m, 6H), 1.62 (brs, 2H), 1.25 (s, 6H), 1.04 (t, J = 7.5 Hz, 3H).</td><td> 576.4</td>
<td> 141</td><td> aT<sup>3</sup> HN N A <sup>4</sup> \</td><td> J</td><td> 11</td><td> 8.61 (brs, 1H), 8.02 (s, 1H), 7.08 (d, J = 8.8 Hz, 1H), 6.8 (t, J = 5.8 Hz, 1H), 6.77 (d, J = 2.5 Hz, 1H), 6.73 (dd, J = 2.7 and 8.7 Hz, 1H), 3.21 (brs, 4H), 3.10 (m, 4H), 2.91 (m, 4H), 2.44 (m, 4H),</td><td> 520.3</td>
<td></td><td></td><td></td><td></td><td> 2.21 (s, 3Η), 1.60 (brs, 2Η), 1.14 (s, 6Η), 1.05 (t, J = 7.5 Hz, 3H).</td><td></td>
<td> 142</td><td> nV<sup>CF3</sup> 0 , A Λ ΛΑ HN Ν N Ν \ Υφ <sup>0</sup> נ/ Ν 1</td><td> J</td><td> 24</td><td> 8.62 (s, 1H), 8.02 (s, 1H), 7.11 (d, J = 8.6 Hz, 1H), 6.8 (t, J = 5.9 Hz, 1H), 6.78 (d, J = 2.5 Hz, 1H), 6.73 (dd, J = 2.5 and 8.6 Hz, 1H), 3.61 (brs, 2H), 3.35 (s, 2H), 3.19 (m, 4H), 3.10 (m, 6H), 2.54 (q, 2H), 2.45 (m, 4H), 2.21 (s, 3H), 1.54 (brs, 2H), 1.06 (s, 6H), 1.06(1, J = 6.8 Hz, 3H).</td><td> 564.3</td>
<td> 143</td><td> .ΥΥ Υ ΗΝ Ν \ / ' \</td><td> J</td><td> 24</td><td> 8.73 (s, 1H), 8.04 (s, 1H), 7.27 (d, J = 8.1 Hz, 1H), 7.09 (m, 2H), 6.96 (m, 1H), 3.60 (m, 4H), 3.36 (brm, 2H), 3.1-3.2 (brm, 4H), 2.97 (t, J = 8.9 Hz, 1H), 2.73 (brm, 2H), 2.52-2.62 (m, 4H), 2.40 (m, 4H), 2.24 (m, 1H), 1.76 (m, 2H), 1.55 (s, 2H), 1.08(1, J = 7.5 Hz, 3H).</td><td> 521.2</td>
<td> 144</td><td> nV<sup>CF3</sup> 0 ΐ J A ΗΝ Ν \ Υφ <sup>0</sup> 'Ν— /</td><td> J</td><td> 18</td><td> 8.53 (brs, 1H), 7.99 (brs, 1H), 7.02 (brs, 1H), 6.86 (brm, 1H), 6.35 (m, 2H), 3.58 (m, 4H), 3.41 (m, 4H), 3.32 (m, 4H), 3.21 (m, 2H), 3.02 (1, J = 8.5 Hz, 2H), 2.78 (m, 1H), 2.57 (m, 2H), 2.21 (s, 6H), 2.14 (m, 2H), 1.80 (m,2H), 1.05(1, J = 7.5 Hz, 3H).</td><td> 550.4</td>
<td> 145</td><td> Ν0 ^<sup>0</sup>^־ Λ /1 ΖΧ /X Κ ΗΝ Ν Ν \ ζχΑ <sup>Η</sup> < / φ ° Q Ν— /</td><td> J</td><td> 26</td><td> 8.53 (brs, 1H), 7.99 (brs, 1H), 7.02 (brs, 1H), 6.86 (brm, 1H), 6.35 (m, 2H), 3.58 (m, 4H), 3.41 (m, 4H), 3.32 (m, 4H), 3.21 (m, 2H), 3.02 (1, J = 8.5 Hz, 2H), 2.78 (m, 1H), 2.57 (m, 2H), 2.21 (s, 6H), 2.14 (m, 2H), 1.80 (m,2H), 1.05(1, J = 7.5 Hz, 3H).</td><td> 550.4</td>
<td> 146</td><td> νΆ°<sup>Ρ3</sup> 0 Λ Α <sub>Λ</sub> A ΗΝ Ν Ν^^^Ν \</td><td> J</td><td> 21</td><td> 8.72 (s, 1Η), 8.04 (s, 1Η), 7.27 (d, J = 8.1 Hz, 1H), 7.07 (s, 1H), 7.02 (m, 1H), 6.96 (t, J = 5.9 Hz, 1H), 3.62 (m, 4H), 3.1-3.6 (brm, 8H), 3.00 (m, 2H), 2.532.61 (m, 4H), 2.32 (m, 3H), 2.21 (t, J = 12.2 Hz, 2H), 1.78 (m, 2H), 1.68 (m, 2H), 1.56 (m, 2H), 1.08 (t, J = 7.6 Hz, 3H).</td><td> 535.2</td>
<td> 147</td><td> nA<sup>F3</sup> 0 ϊ J A ΗΝ Ν Ν'^'^Ν Ο A <sup>Μ </sup>ϋ 1</td><td> J</td><td> 15</td><td> 8.5 (s, 1H), 8.06 (s, 1H), 7.45 (d, J = 7.8 Hz, 1H), 6.9 (m, 1H), 6.90 (s, 1H), 6.87 (dd, J = 1.6 and 8.8 Hz Hz, 1H), 5.25 (brs, 2H), 4.39 (s, 2H), 4.12 (t, J = 4.8 Hz, 2H), 3.27 (s, 3H), 3.17 (m, 4H), 3.09 (m, 4H), 2.44 (m, 4H), 2.21 (s, 3H), 1.89 (m, 2H), 1.70 (m, 2H).</td><td> 538.3</td>
<td> 148</td><td> n^V<sup>CF3</sup> ο Λ J I <sub>Λ</sub> ΗΝ Ν 0 0 1</td><td> J</td><td> 19</td><td> 8.6 (s, 1H),8.O4 (s, 1H), 7.23 (d, J = 8.3 Hz, 1H), 6.9 (t, J = 6.8 Hz, 1H), 6.72 (dd, J = 2.4 and 8.6 Hz, 1H), 6.42 (d, J = 2.4 Hz, 1H), 3.26 (brs, 2H), 3.14 (m, 4H), 3.06 (m, 4H), 2.43 (m, 4H), 2.21 (s, 3H), 1.93 (m, 1H), 1.81 (t, J = 6.2 Hz, 2H), 1.65 (m, 2H), 1.25 (s, 6H), 0.81 (m, 2H), 0.58 (m, 2H).</td><td> 562.3</td>
<td> 149</td><td> rAA X ΙΖ ο Cr°</td><td> J</td><td> 30</td><td> 8.57 (s, 1H), 8.01 (s, 1H), 7.07 (brm, 1H), 6.89 (t, J = 5.8 Hz, 1H), 6.70 (s, 1H), 6.66 (d, J = 8.8 Hz, 1H), 4.24 (brm, 2H), 3.48-3.58 (brm, 6H), 3.21 (brm, 4H), 3.03-3.24 (brm, 6H), 2.542.63 (m, 2H), 1.89 (brm, 2H), 1.62 (m, 2H), 1.51 (brm, 2H), 1.38 (s, 9H), 1.05 (t, J = 7.5 Hz, 3H).</td><td> 648.4</td>
<td> 150</td><td> Al<sup>3</sup> a ην<sup>λ</sup>ν<sup>λ</sup>ν׳^ν% .α. <sup>Η</sup> < / φι ° Ν Η</td><td> κ</td><td> 42</td><td> 10.13 (brs, 1H), 9.75 (brs, 1H), 9.22 (brs, 1H), 8.48 (brs, 1H), 7.32 (brs, 1H), 6.83 (m, 2H), 4.44 (s, 2H), 3.19-3.70 (brm, 8H), 2.933.11 (m, 4H), 2.59 (brs,</td><td> 548.3</td>
<td></td><td></td><td></td><td></td><td> 4H), 2.15 (m, 2H), 2.08 (m, 4H), 1.56-1.75 (brm, 2H), 1.13 (t, J =7.5 Hz, 3H).</td><td></td>
<td> 151</td><td> N^y<sup>CF3</sup> 0 ״ hn^n^n^nA ύ ״ A N 1</td><td> J</td><td> 20</td><td> 8.60 (s, 1H), 8.06 (s, 1H), 7.17 (brm, 1H), 7.00 (t, J = 6.0 Hz, 1H), 6.23 (m, 1H), 5.95 (d, J = 2.5 Hz, 1H), 3.94 (m, 2H), 3.47 (m 2H), 3.0-3.32 (m, 7H), 2.79 (brs, 2H), 2.37 (s, 6H), 2.25 (m, 2H), 1.94 (m, 1H), 1.72 (s, 4H), 1.64 (brs, 2H), 0.84 (m, 2H), 0.58 (m, 2H).</td><td> 546.4</td>
<td> 152</td><td> b zi A ' A /=\ /\ N</td><td> J</td><td> 40</td><td> 8.57 (s, 1H), 7.98 (m, 1H), 7.04 (d, J = 8.0 Hz, 1H), 6.88 (t, J = 8.0 Hz, 1H), 6.24 (m, 2H), 3.96 (q, J = 7.5 Hz, 2H), 3.61 (m, 4H), 3.53 (m, 2H), 3.36 (m, 2H), 3.20 (m, 4H), 3.10 (m, 2H), 2.61 (s, 7H), 2.49 (m, 4H), 1.54 (brs, 2H), 1.04 (m, 3H).</td><td> 550.2</td>
<td> 153</td><td> A A A φ <sup>H 0</sup> 0 1</td><td> J</td><td> 34</td><td> 9.36 (s, 1H), 8.11 (s, 1H), 7.54 (d, J = 8.7 Hz, 2H), 7.06 (brs, 1H), 6.87 (d, J = 8.8 Hz, 2H), 3.61 (m, 4H), 3.33-3.42 (m, 6 H), 3.04 (t, J = 4.8 Hz, 4H), 2.61-2.63 (m, 2H), 2.43 (t, J = 4.8 Hz, 4H), 2.20 (s, 3H), 1.69 (m, 2H).</td><td> 508.4</td>
Example 130. Biochemical assay for ULK1.2 (SEQ. ID NO: 1)
[000258] Activity of ULK1 kinase was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysisdependent oxidation of NADH (e.g., Schindler et al. Science (2000) 289: 1938-1942). Assays were conducted in 384-well plates (100 uL final volume) using 19 nM ULK1 (Eurofins CAT# 14-959), 0.25 mg/mL myelin basic protein, 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCE, 0.5 mM DTT, 0.1 % octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100). Inhibition of ULK1 was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored continuously for 6 hours at 30 °C on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 2-3 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e. reaction with no test compound and reaction with a known inhibitor) and IC50 values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software).
ULK1 protein sequence (residues 1-314 with N-terminal His tag; SEQ. ID NO: 1)
MSYYHHHHHHDYDIPTTENLYFQGAMDPFFMEPGRGGTETVGKFEFSRKDLIGHGA FAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQE MANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDL KPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQ HYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIPRETSAPLRQL LLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGSGSSSSSSSTSHLA S
Example 131. Biochemical assay for ULK1.3 (SEQ. ID NO: 2)
[000259] Activity of ULK1 kinase was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysisdependent oxidation of NADH (e.g., Schindler et al. Science (2000) 289: 1938-1942). Assays were conducted in 384-well plates (100 uL final volume) using 0.1 nM ULK1 (from Beryllium), 0.075 mM peptide substrate (YANWLAASIYLDGKKK (SEQ ID NO: 5)), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgC12, 0.5 mM DTT, 0.004% (w/v) BSA, and 0.004% Triton X-100). Inhibition of ULK1 was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored continuously for 6 hours at 30 °C on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 2-3 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e. reaction with no test compound and reaction with a known inhibitor) and IC50 values were calculated using software routines in Prism (GraphPad software).
ULK1 protein sequence (residues 1-283; SEQ. ID NO: 2)
MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHRAAHDLEVAVKCINKKNLAKS QTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSE DTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARY LQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQ DLRLFYEKNKTLVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPS
Example 132. Biochemical assay for ULK2 (SEQ. ID NO: 3)
[000260] Activity of ULK2 kinase was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysisdependent oxidation of NADH (e.g., Schindler et al. Science (2000) 289: 1938-1942). Assays were conducted in 384-well plates (100 uL final volume) using 9.7 nM ULK2 (Eurofins CAT# 14-772), 0.25 mg/mL myelin basic protein, 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgC12, 0.5 mM DTT, 0.1 % octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100). Inhibition of ULK2 was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored continuously for 6 hours at 30 °C on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 2-3 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e.
reaction with no test compound and reaction with a known inhibitor) and IC50 values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software).
ULK2 protein sequence (residues 1-306 with N-terminal GST and His tag; SEQ. ID NO: 3)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPY YIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDF ETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCL DAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQG PEFMEVVGDFEYSKRDLVGHG AFA VVFRGRHRQKTDWEV AIKS INKKNLSKSQILL GKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRV FLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNM MAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMF YEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQGPVKKSCPVP VPMYSGSVSGSSCGSSPSCRFASHHHHHH
Table 1. Inhibition of biochemical activity of ULK1 and ULK2 kinases by exemplary compounds shown in Table I.
<td> Example (Compound) Number</td><td> ULK1.2</td><td> ULK1.3</td><td> ULK2.2</td>
<td> 1</td><td> + + + +</td><td></td><td></td>
<td> 2</td><td> + + +</td><td></td><td></td>
<td> 3</td><td> + + +</td><td></td><td></td>
<td> 4</td><td> + +</td><td></td><td> + + +</td>
<td> 5</td><td> + + + +</td><td></td><td></td>
<td> 6</td><td> + + + +</td><td></td><td></td>
<td> 7</td><td> + +</td><td></td><td> + + +</td>
<td> 8</td><td> + +</td><td></td><td> + + +</td>
<td> 9</td><td> +</td><td></td><td> +</td>
<td> 10</td><td> +</td><td></td><td> +</td>
<td> 11</td><td> +</td><td></td><td> +</td>
<td> 12</td><td> +</td><td></td><td> +</td>
<td> 13</td><td> +</td><td></td><td> +</td>
<td> 14</td><td> +</td><td> +</td><td> +</td>
<td> 15</td><td></td><td> + +</td><td></td>
<td> 16</td><td> +</td><td></td><td></td>
<td> 17</td><td> +</td><td></td><td></td>
<td> 18</td><td> + + +</td><td></td><td> + +</td>
<td> 19</td><td> +</td><td></td><td> + +</td>
<td> 20</td><td> +</td><td></td><td> + +</td>
<td> 21</td><td> +</td><td></td><td> +</td>
<td> 22</td><td> +</td><td></td><td> + + +</td>
<td> 23</td><td> + +</td><td></td><td> + + +</td>
<td> 24</td><td></td><td> +</td><td></td>
<td> 26</td><td></td><td> +</td><td></td>
<td> 27</td><td></td><td> + +</td><td></td>
<td> 28</td><td></td><td> +</td><td></td>
<td> 29</td><td></td><td> + + +</td><td></td>
<td> 30</td><td></td><td> + +</td><td></td>
<td> 31</td><td></td><td> +</td><td></td>
<td> 32</td><td></td><td> + +</td><td></td>
<td> 33</td><td></td><td> +</td><td></td>
<td> 34</td><td></td><td> +</td><td></td>
<td> 35</td><td></td><td> + +</td><td></td>
<td> 36</td><td></td><td> + +</td><td></td>
<td> 37</td><td></td><td> +</td><td></td>
<td> 38</td><td></td><td> +</td><td></td>
<td> 39</td><td> +</td><td> +</td><td> + +</td>
<td> 40</td><td></td><td> +</td><td></td>
<td> 41</td><td></td><td> +</td><td> + +</td>
<td> 42</td><td></td><td> +</td><td></td>
<td> 43</td><td></td><td> + +</td><td></td>
<td> 44</td><td></td><td> +</td><td></td>
<td> 45</td><td></td><td> + + +</td><td></td>
<td> 46</td><td></td><td> +</td><td> + +</td>
<td> 47</td><td></td><td> + +</td><td></td>
<td> 48</td><td></td><td> + + +</td><td></td>
<td> 49</td><td></td><td> + + +</td><td></td>
<td> 50</td><td> + + +</td><td></td><td> + + + +</td>
<td> 51</td><td> + + +</td><td></td><td> + + + +</td>
<td> 52</td><td> +</td><td> +</td><td> + +</td>
<td> 53</td><td></td><td> + +</td><td></td>
<td> 54</td><td> +</td><td></td><td> + +</td>
<td> 55</td><td> + + +</td><td></td><td> + + +</td>
<td> 56</td><td></td><td> + +</td><td></td>
<td> 57</td><td> + + + +</td><td></td><td> + + + +</td>
<td> 58</td><td> + + +</td><td></td><td> + + + +</td>
<td> 59</td><td> + + + +</td><td></td><td> + + + +</td>
<td> 60</td><td> +</td><td></td><td></td>
<td> 61</td><td></td><td> + + + +</td><td></td>
<td> 62</td><td></td><td> +</td><td></td>
<td> 63</td><td></td><td> + +</td><td></td>
<td> 64</td><td></td><td> + + +</td><td></td>
<td> 65</td><td> +</td><td></td><td> + +</td>
<td> 66</td><td> +</td><td> +</td><td> + +</td>
<td> 67</td><td></td><td> +</td><td></td>
<td> 68</td><td></td><td> +</td><td></td>
<td> 69</td><td></td><td> +</td><td></td>
<td> 70</td><td> +</td><td> +</td><td> + +</td>
<td> 71</td><td> +</td><td></td><td> + + + +</td>
<td> 72</td><td> + +</td><td></td><td> + + + +</td>
<td> 73</td><td> +</td><td></td><td> + + +</td>
<td> 74</td><td></td><td> +</td><td> +</td>
<td> 75</td><td></td><td> +</td><td></td>
<td> 76</td><td> +</td><td> +</td><td></td>
<td> 77</td><td></td><td> + +</td><td></td>
<td> 78</td><td></td><td> + + +</td><td></td>
<td> 79</td><td></td><td> +</td><td></td>
<td> 80</td><td></td><td> + +</td><td></td>
<td> 81</td><td></td><td> +</td><td></td>
<td> 82</td><td></td><td> + +</td><td></td>
<td> 83</td><td></td><td> + + + +</td><td></td>
<td> 84</td><td></td><td> +</td><td> + +</td>
<td> 85</td><td></td><td> +</td><td></td>
<td> 86</td><td></td><td> + +</td><td></td>
<td> 87</td><td></td><td> + +</td><td></td>
<td> 88</td><td></td><td> + +</td><td></td>
<td> 89</td><td></td><td> + + +</td><td></td>
<td> 90</td><td> + + + +</td><td></td><td> + + + +</td>
<td> 91</td><td> + +</td><td> + +</td><td> + + +</td>
<td> 92</td><td></td><td> +</td><td></td>
<td> 93</td><td></td><td> + + +</td><td></td>
<td> 94</td><td></td><td> + +</td><td></td>
<td> 95</td><td> + + +</td><td></td><td> + + + +</td>
<td> 96</td><td> + + + +</td><td></td><td> + + + +</td>
<td> 97</td><td></td><td> + + +</td><td></td>
<td> 98</td><td></td><td> + +</td><td></td>
<td> 99</td><td></td><td> +</td><td> + +</td>
<td> 100</td><td></td><td> + +</td><td></td>
<td> 101</td><td></td><td> +</td><td></td>
<td> 102</td><td></td><td> +</td><td></td>
<td> 103</td><td></td><td> +</td><td></td>
<td> 104</td><td></td><td> + + +</td><td></td>
<td> 105</td><td></td><td> +</td><td></td>
<td> 106</td><td></td><td> +</td><td></td>
<td> 107</td><td></td><td> +</td><td></td>
<td> 108</td><td> + + + +</td><td></td><td> + + + +</td>
<td> 109</td><td> + + + +</td><td></td><td> + + + +</td>
<td> 110</td><td></td><td> +</td><td></td>
<td> 111</td><td></td><td> +</td><td></td>
<td> 112</td><td></td><td> +</td><td></td>
<td> 113</td><td></td><td> +</td><td></td>
<td> 114</td><td></td><td> + +</td><td></td>
<td> 115</td><td></td><td> + + +</td><td></td>
<td> 116</td><td></td><td> + +</td><td></td>
<td> 117</td><td></td><td> + +</td><td></td>
<td> 118</td><td></td><td> + +</td><td></td>
<td> 119</td><td></td><td> +</td><td></td>
<td> 120</td><td></td><td> +</td><td></td>
<td> 121</td><td></td><td> +</td><td></td>
<td> 122</td><td></td><td> +</td><td></td>
<td> 123</td><td></td><td> +</td><td></td>
<td> 124</td><td></td><td> +</td><td></td>
<td> 125</td><td></td><td> +</td><td></td>
<td> 126</td><td></td><td> +</td><td></td>
<td> 127</td><td></td><td> +</td><td></td>
<td> 128</td><td></td><td> +</td><td></td>
<td> 129</td><td></td><td> + +</td><td></td>
<td> 130</td><td></td><td> + +</td><td></td>
<td> 131</td><td></td><td> +</td><td></td>
<td> 132</td><td></td><td> +</td><td></td>
<td> 133</td><td></td><td> + + +</td><td></td>
<td> 134</td><td></td><td> + + + +</td><td></td>
<td> 135</td><td></td><td> + + +</td><td></td>
<td> 136</td><td></td><td> +</td><td></td>
<td> 137</td><td></td><td> +</td><td></td>
<td> 138</td><td></td><td> + + +</td><td></td>
<td> 139</td><td></td><td> + + + +</td><td></td>
<td> 140</td><td></td><td> + + +</td><td></td>
<td> 141</td><td></td><td> + +</td><td></td>
<td> 142</td><td></td><td> +</td><td></td>
<td> 143</td><td></td><td> +</td><td></td>
<td> 144</td><td></td><td> +</td><td></td>
<td> 145</td><td></td><td> +</td><td></td>
<td> 146</td><td></td><td> + +</td><td></td>
<td> 147</td><td></td><td> +</td><td></td>
<td> 148</td><td></td><td> +</td><td></td>
<td> 150</td><td></td><td> +</td><td></td>
<td> 151</td><td></td><td> +</td><td></td>
<td> 152</td><td></td><td> +</td><td></td>
[000261] For Table 1, “+” refers to an IC50 greater than 1 nM and less than or equal to 25 nM; “+ +” refers to an IC50 greater than 25 nM and less than or equal to 100 nM; “+ + +” refers to an IC50 greater than 100 nM and less than or equal to 500 nM; and “+ + + +” refers to an IC50 greater than 500 nM.
Example 133. Cellular inhibition of ULK kinase substrate ATG13 protein pATG13 levels of mutant KRas A549 cells after treatment with ULK inhibitors in combination with Trametinib.
[000262] A549 (KRAS mutant) human lung cancer cells (6,000 cells/well) were added to a 384-well tissue-culture treated plate in 50 pL of pre-warmed DMEM medium supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 100 units/mL penicillin G, and 100 pg/mL streptomycin and allowed to grow overnight at 37 °C, 5% CO2, and 95% humidity. The following day, 10 pL of media containing trametinib or
DMSO as a control was added to wells. The final concentration of trametinib in wells was 250 nM. A dose response of a test compound (0.6 pL per well) was added. DMSO (0.6 pL) was added to control wells. The plate was briefly shaken to mix wells and then incubated at 37 °C overnight. The next day, the media was aspirated and cells were washed with Dulbecco’s Phosphate Buffered Saline (Gibco). Cells were lysed using MPER lysis buffer (Pierce, Rockford, IL) containing Halt Phosphatase and Protease Inhibitors (Pierce, Rockford, IL) and Phosphatase inhibitor cocktail 2 (Sigma, St. Louis, MO) at 4 °C for 10 minutes with shaking.
[000263] Cellular levels of phospho-Serine 318 ATG13 (pATG13) were measured via an ELISA method. Total ATG13 Antibody (Cell Signaling Cat#13273) was used to coat the wells. The plate was incubated at 4 °C overnight and washed with ELISA wash buffer (Biolegend Cat#421601). The wells were then blocked with assay diluent (Biolegend Cat#421203) for 1 hour at room temperature. Plate wells were washed with ELISA wash buffer. Cell lysate was added to wells and incubated at room temperature for 2 hours. Plate wells were washed with ELISA wash buffer. Biotinylated pS318-ATG13 antibody (Rockland Immunochemicals Cat#600 C49) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. Streptavidin linked to horseradish peroxidase (Thermo Fisher Cat#21140) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. High sensitivity TMB substrate (Biolegend Cat#421101) was added to each well and incubated at room temperature for 20 minutes. The reaction was stopped with 2N Sulfuric Acid. The plate was analyzed at on a plate reader measuring absorbance at 450 nm and 540 nm (background). Signal was calculated by first subtracting the background absorbance at 540 nm from the absorbance at 450 nm for each well. Next, the background corrected absorbance at 450 nm from blank wells was subtracted from test wells. Data was compared to control wells to determine % ATG13 phosphorylation. GraphPad Prism was used to calculate IC50 values.
Example 134. pATG13 levels of mutant KRas MiaPaCa-2 cells after treatment with ULK inhibitors in combination with Trametinib.
[000264] MiaPaCa-2 human pancreatic cancer cells (10000 cells/well) were added to a 384-well tissue-culture treated plate in 50 pL of pre-warmed DMEM medium supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 100 units/mL penicillin G, 100 pg/mL streptomycin, and 2.5% Horse Serum and allowed to grow overnight at 37 °C, 5% C02, and 95% humidity. The following day, 10 pL of media containing trametinib or DMSO as a control was added to wells. The final concentration of trametinib in wells was 250 nM. A dose response of a test compound (0.6 pL per well) was added. DMSO (0.6 pL) was added to control wells. The plate was briefly shaken to mix wells and then incubated at 37 °C overnight. The next day, the media was aspirated and cells were washed with Dulbecco’s Phosphate Buffered Saline (Gibco). Cells were lysed using MPER lysis buffer (Pierce, Rockford, IL) containing Halt Phosphatase and Protease Inhibitors (Pierce, Rockford, IL) and Phosphatase inhibitor cocktail 2 (Sigma, St. Louis, MO) at 4 °C for 10 minutes with shaking.
[000265] Cellular levels of phospho-Serine 318 ATG13 (pATG13) were measured via an ELISA method. Total ATG13 Antibody (Cell Signaling Cat#13273) was used to coat the wells. The plate was incubated at 4 °C overnight and washed with ELISA wash buffer (Biolegend Cat#421601). The wells were then blocked with assay diluent (Biolegend Cat#421203) for 1 hour at room temperature. Plate wells were washed with ELISA wash buffer. Cell lysate was added to wells and incubated at room temperature for 2 hours. Plate wells were washed with ELISA wash buffer. Biotinylated pS318-ATG13 antibody (Rockland Immunochemicals Cat#600 C49) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. Streptavidin linked to horseradish peroxidase (Thermo Fisher Cat#21140) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. High sensitivity TMB substrate (Biolegend Cat#421101) was added to each well and incubated at room temperature for 20 minutes. The reaction was stopped with 2N Sulfuric Acid. The plate was analyzed at on a plate reader measuring absorbance at 450 nm and 540 nm (background). Signal was calculated by first subtracting the background absorbance at 540 nm from the absorbance at 450 nm for each well. Next, the background corrected absorbance at 450 nm from blank wells was subtracted from test wells. Data was compared to control wells to determine % ATG13 phosphorylation. GraphPad Prism was used to calculate IC50 values.
Example 135. pATG13 levels of mutant KRas HCT-116 cells after treatment with ULK inhibitors in combination with Trametinib.
[000266] HCT-116 human colon cancer cells (10000 cells/well) were added to a 384well tissue-culture treated plate in 50 pL of pre-warmed DMEM medium supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 100 units/mL penicillin G, and 100 pg/mL streptomycin and allowed to grow overnight at 37 °C, 5% CO2, and 95% humidity. The following day, 10 pL of media containing trametinib or DMSO as a control was added to wells. The final concentration of trametinib in wells was 250 nM. A dose response of a test compound (0.6 pL per well) was added. DMSO (0.6 pL) was added to control wells. The plate was briefly shaken to mix wells and then incubated at 37 °C overnight. The next day, the media was aspirated and cells were washed with Dulbecco’s Phosphate Buffered Saline (Gibco). Cells were lysed using MPER lysis buffer (Pierce, Rockford, IL) containing Halt Phosphatase and Protease Inhibitors (Pierce, Rockford, IL) and Phosphatase inhibitor cocktail 2 (Sigma, St. Louis, MO) at 4 °C for 10 minutes with shaking. [000267] Cellular levels of phospho-Serine 318 ATG13 (pATG13) were measured via an ELISA method. Total ATG13 Antibody (Cell Signaling Cat#13273) was used to coat the wells. The plate was incubated at 4 °C overnight and washed with ELISA wash buffer (Biolegend Cat#421601). The wells were then blocked with assay diluent (Biolegend Cat#421203) for 1 hour at room temperature. Plate wells were washed with ELISA wash buffer. Cell lysate was added to wells and incubated at room temperature for 2 hours. Plate wells were washed with ELISA wash buffer. Biotinylated pS318-ATG13 antibody (Rockland Immunochemicals Cat#600 C49) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. Streptavidin linked to horseradish peroxidase (Thermo Fisher Cat#21140) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. High sensitivity TMB substrate (Biolegend Cat#421101) was added to each well and incubated at room temperature for 20 minutes. The reaction was stopped with 2N Sulfuric Acid. The plate was analyzed at on a plate reader measuring absorbance at 450 nm and 540 nm (background). Signal was calculated by first subtracting the background absorbance at 540 nm from the absorbance at 450 nm for each well. Next, the background corrected absorbance at 450 nm from blank wells was subtracted from test wells. Data was compared to control wells to determine % ATG13 phosphorylation. GraphPad Prism was used to calculate IC50 values.
Example 136. pATG13 levels of mutant BRAF A375 cells after treatment with ULK inhibitors in combination with Trametinib.
[000268] A375 human malignant melanoma cancer cells (20000 cells/well) were added to a 96-well tissue-culture treated plate in 100 pL of pre-warmed DMEM medium supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 100 units/mL penicillin G, and 100 pg/mL streptomycin and allowed to grow overnight at 37 °C, 5% CO2, and 95% humidity. The following day, 100 pL of media containing trametinib or DMSO as a control was added to wells. The final concentration of trametinib in wells was 250 nM. A dose response of a test compound (0.5 pL per well) was added. DMSO (0.5 pL) was added to control wells. The plate was briefly shaken to mix wells and then incubated at 37 °C overnight. The next day, the media was aspirated and cells were washed with Dulbecco’s Phosphate Buffered Saline (Gibco). Cells were lysed using MPER lysis buffer (Pierce, Rockford, IL) containing Halt Phosphatase and Protease Inhibitors (Pierce, Rockford, IL) and Phosphatase inhibitor cocktail 2 (Sigma, St. Louis, MO) at 4 °C for 10 minutes with shaking.
[000269] Cellular levels of phospho-Serine 318 ATG13 (pATG13) were measured via an ELISA method. Total ATG13 Antibody (Cell Signaling Cat#13273) was used to coat the wells. The plate was incubated at 4 °C overnight and washed with ELISA wash buffer (Biolegend Cat#421601). The wells were then blocked with assay diluent (Biolegend Cat#421203) for 1 hour at room temperature. Plate wells were washed with ELISA wash buffer. Cell lysate was added to wells and incubated at room temperature for 2 hours. Plate wells were washed with ELISA wash buffer. Biotinylated pS318-ATG13 antibody (Rockland Immunochemicals Cat#600 C49) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. Streptavidin linked to horseradish peroxidase (Thermo Fisher Cat#21140) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. High sensitivity TMB substrate (Biolegend Cat#421101) was added to each well and incubated at room temperature for 20 minutes. The reaction was stopped with 2N Sulfuric Acid. The plate was analyzed at on a plate reader measuring absorbance at 450 nm and 540 nm (background). Signal was calculated by first subtracting the background absorbance at 540 nm from the absorbance at 450 nm for each well. Next, the background corrected absorbance at 450 nm from blank wells was subtracted from test wells. Data was compared to control wells to determine % ATG13 phosphorylation. GraphPad Prism was used to calculate IC50 values.
Example 137. pATG13 levels of mutant HRas T24 cells after treatment with ULK inhibitors in combination with Trametinib.
[000270] T24 human urinary bladder cancer cells (25000 cells/well) were added to a 96well tissue-culture treated plate in 100 pL of pre-warmed DMEM medium supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 100 units/mL penicillin G, and 100 pg/mL streptomycin and allowed to grow overnight at 37 °C, 5% CO2, and 95% humidity. The following day, 100 pL of media containing trametinib or DMSO as a control was added to wells. The final concentration of trametinib in wells was 250 nM. A dose response of a test compound (0.5 pL per well) was added. DMSO (0.5 pL) was added to control wells. The plate was briefly shaken to mix wells and then incubated at 37 °C overnight. The next day, the media was aspirated and cells were washed with Dulbecco’s Phosphate Buffered Saline (Gibco). Cells were lysed using MPER lysis buffer (Pierce, Rockford, IL) containing Halt Phosphatase and Protease Inhibitors (Pierce, Rockford, IL) and Phosphatase inhibitor cocktail 2 (Sigma, St. Louis, MO) at 4 °C for 10 minutes with shaking. [000271] Cellular levels of phospho-Serine 318 ATG13 (pATG13) were measured via an ELISA method. Total ATG13 Antibody (Cell Signaling Cat#13273) was used to coat the wells. The plate was incubated at 4 °C overnight and washed with ELISA wash buffer (Biolegend Cat#421601). The wells were then blocked with assay diluent (Biolegend Cat#421203) for 1 hour at room temperature. Plate wells were washed with ELISA wash buffer. Cell lysate was added to wells and incubated at room temperature for 2 hours. Plate wells were washed with ELISA wash buffer. Biotinylated pS318-ATG13 antibody (Rockland Immunochemicals Cat#600 C49) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. Streptavidin linked to horseradish peroxidase (Thermo Fisher Cat#21140) was diluted in assay diluent and added to each well and incubated at room temperature for 1 hour. Plate wells were washed with ELISA wash buffer. High sensitivity TMB substrate (Biolegend Cat#421101) was added to each well and incubated at room temperature for 20 minutes. The reaction was stopped with 2N Sulfuric Acid. The plate was analyzed at on a plate reader measuring absorbance at 450 nm and 540 nm (background). Signal was calculated by first subtracting the background absorbance at 540 nm from the absorbance at 450 nm for each well. Next, the background corrected absorbance at 450 nm from blank wells was subtracted from test wells. Data was compared to control wells to determine % ATG13 phosphorylation. GraphPad Prism was used to calculate IC50 values.
Table 2. Inhibition of ULK kinase in mutant Ras or mutant BRAF cell lines by exemplary compounds shown in Table I.
<td> Example (Compound) No.</td><td> A549 pATG13 ELISA</td><td> MiaPaca2pATG13 ELISA</td><td> HCT-116 pATG13 ELISA</td><td> T24 pATG13 ELISA</td><td> A375 pATG13 ELISA</td>
<td> 4</td><td> + + +</td><td> + + +</td><td></td><td></td><td></td>
<td> 7</td><td> + + + +</td><td></td><td></td><td></td><td></td>
<td> 8</td><td> + +</td><td></td><td></td><td></td><td></td>
<td> 10</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 11</td><td> + +</td><td> +</td><td> +</td><td></td><td> +</td>
<td> 12</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 13</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 14</td><td> +</td><td> +</td><td> +</td><td> +</td><td> +</td>
<td> 16</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 19</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 20</td><td> + + +</td><td> + +</td><td> + +</td><td></td><td></td>
<td> 21</td><td> + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 23</td><td> +</td><td> +</td><td> +</td><td></td><td> +</td>
<td> 26</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 27</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 28</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 30</td><td> + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 31</td><td> + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 33</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 34</td><td> +</td><td> +</td><td> +</td><td> + +</td><td></td>
<td> 35</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 36</td><td> + + + +</td><td> + + + +</td><td></td><td></td><td></td>
<td> 37</td><td> + +</td><td> +</td><td></td><td></td><td> + + +</td>
<td> 39</td><td> +</td><td> +</td><td> +</td><td> +</td><td> +</td>
<td> 40</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 41</td><td> +</td><td> +</td><td> +</td><td> +</td><td> +</td>
<td> 42</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 44</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 46</td><td> +</td><td> +</td><td> + +</td><td> + +</td><td> + +</td>
<td> 47</td><td> + +</td><td> + + +</td><td> + +</td><td></td><td> + + +</td>
<td> 50</td><td> + + + +</td><td> + + + +</td><td></td><td></td><td></td>
<td> 52</td><td> +</td><td> +</td><td> +</td><td></td><td> + +</td>
<td> 54</td><td> +</td><td> +</td><td> +</td><td></td><td></td>
<td> 55</td><td> + +</td><td> +</td><td> +</td><td></td><td> + +</td>
<td> 57</td><td> + + + +</td><td></td><td></td><td></td><td></td>
<td> 58</td><td> + +</td><td> +</td><td> +</td><td></td><td></td>
<td> 60</td><td> + +</td><td> + +</td><td> +</td><td></td><td> + + +</td>
<td> 62</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 65</td><td> +</td><td> + +</td><td></td><td></td><td></td>
<td> 66</td><td> +</td><td> +</td><td> +</td><td> +</td><td> +</td>
<td> 67</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 68</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 69</td><td> +</td><td> +</td><td> +</td><td></td><td></td>
<td> 70</td><td> +</td><td> +</td><td> +</td><td> +</td><td> +</td>
<td> 71</td><td></td><td> + + + +</td><td></td><td></td><td></td>
<td> 72</td><td></td><td> + + +</td><td></td><td></td><td></td>
<td> 73</td><td> + +</td><td> + +</td><td> +</td><td></td><td> +</td>
<td> 74</td><td> +</td><td> +</td><td> +</td><td> +</td><td></td>
<td> 75</td><td> + +</td><td> +</td><td> + +</td><td></td><td> + +</td>
<td> 76</td><td> +</td><td> +</td><td> +</td><td> +</td><td></td>
<td> 79</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 80</td><td> + + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 81</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 82</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 84</td><td> +</td><td> +</td><td> +</td><td> + +</td><td> + +</td>
<td> 85</td><td> +</td><td> +</td><td> + +</td><td></td><td> + +</td>
<td> 86</td><td> +</td><td> +</td><td> + +</td><td> + +</td><td> +</td>
<td> 87</td><td> + + +</td><td> + + +</td><td></td><td></td><td></td>
<td> 88</td><td> + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 91</td><td> + +</td><td> + + + +</td><td></td><td></td><td></td>
<td> 92</td><td> + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 99</td><td> +</td><td> + +</td><td></td><td> + +</td><td> + +</td>
<td> 100</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 101</td><td> + + +</td><td> + + + +</td><td></td><td></td><td></td>
<td> 102</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 103</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 105</td><td> +</td><td> +</td><td> +</td><td></td><td></td>
<td> 106</td><td> +</td><td> +</td><td> +</td><td></td><td></td>
<td> 107</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 109</td><td> + + + +</td><td></td><td></td><td></td><td></td>
<td> 110</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 112</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 116</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 117</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 119</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 120</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 122</td><td> + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 123</td><td> +</td><td></td><td></td><td></td><td></td>
<td> 124</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 125</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 126</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 127</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 129</td><td> + + +</td><td> + +</td><td></td><td></td><td></td>
<td> 130</td><td> + + +</td><td> + + +</td><td></td><td></td><td></td>
<td> 131</td><td> + +</td><td> + + +</td><td></td><td></td><td></td>
<td> 132</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 137</td><td> + +</td><td> +</td><td></td><td></td><td></td>
<td> 147</td><td> + +</td><td> + +</td><td></td><td></td><td></td>
<td> 148</td><td> +</td><td> +</td><td></td><td></td><td></td>
<td> 150</td><td> + +</td><td> +</td><td></td><td></td><td></td>
[000272] For Table 2, “+” refers to an IC50 greater than 10 nM and less than or equal to 100 nM; “+ +” refers to an IC50 greater than 100 nM and less than or equal to 300 nM; “+ + +” refers to an IC50 greater than 300 nM and less than or equal to 600 nM; and “+ + + +” refers to an IC50 greater than 600 nM.
Example 138. Biochemical assay for LRRK2 (SEQ. ID NO: 4)
[000273] Activity of LRRK2 kinase was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysisdependent oxidation of NADH (e.g., Schindler et al. Science (2000) 289: 1938-1942). Assays were conducted in 384-well plates (100 pL final volume) using 26.4 nM LRRK2 (Thermo Fisher), 0.1 mM peptide substrate (RLGRDKYKTLRQIRQ (SEQ ID NO: 6)), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgC12, 0.5 mM DTT, 0.004% (w/v) BSA, and 0.004% Triton X-100). Inhibition of LRRK2 was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored continuously for 6 hours at 30 °C on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 2-3 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e. reaction with no test compound and reaction with a known inhibitor) and IC50 values were calculated using software routines in Prism (GraphPad software).
LRRK2 protein sequence (residues 970-2528; SEQ. ID NO: 4)
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPY YIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDF ETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCL DAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRHNQ TSLYKKAGTMHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLEL
HQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVL DPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILN LSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNL PHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLS HNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIG CKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSAT VGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKG QAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPA IRDYHFVNATEESDALAKL
RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREN QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEG CPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDH RPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWR QGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFP GLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIP ISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNK HTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLT RTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCC RMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEF DELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCL TRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADS RILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSK QSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERN VMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPV VEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWI GTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGT QKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE
Table 3. Inhibition of LRRK2 kinase activity by exemplary compounds shown in Table I.
<td> Example (Compound) No.</td><td> LRRK2</td>
<td> 1</td><td> + + + +</td>
<td> 2</td><td> +</td>
<td> 5</td><td> + +</td>
<td> 14</td><td> +</td>
<td> 18</td><td> +</td>
<td> 33</td><td> + + +</td>
<td> 35</td><td> +</td>
<td> 37</td><td> + +</td>
<td> 39</td><td> +</td>
<td> 41</td><td> +</td>
<td> 46</td><td> + +</td>
<td> 47</td><td> + +</td>
<td> 48</td><td> + +</td>
<td> 49</td><td> + +</td>
<td> 50</td><td> +</td>
<td> 51</td><td> +</td>
<td> 52</td><td> +</td>
<td> 55</td><td> + +</td>
<td> 56</td><td> + +</td>
<td> 58</td><td> + +</td>
<td> 61</td><td> + + + +</td>
<td> 64</td><td> +</td>
<td> 66</td><td> + +</td>
<td> 68</td><td> + +</td>
<td> 69</td><td> + + +</td>
<td> 70</td><td> +</td>
<td> 74</td><td> + + +</td>
<td> 76</td><td> + +</td>
<td> 78</td><td> + +</td>
<td> 79</td><td> + +</td>
<td> 84</td><td> + +</td>
<td> 86</td><td> +</td>
<td> 87</td><td> + + +</td>
<td> 90</td><td> + + +</td>
<td> 92</td><td> + + + +</td>
<td> 93</td><td> + +</td>
<td> 99</td><td> +</td>
<td> 105</td><td> +</td>
<td> 106</td><td> + +</td>
<td> 107</td><td> + +</td>
<td> 108</td><td> +</td>
<td> 109</td><td> +</td>
<td> 111</td><td> + +</td>
<td> 112</td><td> + +</td>
<td> 113</td><td> + +</td>
<td> 114</td><td> +</td>
<td> 115</td><td> + +</td>
<td> 116</td><td> +</td>
<td> 117</td><td> +</td>
<td> 118</td><td> +</td>
<td> 119</td><td> + +</td>
<td> 120</td><td> + +</td>
<td> 122</td><td> +</td>
<td> 123</td><td> + +</td>
<td> 124</td><td> + +</td>
<td> 125</td><td> +</td>
<td> 126</td><td> +</td>
<td> 127</td><td> + + +</td>
<td> 129</td><td> + + + +</td>
<td> 131</td><td> + +</td>
<td> 132</td><td> +</td>
<td> 147</td><td> + + +</td>
<td> 148</td><td> + +</td>
[000274] For Table 3, “+” refers to an IC50 greater than 1 nM and less than or equal to 100 nM; “+ +” refers to an IC50 greater than 100 nM and less than or equal to 300 nM; “+ + +” refers to an IC50 greater than 300 nM and less than or equal to 600 nM; and “+ + + +” refers to an IC50 greater than 600 nM.
Example 139. Evaluation of ULK inhibitors in pancreatic ductal adenocarcinoma (PDAC) in vitro and in vivo
[000275] ULK inhibitors will be evaluated in PDAC flux assays, and the IC50 of the compounds in a panel of multiple PDAC cell lines, including cells derived from primary tumors of a Trp53lox/+, LSL-KrasG12D, Rosa-rtTALSL, p48Cre+) will be determined using a clonogenicity 2D assay and a 3D organoid assay, in the absence or the presence of trametinib. [000276] The inhibition of autophagic flux using flux reporters in PDAC tumors in vivo using syngeneic orthotopic models after single and multiple doses will be evaluated.
[000277] The therapeutic efficacy of ULK inhibitors in PDAC models will be evaluated by (i) assessing the tumor kinetics of PDAC subcutaneously; (ii) assessing the tumor kinetics of PDAC (KPC implanted C57 black mice) orthotopically in the pancreas in syngeneic models; (iii) assessing tumor growth kinetics in syngeneic models with ULK inhibitors and MEK inhibitors; (iv) assessing the compounds in the PDAC autochthonous model; (v) assessing histological changes in the tumor microenvironment; (vi) assessing the changes in the immune cell infiltrates in the tumors upon inhibition by ULK inhibitors; (vii) assessing the efficacy of ULK inhibitors in combination with immune checkpoint blockade.
EQUIVALENTS
[000278] While specific embodiments have been discussed, the above specification is illustrative and not restrictive. Many variations of the embodiments will become apparent to those skilled in the art upon review of this specification. The full scope of what is disclosed should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.
[000279] Unless otherwise indicated, all numbers expressing quantities of ingredients, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about.” Accordingly, unless indicated to the contrary, the numerical parameters set forth in this specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained.
Contents41
255 sheets
Sheet 1 Sheet 2 Sheet 3 Sheet 4 Sheet 5 Sheet 6 Sheet 7 Sheet 8 Sheet 9 Sheet 10 Sheet 11 Sheet 12 Sheet 13 Sheet 14 Sheet 15 Sheet 16 Sheet 17 Sheet 18 Sheet 19 Sheet 20 Sheet 21 Sheet 22 Sheet 23 Sheet 24 Sheet 25 Sheet 26 Sheet 27 Sheet 28 Sheet 29 Sheet 30 Sheet 31 Sheet 32 Sheet 33 Sheet 34 Sheet 35 Sheet 36 Sheet 37 Sheet 38 Sheet 39 Sheet 40 Sheet 41 Sheet 42 Sheet 43 Sheet 44 Sheet 45 Sheet 46 Sheet 47 Sheet 48 Sheet 49 Sheet 50 Sheet 51 Sheet 52 Sheet 53 Sheet 54 Sheet 55 Sheet 56 Sheet 57 Sheet 58 Sheet 59 Sheet 60 Sheet 61 Sheet 62 Sheet 63 Sheet 64 Sheet 65 Sheet 66 Sheet 67 Sheet 68 Sheet 69 Sheet 70 Sheet 71 Sheet 72 Sheet 73 Sheet 74 Sheet 75 Sheet 76 Sheet 77 Sheet 78 Sheet 79 Sheet 80 Sheet 81 Sheet 82 Sheet 83 Sheet 84 Sheet 85 Sheet 86 Sheet 87 Sheet 88 Sheet 89 Sheet 90 Sheet 91 Sheet 92 Sheet 93 Sheet 94 Sheet 95 Sheet 96 Sheet 97 Sheet 98 Sheet 99 Sheet 100 Sheet 101 Sheet 102 Sheet 103 Sheet 104 Sheet 105 Sheet 106 Sheet 107 Sheet 108 Sheet 109 Sheet 110 Sheet 111 Sheet 112 Sheet 113 Sheet 114 Sheet 115 Sheet 116 Sheet 117 Sheet 118 Sheet 119 Sheet 120 Sheet 121 Sheet 122 Sheet 123 Sheet 124 Sheet 125 Sheet 126 Sheet 127 Sheet 128 Sheet 129 Sheet 130 Sheet 131 Sheet 132 Sheet 133 Sheet 134 Sheet 135 Sheet 136 Sheet 137 Sheet 138 Sheet 139 Sheet 140 Sheet 141 Sheet 142 Sheet 143 Sheet 144 Sheet 145 Sheet 146 Sheet 147 Sheet 148 Sheet 149 Sheet 150 Sheet 151 Sheet 152 Sheet 153 Sheet 154 Sheet 155 Sheet 156 Sheet 157 Sheet 158 Sheet 159 Sheet 160 Sheet 161 Sheet 162 Sheet 163 Sheet 164 Sheet 165 Sheet 166 Sheet 167 Sheet 168 Sheet 169 Sheet 170 Sheet 171 Sheet 172 Sheet 173 Sheet 174 Sheet 175 Sheet 176 Sheet 177 Sheet 178 Sheet 179 Sheet 180 Sheet 181 Sheet 182 Sheet 183 Sheet 184 Sheet 185 Sheet 186 Sheet 187 Sheet 188 Sheet 189 Sheet 190 Sheet 191 Sheet 192 Sheet 193 Sheet 194 Sheet 195 Sheet 196 Sheet 197 Sheet 198 Sheet 199 Sheet 200 Sheet 201 Sheet 202 Sheet 203 Sheet 204 Sheet 205 Sheet 206 Sheet 207 Sheet 208 Sheet 209 Sheet 210 Sheet 211 Sheet 212 Sheet 213 Sheet 214 Sheet 215 Sheet 216 Sheet 217 Sheet 218 Sheet 219 Sheet 220 Sheet 221 Sheet 222 Sheet 223 Sheet 224 Sheet 225 Sheet 226 Sheet 227 Sheet 228 Sheet 229 Sheet 230 Sheet 231 Sheet 232 Sheet 233 Sheet 234 Sheet 235 Sheet 236 Sheet 237 Sheet 238 Sheet 239 Sheet 240 Sheet 241 Sheet 242 Sheet 243 Sheet 244 Sheet 245 Sheet 246 Sheet 247 Sheet 248 Sheet 249 Sheet 250 Sheet 251 Sheet 252 Sheet 253 Sheet 254 Sheet 255
56 members in 31 offices
Members56
| Document | Office | Kind | |
|---|---|---|---|
| US2020354352A1 | United States of America | A1 | |
| CA3139708A1 | Canada | A1 | |
| WO2020231806A1 | World Intellectual Property Organization (WIPO) | A1 | |
| TW202108573A | Taiwan Province of China | A | |
| AU2020275392A1 | Australia | A1 | |
| SG11202112336PA | Singapore | A | |
| IL287787AThis record | Israel | A | |
| IL287787D0 | Israel | D0 | |
| KR20220008873A | Republic of Korea | A | |
| EA202193086A1 | Eurasian Patent Organization (EAPO) | A1 | |
| CN114127057A | China | A | |
| MX2021013661A | Mexico | A | |
| EP3966207A1 | European Patent Office (EPO) | A1 | |
| MA55892A | Morocco | A | |
| MA55892A | Morocco | A | |
| CO2021016768A2 | Colombia | A2 | |
| BR112021022504A2 | Brazil | A2 | |
| PE20220597A1 | Peru | A1 | |
| JP2022531801A | Japan | A | |
| CL2021002952A1 | Chile | A1 | |
| AR122332A1 | Argentina | A1 | |
| PH12021552848A1 | Philippines | A1 | |
| US11530206B2 | United States of America | B2 | |
| US2023039712A1 | United States of America | A1 | |
| AU2020275392B2 | Australia | B2 | |
| EP3966207B1 | European Patent Office (EPO) | B1 | |
| AU2023251416A1 | Australia | A1 | |
| FI3966207T3 | Finland | T3 | |
| MA55892B1 | Morocco | B1 | |
| LT3966207T | Lithuania | T | |
| DK3966207T3 | Denmark | T3 | |
| PT3966207T | Portugal | T | |
| SI3966207T1 | Slovenia | T1 | |
| SMT202300469T1 | San Marino | T1 | |
| RS65019B1 | Serbia | B1 | |
| PL3966207T3 | Poland | T3 | |
| EP4342469A2 | European Patent Office (EPO) | A2 | |
| ES2966807T3 | Spain | T3 | |
| HRP20231730T1 | Croatia | T1 | |
| HUE065486T2 | Hungary | T2 | |
| EP4342469A3 | European Patent Office (EPO) | A3 | |
| CN114127057B | China | B | |
| US12071432B2 | United States of America | B2 | |
| CN118878519A | China | A | |
| CN118878520A | China | A | |
| CN118930524A | China | A | |
| JP7593947B2 | Japan | B2 | |
| TWI865526B | Taiwan Province of China | B | |
| JP2025028915A | Japan | A | |
| US2025084073A1 | United States of America | A1 | |
| MX2025004367A | Mexico | A | |
| AU2023251416B2 | Australia | B2 | |
| TW202540081A | Taiwan Province of China | A | |
| IL287787B1 | Israel | B1 | |
| IL324234A | Israel | A | |
| AU2025275164A1 | Australia | A1 |
Numbers
- Publication
- 287787
- Application
- 287787
Titles2
- English
- PHENYLAMINOPYRIMIDINE AMIDE AUTOPHAGY INHIBITORS AND METHODS OF USE THEREOF
- Hebrew
- פנילאמינופירימידין אמיד כמעכבי אוטופאגיה ושיטות לשימוש בהם
Classification
- CPC, 24
- C07D403/12
- C07D413/14
- C07D401/12
- C07D403/14
- A61K31/4523
- C07D401/14
- C07D471/08
- C07D487/04
- A61K45/06
- C07D487/08
- A61K31/506
- C07D491/08
- A61P35/00
- A61K31/519
- A61K2300/00
- A61K31/4184
- Y02A50/30
- A61P35/04
- A61K31/5377
- A61K31/553
- A61K31/551
- A61K31/5355
- A61K31/535
- C07D413/12
- IPC, 13
- C07D403 12
- C07D413 14
- A61K31 4184
- A61P35 00
- A61K31 4523
- A61K45 06
- C07D403 14
- C07D487 08
- A61K31 519
- C07D401 14
- C07D471 08
- C07D487 04
- A61K31 506
