Polypeptides with xylanase activity
Abstract
A polypeptide with xylanase activity and comprising an amino acid sequence, said amino acid sequence having at least an 88% identity with SEQ ID No. 1 and whose polypeptide has an amino acid substitution at position 110 with any other different amino acid residue selected from the group consisting of: asparagine (N), glutamic acid (E), tryptophan (W), alanine (A) and cysteine (C), and one or more amino acid substitutions selected from the group consisting of: 11F, 12F, 122D, 113A, 13Y, 54Q, 54W, 113D, 141Q, 175L, 122F, 34K, 99Y, 104W, 154R, 159D, 175K, 81I, 166F, 162E, 162D, 164F, 114D, 114Y, 114F, 118V, 175K, 77L, 77M, 77V, and 77Y, the position (s) being determined as the corresponding position (s) of the amino acid sequence of B. subtilis shown as SEQ ID No . 1; wherein the xylanase variant has a better bran solubilization activity, higher than that obtainable by using the corresponding wild type xylanase of SEQ ID No. 1.
Term
3.2 yearsto projected expiry
Projected expiry 23 December 2029, counted from filing; an application has no term until it is granted.
- Priority
- Filed
- Published
- Today
- Projected expiry
10 claims: 7 independent, 3 dependent
- 1ES 2 561 427 T3 REIVINDICACIONES 1. Un polipéptido con actividad de xilanasa y que comprende una secuencia de aminoácidos, teniendo dicha secuencia de aminoácidos al menos una identidad del 88% con SEQ ID No. 1 y cuyo polipéptido tiene una sustitución de aminoácidos en la posición 110 con cualquier otro resto de aminoácido diferente seleccionado a partir del grupo que consiste en:asparagina (N), ácido glutámico (E), triptófano (W), alanina (A) y cisteína (C), y una o más sustituciones de aminoácidos seleccionadas a partir del grupo que consiste en: 11F, 12F, 122D, 113A, 13Y, 54Q, 54W, 113D, 141Q, 175L, 122F, 34K, 99Y, 104W, 154R, 159D, 175K, 81I, 166F, 162E, 162D, 164F, 114D, 114Y, 114F, 118V, 175K, 77L, 77M, 77V, y 77Y, estando determinada la(s) posición(ones) como la(s) posición(ones) correspondiente(s) de la secuencia de aminoácidos de B. subtilis mostrada como SEQ ID No. 1;en donde la variante de xilanasa tiene una mejor actividad de solubilización del salvado, más alta que la que puede obtenerse mediante el uso de la correspondiente xilanasa tipo salvaje de SEQ ID No. 1.
- 2El polipéptido de acuerdo con la reivindicación 1, en donde dicho polipéptido tiene mejor actividad de xilanasa cuando se compara con SEQ ID NO:1.
- 3El polipéptido de acuerdo con las reivindicaciones 1 ó 2, en donde dicho polipéptido tiene al menos 90, 92 ó 95% de identidad con SEQ ID No. 1.
- 4El polipéptido de acuerdo con cualquiera de las reivindicaciones 1-3 que tiene un plegamiento β-enrollado.
- 5El polipéptido de acuerdo con cualquiera de las reivindicaciones 1-4, en donde la modificación de aminoácidos en la posición 110 es una sustitución en alanina.
- 6El polipéptido de acuerdo con cualquiera de las reivindicaciones 1-5 que tiene un número total de aminoácidos de menos de 250, tal como menos de 240, tal como menos de 230, tal como menos de 220, tal como menos de 210, tal como menos de 200 aminoácidos, tal como en el intervalo de 160 a 240, tal como en el intervalo de 160 a 220 aminoácidos.
- 7Un método para preparar un polipéptido de acuerdo con cualquiera de las reivindicaciones 1- 6, comprendiendo dicho método expresar una secuencia de nucleótidos que codifica a dicho polipéptido;y opcionalmente aislar y/o purificar el polipéptido después de la expresión.
- 8Una secuencia de nucleótidos que codifica un polipéptido de acuerdo con cualquiera de las reivindicaciones 1 a 6.
- 9Una composición que comprende el polipéptido de acuerdo con cualquiera de las reivindicaciones 1-6 o un polipéptido preparado de acuerdo con la reivindicación 7 o la secuencia de nucleótidos de acuerdo con la reivindicación 8 en mezcla con un componente no tóxico.
- 10El uso del polipéptido de acuerdo con cualquiera de las reivindicaciones 1-6 o un polipéptido preparado de acuerdo con la reivindicación 7 o la secuencia de nucleótidos de acuerdo con la reivindicación 8 en mezcla con un componente no tóxico o una composición de acuerdo con la reivindicación 9 en un método para modificar materiales de plantas.
Independent claims10
922 paragraphs in 117 sections, as filed
ES 2 561 427 T3
DESCRIPTION
Polypeptides with xylanase activity
Field of the invention
The present invention relates to polypeptides with xylanase activity and their uses. The present invention also relates to a method for modifying polypeptides with xylanase activity that affects, preferably increases, xylanase activity and / or the solubility of bran.
Background of the invention
For many years, endo-p-1,4-xylanases (EC 3.2.1.8) (referred to herein as xylanases) have been used to modify complex carbohydrates derived from plant cell wall materials. It is well known in the art that the functionality of different xylanases (derived from different microorganisms or plants) differs greatly. Based on structural and genetic information, xylanases have been classified in different families of Glycoside Hydrolase (GH) (Henrissat, 1991; Coutinho and Henrissat, 1999). Until recently, all known and characterized xylanases belonged to the GH10 or GH11 families. Recent studies have identified numerous other types of xylanases belonging to the GH5, GH7, GH8 and GH43 families (Coutinho and Henrissat, 1999; Collins et al., 2005). So far the GH11 family differs from all other Ghs, consisting of only the single family of xylan-specific xylanases. The structure of GH11 xylanases can be described as a β-coiled structure (see Figure 1, discussed herein).
US 6,682,923 relates to xylanase nucleic acid and protein activity.
Comprehensive studies characterizing xylanase functionality on well characterized and pure substrates have been performed (Kormelink et al., 1992). These studies show that different xylanases have different specific requirements with respect to substitution of the xylose backbone of arabinoxylan (AX). Some xylanases require three unsubstituted xylose moieties to hydrolyze the xylose backbone; others require just one or two. The reasons for these differences in specificity are thought to be due to the three-dimensional structure within the catalytic domains, which are in turn dependent on the primary structure of the xylanase, ie, the amino acid sequence. However, the translation of these amino acid sequence differences into differences in xylanase functionality has so far not yet been documented when xylanase acts in a complex medium, such as plant materials.
The xylanase substrates found in wheat (wheat flour) have traditionally been divided into two fractions: the non-water extractable AX (WU-AX) and the water extractable AX (WE-AX). The WU-AX: WE-AX ratio is approx. 70:30 in wheat flour. There have been numerous explanations why there are different fractions of AX. The older literature (D'Appolonia and MacArthur (1976) and Montgomery and Smith (1955)) describe many essential differences in the degree of substitution between WE-AX and WU-AX. The highest degree of substitution was found in WE-AX. This was used to explain why some of the AXs were removable. The high degree of substitution made the polymer soluble, compared to a lower degree of substitution, which causes hydrogen bonds between low polymers and, consequently, their precipitation.
The difference between the functionality of different xylanases has been thought to be due to differences in the specificity of the xylanase and hence its preference for the WU-AX or WE-AX substrates.
However, the more recent literature does not find the same large differences between the degree of substitution of the WE-AX and the WU-AX. Therefore, parameters other than the specificity of the xylanase substrate could be of importance. These parameters may be the preference of xylanases for WE-AX versus WU-AX, determined by means other than the classical substrate specificity. This parameter can be found described in the literature as the selectivity for the substrate.
In some applications (eg bakery) it is desirable to produce soluble high molecular weight polymers (APM) from the WU-Ax fraction. These polymers have been correlated with an increase in the volume of bread production (Rouau, 1993; Rouau et al., 1994 and Courtin et al., 1999).
In other applications it is desirable to modify both WU-AX and WE-AX, solubilize the WU-AX, making the molecular weight lower, reduce its hydrocolloid effect, produce arabinoxylan oligosaccharides, giving access to a subsequent degradation of other components of the wall cellular (such as in biscuit production, flour separation, food application, bio-ethanol production, prebiotics, etc.).
WO03 / 020923 refers to xylanase variants with altered sensitivity to xylanase inhibitors. WO 02/38746 refers to xylanase proteins with higher thermostability and alkaliphilia.
All of the above-mentioned characteristics of xylanases used in various applications are directed at the behavior of xylanases and are of great importance in achieving the needed functionality. However, the selection of xylanases with the appropriate characteristics for a certain known application or engineering of the
ES 2 561 427 T3 xylanases to achieve this often results in lower efficacy of the xylanase molecule, eg, a molecule with low catalytic activity (i.e., specific activity characterized by units of xylanase protein molecules / mg). Since these molecules are to be used in commercial applications, it is therefore of great importance to have as high a catalytic activity as possible. The improvement of this characteristic will be of more and more importance to achieve the commercial application of these enzymes in the future, due to the greater use of agricultural secondary products such as bran cereal or the use in the production of cellulosic bioethanol.
Compendium of the invention
The present invention relates to the surprising finding that it is possible - by modifying a polypeptide with xylanase activity at position 110 compared to the B. subtilis xylanase polypeptide sequence shown as SEQ ID No. 1- to increase solubilization of the bran and / or the xylanase activity of the enzyme.
Thus, it has been shown by the inventors of the present invention that it is possible to produce xylanase polypeptides with increased xylanase activity and / or bran solubilization. This will make it possible, for example, to hydrolyze the hemicellulosic fraction during processing in relation to the production of cellulosic bioethanol, or will allow the reduction in the amount of xylanase required in a number of applications such as animal feed, starch liquefaction, bakery, flour separation (wet milling), production of prebiotic agents, and paper and pulp production.
In a first aspect, the present invention relates to a polypeptide with xylanase activity and comprising an amino acid sequence, said amino acid sequence having at least 88% identity with SEQ ID No. 1, and whose polypeptide has an amino acid substitution at position 110 with any other different amino acid residue selected from the group consisting of: asparagine (N), glutamic acid (E), tryptophan (W), alanine (A) and cysteine (C), and one or more amino acid substitutions selected from the group consisting of: 11F, 12F, 122D, 113A, 13Y, 54Q, 54W, 113D, 141Q, 175L, 122F, 34K, 99Y, 104W, 154R, 159D, 175K, 811, 166F, 162E, 162D, 164F, 114D, 114Y, 114F, 118V, 175K, 77L, 77M, 77V, and 77Y, the position (s) being determined as the corresponding position (s) of the amino acid sequence of B. subtilis shown as SEQ ID No. . 1; wherein the xylanase variant has a better solubilization of the bran activity, higher than that which can be obtained by using the corresponding wild-type xylanase of SEQ ID No. 1.
In a second aspect, the present invention relates to a method for preparing a polypeptide of the invention, said method comprising expressing a nucleotide sequence encoding said polypeptide; and optionally isolating and / or purifying the polypeptide after expression.
In another aspect, the present invention relates to a nucleotide sequence encoding a polypeptide according to the invention.
In another aspect, the present invention relates to a composition comprising the polypeptide according to the invention or the nucleotide sequence according to the invention in admixture with a non-toxic component.
In another aspect, the present invention relates to the use of the polypeptide according to the invention or the nucleotide sequence according to the invention in admixture with a non-toxic component or a composition according to the invention in a method for modifying materials of plants.
Also described herein is a polypeptide with xylanase activity and comprising an amino acid sequence with at least 88% identity with SEQ ID No. 1 or with at least 75% identity with an amino acid sequence selected from of SEQ ID No. 2-22, and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the xylanase sequence of B. subtilis shown as SEQ ID No. 1 by alignment.
Also described in this document is a polypeptide with xylanase activity and comprising an amino acid sequence with at least 88% identity with SEQ ID No. 1 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
Also described in this document is a polypeptide with xylanase activity and comprising an amino acid sequence with at least 75% identity with SEQ ID No. 2 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
Also described in this document is a polypeptide with xylanase activity and comprising an amino acid sequence with at least 75% identity with SEQ ID No. 3 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
ES 2 561 427 T3
Also described herein is a method for identifying a polypeptide according to the invention, said method comprising:
(i) preparing a polypeptide with at least 88% identity with SEQ ID No. 1 or with at least 75% identity with an amino acid sequence selected from SEQ ID No. 2-22 and whose polypeptide has a amino acid modification at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment;
(ii) compare the solubilization of the bran and / or the xylanase activity of said polypeptide with the solubilization of the bran and / or the xylanase activity of the amino acid sequence selected from SEQ ID NOs: 1-22 with which they have the highest percentage of identity; and (iii) selecting the polypeptide if it has better bran solubilization and / or better xylanase activity compared to the amino acid sequence selected from SEQ ID NOs: 1-22 with which it has the highest percentage of identity.
In a further aspect, the present invention relates to a method for preparing a polypeptide according to the invention, said method comprising expressing a nucleotide sequence encoding said polypeptide; and optionally isolating and / or purifying the polypeptide after expression.
In some embodiments the polypeptide is prepared by modifying both an amino acid polypeptide sequence at position 110 and a codon encoding an amino acid residue at position 110 in a nucleotide sequence encoding an amino acid polypeptide sequence, wherein position 110 is determined with reference to the B. subtilis xylanase sequence shown as SEQ ID No. 1.
In a further aspect, the present invention relates to a nucleotide sequence encoding a polypeptide according to the invention.
Also described herein is a vector comprising the nucleotide sequence encoding a polypeptide according to the invention.
Also described herein is a cell that has been transformed with the nucleotide sequence encoding a polypeptide according to the invention or the vector comprising the nucleotide sequence encoding a polypeptide according to the invention.
Also described herein is a host organism that has been transformed with the nucleotide sequence encoding a polypeptide according to the invention or the vector comprising the nucleotide sequence encoding a polypeptide according to the invention.
In a further aspect, the present invention relates to a composition comprising the polypeptide according to the invention.
In a further aspect, the present invention relates to a composition comprising a polypeptide identified in accordance with the methods of the invention.
In a further aspect, the present invention relates to a composition comprising a polypeptide prepared according to the invention.
In a further aspect, the present invention relates to a composition comprising the nucleotide sequence encoding a polypeptide according to the invention. Also described herein is a composition comprising the vector comprising the nucleotide sequence encoding a polypeptide according to the invention.
Also described herein is a composition comprising the cell that has been transformed with the nucleotide sequence encoding a polypeptide according to the invention.
Also described herein is a composition comprising the vector comprising the nucleotide sequence encoding a polypeptide according to the invention.
Also described herein is a composition comprising the organism that has been transformed with the nucleotide sequence encoding a polypeptide according to the invention or the vector comprising the nucleotide sequence encoding a polypeptide according to the invention in admixture with a non-toxic component.
Also described herein is a mass comprising the polypeptide according to the invention or an identified polypeptide according to the invention or a polypeptide prepared according to the invention or the nucleotide sequence according to the invention or the vector according to with the invention or the cell according to
ES 2 561 427 T3 with the invention or the organism according to the invention in admixture with a non-toxic component or a composition according to the invention.
Also described herein is a bakery product comprising the polypeptide according to the invention or an identified polypeptide according to the invention or a polypeptide prepared according to the invention or the nucleotide sequence according to the invention or the vector according to the invention or the cell according to the invention or the organism according to the invention in admixture with a non-toxic component or a composition according to the invention or a mass according to the invention.
Also described herein is an animal feed comprising the polypeptide according to the invention or an identified polypeptide according to the invention or a polypeptide prepared according to the invention or the nucleotide sequence according to the invention or the vector of according to the invention or the cell according to the invention or the organism according to the invention in admixture with a non-toxic component or a composition according to the invention.
Also described herein is a cleaning composition comprising xylanase. In some embodiments, the cleaning compositions are laundry detergent compositions, while in other embodiments, the cleaning compositions are dishwasher detergents. In some other embodiments, the dishwasher detergents are automatic dishwasher detergents. In some additional embodiments, the xylanase-containing cleaning compositions further comprise one or more additional enzymes. In some embodiments, the additional enzymes are selected from hemicellulases, cellulases, peroxidases, proteases, xylanases, lipases, phospholipases, esterases, cutinases, pectinases, pectate lyases, mannanases, keratinases, reductases, oxidases, phenoloxidases, puligninases, lipoxygeninases, lipoxygeninases. , tanases, pentosanases, malanases, β-glucanases, arabinosidases, hyaluronidase, chondroitinase, laccase and amylases, or their mixtures. In some embodiments, a combination of enzymes (ie, a cocktail) finds use.
Also described in this document is a method for degrading or modifying a plant cell wall, which method comprises contacting said plant cell wall with the polypeptide according to the invention or an identified polypeptide according to the invention or a polypeptide prepared according to the invention or the nucleotide sequence according to the invention or the vector according to the invention or the cell according to the invention or the organism according to the invention in admixture with a non-toxic component or a composition according to the invention.
Also described herein is a method for processing plant materials which method comprises contacting said plant materials with the polypeptide according to any of the invention or an identified polypeptide according to the invention or a polypeptide prepared according to the invention or nucleotide sequence according to invention or vector according to invention or cell according to invention or organism according to invention in admixture with a non-toxic component or a composition according to the invention.
Also described herein is the use of the polypeptide according to the invention or an identified polypeptide according to the invention or a polypeptide prepared according to the invention or the nucleotide sequence according to the invention or the vector according to the invention or the cell according to the invention or the organism according to the invention in admixture with a non-toxic component or a composition according to the invention in a method for modifying plant materials.
Also described herein is the use of the polypeptide according to the invention or an identified polypeptide according to the invention or a polypeptide prepared according to the invention or the nucleotide sequence according to the invention or the vector according to the invention or the cell according to the invention or the organism according to the invention in admixture with a non-toxic component or a composition according to the invention in any one or more of: baking, cereal processing, starch liquefaction, production of bio-ethanol from cellulosic material, animal feed, in wood processing and in enhancing the bleaching of wood pulp.
Also described herein is a polypeptide or fragment thereof substantially as described hereinbefore with reference to Examples and drawings.
Also described herein is a method substantially as described hereinbefore with reference to Examples and drawings.
Also described herein is a composition substantially as described herein above with reference to Examples and drawings.
Use is also described herein substantially as described hereinbefore with reference to Examples and drawings.
ES 2 561 427 T3
Legends of the figures
Reference is made in this document to the following Figures.
Figure 1 shows a Bacillus subtilis (T110A) xylanase xylanase variant (T110A) (black), Trichoderma reesei xylanase xylanase variant (T120A) (dark gray) and a Thermomyces lanuginosus xylanase xylanase (T120A) variant (light gray) overlaid. . The mutated residues, T110 and T120, respectively, are highlighted.
Figure 2 shows a multiple sequence alignment of SEQ ID NO: 1-22 in the AlignX Program (part of the NTI vector package) with standard parameters for multiple alignment (penalty for inclusion of a gap: 10 og penalty for extension of a gap 0.05). The numbers to the left of the sequence represent SEQ ID NO.
Detailed description of the invention
Xylanase enzymes derived from nearly 100 different organisms, including plants, fungi, and bacteria, have been published. Xylanase enzymes are classified into several of the more than 40 families of glycosyl hydrolase enzymes. Glycosyl hydrolase enzymes, including xylanases, mannanases, amylases, β-glucanases, cellulases, and other carbohydrases, are classified based on properties such as amino acid sequence, three-dimensional structure, and catalytic site geometry (Gilkes, et al., 1991, Microbiol. Reviews 55: 303-315).
Also described herein is a polypeptide with xylanase activity and comprising at least three, such as five, six, seven, eight, nine or ten amino acid substitutions with respect to any other amino acid sequence of SEQ ID NO: 1-22 , and whose polypeptide has an amino acid substitution at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
Also described herein is a polypeptide with xylanase activity and comprising an amino acid sequence, said amino acid sequence having at least 88% identity with SEQ ID No. 1 or with at least 75% identity to an amino acid sequence selected from 2-22 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
The position of a particular amino acid within a polypeptide according to the present invention is determined by aligning the amino acid sequence of said polypeptide with SEQ ID No. 1 using the standard sequence alignment tool, such as by aligning two sequences. using the SmithWaterman algorithm, or with the CLUSTALW2 algorithms, where the sequences are said to align when the alignment score is the highest. The alignment score can be calculated according to the methods described by Wilbur, WJ and Lipman, DJ (1983) "Rapid similarity searches of nucleic acids and protein data banks". Proc. Natl. Acad. Sci. USA, 80: 726-730. Preferably, standard parameters are used in the ClustalW2 algorithm (1.82): Penalty for inclusion of a protein gap = 10.0; Penalty for protein gap extension = 0.2; Protein matrix = Gonnet; Protein / DNA ENDGAP = -1; Protein / DNA GAPDIST = 4.
Preferably a position of the particular amino acids within a polypeptide according to the present invention is determined by aligning the amino acid sequence of the polypeptide with SEQ ID No. 1 using the AlignX Program (part of the NTI vector package) with standard parameters for multiple alignment (Penalty for the inclusion of a gap: 10 og Penalty for the extension of a gap 0.05). For some embodiments in accordance with the present invention, alignment can be performed using Figure 2 as described herein.
Also described in this document is a polypeptide with xylanase activity and with an amino acid sequence with at least 88% identity with SEQ ID No. 1 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
Also described in this document is a polypeptide with xylanase activity and with at least 75% identity with SEQ ID No. 2 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
Also described in this document is a polypeptide with xylanase activity and with at least 75% identity with SEQ ID No. 3 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
ES 2 561 427 T3
Also described in this document is a polypeptide with xylanase activity and with at least 75% identity with SEQ ID No. 4 and whose polypeptide has an amino acid modification at position 110, wherein said position 110 is determined as position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
Also described herein is a polypeptide with xylanase activity and comprising an amino acid sequence with at least 75% identity with SEQ ID No. 1 and whose polypeptide has an amino acid substitution at position 110 with respect to any other different amino acid residue selected from the group consisting of: glutamic acid, tryptophan, alanine and cysteine, wherein said position 110 is determined as the position corresponding to position 110 of the B. subtilis xylanase sequence shown as SEQ ID No. 1 by alignment.
Unless otherwise stated, the term "sequence identity for amino acids," as used herein, refers to sequence identity calculated as (n<sub>re</sub>r- ndf) -100 / n<sub>re</sub>r, where n ^ is the total number of non-identical residues in the two sequences when aligned and where n<sub>re</sub>r is the number of residues in one of the sequences. Therefore, the amino acid sequence ASTDYWQNWT will have 80% sequence identity with the sequence ASTGYWQAWT (ndif = 2 and n<sub>re</sub>F<sup>=</sup>10).
In some embodiments, sequence identity is determined by standard methods, eg, Smith and Waterman, 1981, Adv. Appl. Math. 2: 482, by searching by the method of similarity of Pearson & Lipman, 1988, Proc. Natl. Acad. Sci. USA 85: 2444, using the CLUSTAL W algorithm of Thompson et al., 1994, Nucleic Acids Res 22: 467380, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group). The BLAST algorithm (Altschul et al., 1990, Mol. Biol. 215: 403-10) whose software is available from the National Center for Biotechnology Information www.ncbi.nlm.nih.gov/) can also be used. When using any of the aforementioned algorithms, the standard parameters for Window length, gap penalty, etc. are used.
The term "modification" as used herein means any chemical modification to any of the amino acids or to the amino acid sequence of the polypeptide selected from SEQ ID NO: 1-22, as well as the genetic manipulation of the DNA encoding such polypeptide. Modifications can be substitutions, deletions and / or insertions of one or more amino acids as well as replacements of one or more amino acid side chains. In some embodiments, polypeptides having xylanase activity have only amino acid substitutions relative to SEQ ID No.1-22.
It is to be understood that the modification in a given polypeptide is relative to the polypeptide selected from SEQ ID NO: 1-22 with the highest percent sequence identity to this given polypeptide.
The terminology for amino acid substitutions used in this description is as follows. The first letter represents the amino acids naturally present at a position in a particular sequence. The next number represents the position with respect to sEq ID No. 1. The second letter represents the different amino acids that replace the natural amino acids. An example is D11F / R122D / T110A, where the aspartic acid at position 11 of SEQ ID NO: 1 is replaced by a phenylalanine and the arginine at position 122 of SEQ ID NO: 1 is replaced by an aspartic acid, and the threonine at position 110 is replaced by an alanine, all three mutations being in the same polypeptide with xylanase activity.
Apart from amino acid modifications in polypeptides with xylanase activity according to the invention, polypeptides may have other amino acid modifications of a minor nature, which are conservative amino acid substitutions or insertions that do not significantly affect folding and / or folding. protein activity; small deletions, typically one to about 30 amino acids; small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue; a small linker peptide of up to about 20-25 residues; or a small extension that facilitates purification by changing the net charge or other function, such as a polo-histidine tract, an antigenic epitope, or a binding domain.
Examples of conservative substitutions are within the group of basic amino acids (arginine, lysine and histidine), acidic amino acids (glutamic acid and aspartic acid), polar amino acids (glutamine and asparagine), hydrophobic amino acids (leucine, isoleucine and valine), aromatic amino acids ( phenylalanine, tryptophan, and tyrosine) and small amino acids (glycine, alanine, serine, threonine, and methionine). Amino acid substitutions that do not generally alter specific activity are known in the art and are described, for example, in H. Neurath and RL Hill, 1979, in, The Proteins, Academic Press, New York. The most common changes are Ala for Ser, Val for lie, Asp for Glu, Thr for Ser, Ala for Gly, Ala for Thr, Ser for Asn, Ala for Val, Ser for Gly, Tyr for Phe, Ala for Pro, Lys for Arg, Asp for Asn, Leu for Ile, Leu for Val, Ala for Glu and Asp for Gly.
In addition to the 20 standard amino acids, non-standard amino acids (such as 4-hydroxyproline, 6M-methyl lysine, 2-aminoisobutyric acid, isovaline, and alpha-methyl serine) can be substituted with amino acid residues from a wild-type polypeptide. A limited number of non-conservative amino acids, amino acids that are not to be encoded by the genetic code, and non-natural amino acids can be substituted with amino acid residues. Amino acids do not
Natural ES 2 561 427 T3 have been modified after protein synthesis and / or have a chemical structure in their side chain (s) different from standard amino acids. Non-natural amino acids can be chemically synthesized, and preferably are commercially available and include pipecolic acid, thiazolidine carboxylic acid, dehydroproline, 3- and 4-methylproline, and 3,3-dimethylproline.
The term "host organism" as used herein includes any type cell that is susceptible to transformation, transfection, transduction, and the like with a nucleic acid construct or expression vector comprising a polynucleotide encoding the polypeptides of the present invention.
For present purposes, a xylanase means a protein or polypeptide with xylanase activity.
The phrase a polypeptide with xylanase activity as used herein refers to any protein or polypeptide that has activity in a xylanase assay as described herein.
Xylanase activity can be measured using any assay, employing a substrate that includes 1,4-beta-D-xylosidic endo-linkages on the xylanes. The pH and temperature used in the assay have to be adapted to the xylanase in question. Examples of suitable pH values are 4, 5, 6, 7, 8, 9, 10 or 11. Examples of suitable temperatures are 30, 35, 37, 40, 45, 50, 55, 60, 65, 70 or 80 ° C. Different types of substrates are available for the determination of xylanase activity eg Xylazyme tablets (cross-linked, stained xylan substrate, Megazyme, Bray, Ireland).
Preferably, xylanase activity is measured using the following assay.
Xylanase Assay (Endo-p-1,4-xylanase Activity)
The samples were diluted in citric acid (0.1 M) - di-sodium hydrogen phosphate (0.2 M) buffer, pH 5.0, to obtain approx. an OD590 = 0.7 in this test. Three different dilutions of the sample were pre-incubated for 5 minutes at 40 ° C. At a time = 5 minutes, 1 Xylazyme tablet (cross-linked, stained xylan substrate, Megazyme, Bray, Ireland) was added to the enzyme solution in a reaction volume of 1 ml. At time = 15 minutes the reaction was terminated by adding 10 ml of TRIS / 2% NaOH, pH 12. Controls were prepared using 1000 ml of buffer instead of enzyme solution. The reaction mixture was centrifuged (1500 xg, 10 minutes, 20 ° C) and the OD of the supernatant was measured at 590 nm. One unit of xylanase (UX) is defined as xylanase activity increasing OD590 by 0.025 per minute.
The substrate (dyed, cross-linked arabinoxylan, extracted from wheat) used in the above test is a good approximation to the corresponding substrate in commercial applications.
Enzymes can also be classified according to the NC-IUBMB Enzyme Nomenclature manual, 1992, see also ENZYME website on the internet: http://www.expasy.ch/enzyme/. ENZYME is a repository of information related to the nomenclature of enzymes. It is based primarily on the recommendations of the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUB-MB) and describes each type of enzyme characterized for which an EC (Enzyme Commission) number has been provided (Bairoch A. “The ENZIMA database ”, 2000, Nucleic Acids Res 28: 304-305). This nomenclature of IUB-MB enzymes is based on their substrate specificity and occasionally on their molecular mechanism; this classification does not reflect the structural characteristics of these enzymes.
In one aspect of the invention, xylanase is an enzyme classified as EC 3.2.1.8. The official name is endo1,4-beta-xylanase. The systematic name is 1,4-beta-D-xylan xylanhydrolase. Other names may be used, such as endo- (1-4) -beta-xylanase; (1-4) -beta-xylan 4-xylanhydrolase; endo-1,4-xylanase; xylanase; beta-1,4-xylanase; endo-1,4-xylanase; endo-beta-1,4-xylanase; endo-1,4-beta-D-xylanase; 1,4-beta-xylan xylanhydrolase; beta-xylanase; beta-1,4-xylan xylanhydrolase; endo-1,4-beta-xylanase; beta-D-xylanase. The catalyzed reaction is the endohydrolysis of 1,4-beta-D-xylosidic bonds in xylan.
Another classification of certain glucoside hydrolase enzymes, such as endoglucanase, xylanase, galactanase, mannanase, dextranase, and alpha-galactosidase, into families based on amino acid sequence similarities has been proposed some years ago. They normally fall into 90 different families: See the CAZy (ModO) website (Coutinho, PM & Henrissat, B. (1999) Carbohydrate-Active Enzymes server at: http://afmb.cnrsmrs.fr/~cazy/CAZY/index.html (corresponding publications: Coutinho, PM & Henrissat, B. (1999) Carbohydrateactive enzymes: an integrated database approach In Recent Advances in Carbohydrate Bioengineering, HJ. Gilbert, G. Davies, B. Henrissat and B. Svensson eds., The Royal Society of Chemistry, Cambridge, pp. 3-12; Coutinho, PM & Henrissat, B. (1999) The modular structure of cellulases and other carbohydrate-active enzymes: an integrated database approach. In Genetics, Biochemistry and Ecology of Cellulose Degradation, K. Ohmiya, K. Hayashi, K. Sakka, Y. Kobayashi, S. Karita and T. Kimura eds., Uni Publishers Co., Tokyo, pp. 15-23).
In one aspect of the invention, the xylanase of the invention is a xylanase of the Family 11 of Glucoside Hydroliase (GH). The expression "Family 11 of Glycoside Hydrolyase (GH)" means that the xylanase in question is or can be classified in Family 11 of GH.
ES 2 561 427 T3
It should be understood that protein similarity searches (such as ProteinBlast at, for example, http: //toolkit.tuebingen. Mpg.de/prot_blast) may not necessarily be determining whether an unknown sequence actually falls under the expression of a member of the GH11 xylanase family. The protein sequences found using a BLAST search could have relatively high identity / homology and still not be true xylanases, and furthermore, they are not GH11-owned xylanases. Alternatively, the protein sequences may have relatively low primary amino acid sequence identity and still be a member of the GH11 xylanase family. To determine if an unknown protein sequence is really a xylanase protein within the GH11 family, the evaluation will have to be made, not only in the sequence similarity, but also in the similarity of the 3D structure, since the classification within the GH families are based on 3D folding. One software that will predict the 3D folding of an unknown protein sequence is HHpred (http://toolkit.tuebingen.mpg.de/hhpred). The power of this software for the prediction of protein structure is based on the identification of homologous sequences with the known structure that is used as a model. This works so well because the structures diverge much slower than the primary sequences. Proteins in the same family can have very similar structures even when their sequences have diverged beyond recognition.
In practice, an unknown sequence can be pasted into the software (http://toolkit.tuebingen.mpg.de/hhpred) in FASTA format. Having done this, the search can be submitted. The search result will display a list of sequences with known 3D structures. To confirm that the unknown sequence is indeed a GH11 xylanase, GH11 xylanases should be on the homolog list with a probability of> 90. Not all proteins identified as homologous will be characterized as GH11 xylanases, but some will. The latter proteins are proteins with a known structure and a characterization that biochemically identifies them as xylanases. The former have not been biochemically characterized as GH11 xylanases. Several references describe this protocol, such as Soding J. (2005) "Protein homology detection by HMM-HMM comparison". Bioinformatics 21, 951-960 (doi: 10.1093 / bioinformatics / bti125) and Soding J, Biegert A, and Lupas AN. (2005) "The HHpred interactive server for protein homology detection and structure prediction". Nucleic Acids Research 33, W244-W248 (Web Server issue) (doi: 10.1093 / nar / gki40).
According to the Cazy (ModO) site, Family 11 glycoside hydrolases can be characterized as follows:
Known activities: xylanase (EC 3.2.1.8)
Mechanism: Retention
Nucleophile / Catalytic Base: Glu (experimental)
Catalytic proton donor: Glu (experimental)
State of the 3D structure: Folding: β-coiled
Clan: GH-C
As used herein, Clan C refers to groupings of families that share a common three-dimensional folding and identical catalytic machinery (see, for example, Henrissat, B. and Bairoch, A., (1996) Biochem. J., 316 , 695-696).
As used herein, Family 11 refers to a family of enzymes as set forth in Henrissat and Bairoch (1993) Biochem J., 293,781-788 (see, also, Henrissat & Davies (1997) Current Opinion in Structural Biol. 1997, &: 637-644). Common characteristics for family 11 members include high genetic homology, a size of approximately 20 kDa, and a double displacement catalytic mechanism (see Tenkanen et al., 1992; Wakarchuk et al., 1994). The structure of family 11 xylanases includes two large β-sheets made of β-chains and α-helices.
Family 11 xylanases include, but are not limited to, the following: XynA from Aspergillus niger, XynC from Aspergillus kawachii, XynA from Aspergillus tubigensis, XynA from Bacillus circulans, XynA from Bacilluspunzilus, XynA from Bacillus subtilis, XynA from Neocalliniaomystix patriciarum, XynCynces livinomystix patricidansis Xyncesynces livinomystix patriciarum, XynyncesClinces livinomystix patricidansis from Thermomonospora fusca, Xyn from Trichoderma harzianum, Xynl from Tyichoderma reesei, XynlI from Trichoderma reesei, Xyn from Trichodermaviride.
As used herein, "wild type" refers to a sequence or protein that is native or naturally occurring.
In another particular embodiment, the xylanase of the invention is derived from a bacterial xylanase, such as from a bacterium of (i) the filium of Firmicutas; (ii) the Bacilli class; (iii) the order of Bacillales; (iv) the Paenibacillaceae family; or (v) the genus of Paenibacillus; such as from a bacterium of (vi) the species of Paenibacillus pabuli, Paenibacillus polymyxa or Paenibacillus sp .; such as from (vii) strains of Paenibacillus pabuli or Paenibacillus polymyxa.
ES 2 561 427 T3
The term xylanase derivatives of a bacterial xylanase, as used hereinbefore, includes any wild-type xylanase isolated from the bacterium in question, as well as its variants or fragments that retain xylanase activity.
Also described herein is a xylanase derived from a fungal xylanase.
The above definition of derivative from (in the context of bacterial xylanases) is applicable by analogy also to fungal xylanases.
Examples of family 11 glycoside hydrolase fungal xylanases are those that can be derived from the following fungal genus: Aspergillus, Aureobasidium, Emericella, Fusarium, Gaeumannomyces, Humicola, Lentinula, Magnaporthe, Neocallimastix, Nocardiopsis, Orpincesomyces, Penicillium, Paecilium Schizophyllum, Talaromyces, Thermomyces, Trichoderma.
Fungal xylanases include yeast and filamentous fungal xylanases. In some embodiments, the xylanase is derived from a fungus of (i) Ascomycota filium; (ii) the Pezizomycotina class; (iii) the order of Eurotiomycetes; (iv) the Eurotiales sub-order; (v) the Trichocomaceae family, such as the mitosporic Trichocomaceae; or from a fungus of (vi) the genus Aspergillus; such as from (vii) Aspergillus niger strains. The definition of the aforementioned species will be understood to include both perfect and imperfect states, and other taxonomic equivalents, eg, anamorphic, regardless of the species name by which they are known. Those skilled in the art will readily recognize the identity of appropriate equivalents.
The strains of the aforementioned bacteria and fungi are readily available to the public in a number of culture collections, such as the American Type Culture Collection (ATCC), Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ), Centraalbureau Voor Schimmelcultures ( CBS) and Agricultural Research Service Patent Culture Collection, Northern Regional Research Center (NRRL).
Questions related to taxonomy can be resolved by consulting a taxonomy database, such as the NCBI Taxonomy Navigator which is available at the following website: http://www.ncbi.nlm.nih.gov/Taxonomy /taxonomyhome.html/. However, reference is preferably made to the following manuals: Dictionary of the Fungi, 9<sup>to</sup> edition, edited by Kirk, PM, PF Cannon, JC David & JA Stalpers, CAB Publishing, 2001; and Bergey's Manual of Systematic Bacteriology, Second Edition (2005).
The present invention relates to a modification or modifications of a certain amino acid position (s). This position or positions are listed with reference to the amino acid sequence of B. subtilis shown as SEQ ID No. 1. In the present invention, polypeptides with xylanase activity have a modification at least at position 110 compared to the sequence of B. subtilis shown as SEQ ID No. 1. Equivalent positions in other Family 11 xylanases can be found by aligning other Family 11 xylanases with SEQ ID No. 1 and determining which amino acids align with the specific amino acids of SEQ ID No. 1 (for example, see Example 5) . Such alignment and the use of a sequence as a first reference is merely routine matter for one of ordinary skill in the art.
In one aspect, a xylanase variant according to the invention has a better bran solubilization activity that is greater than that which can be obtained by using the corresponding wild-type xylanase, as measured in a bran solubilization assay.
In one aspect, the xylanase according to the invention has a better solubilization of bran activity as a result of the modification at position 110.
Suitably, the solubilizing activity of xylanase bran can be measured using the bran solubilization assay provided herein. Thus, polypeptides with higher xylanase activity and / or higher bran solubilizing activity can be provided. The requirement for specificity towards WU-AX is becoming more and more important, as many applications are using a high concentration of cereal bran. The bread-making industry increases the concentration of bran in many products, due to health and nutritional concerns, and the food industry incorporates increasing amounts of bran material (fiber, Distillates from Dried Grains with Soluble Agents (DDGS)) due to use. of cereals in the production of bioethanol, for example. It is therefore advantageous to provide new xylanases with higher specificity and hence efficiency in solubilizing this bran material.
Bran solubilization test
Preferably, the solubility of the bran is measured using the following test.
A suspension of wheat bran in buffer (0.1 M) di-sodium hydrogen phosphate (0.2 M), pH 5.0 is prepared at a concentration of 1.33% of bran (w / w). From this suspension, 750 ml aliquots are transferred to shaking eppendorph tubes. Each tube of substrate is preheated for 5 minutes at 40 ° C. From there, 250 ml of enzyme solution are added, making the final substrate concentration 1%. Three dilutions (in duplicate) are prepared from each of the xylanases, increasing the enzyme concentration (0.33, 1.0 and
ES 2 561 427 T3
3.0 mg xylanase / grams of bran) at each determination time (0, 30, 60 and 240 minutes). As a control, a heat denatured solution of the xylanase is used. The reaction is terminated at the given times by transferring the tubes to an incubator set at 95 ° C. Heat denatured samples are kept at 4 ° C until all enzymatic reactions are complete. When all enzymatic reactions are complete, the Eppendorph tubes are centrifuged to obtain a clear supernatant. The ability of enzymes to solubilize the bran is expressed as the increase in reducing end groups as determined using PAHBAH (Lever, 1972).
Since side activities, such as amylase activity, can interfere with the above assay, the bran solubilization assay should only be carried out on purified xylanase samples (see Ex. 2).
In one aspect, the xylanase according to the invention has a lower sensitivity to the xylanase inhibitor when compared to any wild-type xylanase.
In a further aspect, the polypeptide with xylanase activity according to the invention has a decreased sensitivity to the xylanase inhibitor as a result of modification at position 110 in combination with one or more modifications at any one or more of the positions of amino acids: 11, 12, 13, 34, 54, 77, 81, 99, 104, 113, 114, 118, 122, 141, 154, 159, 162, 164, 166 and 175.
The inhibitor can be an inhibitor found in nature in plant tissues.
As used herein, the term "xylanase inhibitor" refers to a compound, typically a protein, whose role is to control the depolymerization of complex carbohydrates, such as arabinoxylan, found in the cell wall of plants. These xylanase inhibitors are capable of reducing the activity of xylanase enzymes found in nature as well as those of fungal or bacterial origin. Although the presence of xylanase inhibitors has been shown in cereal seeds (see, for example, McLauchlan et al 1999a; Rouau and Suget 1998).
McLauchlan et al. (1999a) describe the isolation and characterization of a protein from wheat that binds and inhibits two xylanases of the 11-family. Similarly, WO 98/49278 shows the effect of a wheat flour extract on the activity of a group of microbial xylanases, all of which are classified as family 11 xylanases. Debyser et al. (1999) also describe that endoxylanases from Aspergillus niger and Bacillus subtilis, which are both members of family 11 xylanases, were inhibited by a wheat xylanase inhibitor called TAXI. McLauchlan et al. (1999b) show that extracts from commercial flours such as wheat, barley, rye and corn are capable of inhibiting both family 10 and 11 xylanases.
The xylanase inhibitor can be any suitable xylanase inhibitor. Illustratively, the xylanase inhibitor can be the inhibitor described in WO-A-98/49278 and / or the xylanase inhibitor described by Rouau, X. and Surget, A. (1998), McLauchlan, R., et al. (1999) and / or the xylanase inhibitor described in GB19980028599, GB19990007805 and GB19990008645, priority applications of WO0039289.
The inhibitors described in the prior art can also be used in assays to determine the sensitivity of a polypeptide variant of the invention with xylanase inhibitors. They can also be used as described below to modulate the functionality of a xylanase.
Xylanase Inhibitor Assay
Preferably, the xylanase inhibition activity is measured using the following assay.
100 μl of the inhibitor preparation (containing various concentrations of the xylanase inhibitor (for quantification, see quantification of the xylanase inhibitor below)), 250 μl xylanase solution (containing 12 UX xylanase / ml) and 650 µl of buffer (0.1 M citric acid - 0.2 M di-sodium hydrogen phosphate buffer, 1% BSA (Sigma-Aldrich, USA), pH 5.0). The mixture was thermostatted for 5 minutes at 40.0 ° C. At time = 5 minutes, one Xylazyme tablet was added. At a time = 15 minutes the reaction was terminated by adding 10 ml of TRIS / 2% NaOH, pH 12. The reaction mixture was centrifuged (1500 xg, 10 minutes, 20 ° C) and the supernatant was measured at 590 nm. Xylanase inhibition was calculated as% residual activity, compared to control.
The endogenous endo-p-1,4-xylanase inhibitor used is obtainable from wheat flour. The inhibitor is a di-peptide, with a MW of about 40 kDa (as measured by SDS-PAGE or mass spectrometry) and a pl of about 8 to about 9.5. Sequence analysis to date has revealed that the inhibitor has the sequence reported as SEQ ID No. 24 or is highly homologous to it.
A method for quantifying the inhibitor concentration in a given inhibitor preparation can be found in Ex. 3.
Controls were prepared in the same way, but replacing the inhibitor solution with water.
The present invention also relates to a nucleotide sequence encoding a polypeptide according to the invention comprising a nucleotide sequence operably linked to one or more control sequences
ES 2 561 427 T3 that direct the expression of the coding sequence in a suitable host cell under conditions compatible with the control sequences. A polynucleotide encoding a polypeptide of the present invention can be manipulated in a variety of ways to provide for expression of the polypeptide. Manipulation of the polynucleotide sequence prior to insertion into a vector may be desirable or necessary depending on the expression vector. Techniques for modifying polynucleotide sequences using recombinant DNA methods are well known in the art.
The control sequence can be an appropriate promoter sequence, a nucleotide sequence which is recognized by a host cell for expression of a polynucleotide encoding a polypeptide of the present invention. The promoter sequence contains transcriptional sequence controls that mediate the expression of the polypeptide. The promoter can be any nucleotide sequence that exhibits transcriptional activity in the host cell of choice including mutant, truncated and hybrid promoters and can be derived from genes encoding extracellular or intracellular polypeptides both homologous and heterologous with the host cell.
Examples of suitable promoters to direct the transcription of the nucleic acid constructs of the present invention, especially in a bacterial host cell, are promoters obtained from the lac operon of E. coli, Streptomyces coelicolor agarase gene (dagA), Bacillus subtilis levansucrase gene (sacB), Bacillus licheniformis alpha-amylase gene (amyL), Bacillus stearothermophilus maltogenic amylase gene (amyMilasa), alpha-amylase gene from Bacillus amyloliquefaciens (amyQ), penicillinase gene from Bacillus licheniformis (penP), xylA and xylB genes from Bacillus subtilis, and prokaryotic beta-lactamase gene (VillaKamaroff et al., 1978, Proceedings of the National Academy of Sciences USA 75: 3727-3731), as well as the tac promoter (DeBoer et al., 1983, Proceedings of the National Academy of Sciences USA 80: 21-25). Other promoters are described in Useful proteins from recombinant bacteria in Scientific American, 1980, 242: 74-94; and in Sambrook et al., 1989, supra.
Examples of promoters suitable for directing the transcription of the nucleic acid constructs of the present invention in a filamentous fungal host cell are promoters derived from the genes for Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, neutral alpha-amylase. from Aspergillus niger, acid stable alfamylase from Aspergillus niger, awamori glucoamylase from Aspergillus niger or Aspergillus (glaA), lipase from Rhizomucor miehei, alkaline protease from Aspergillus oryzae, triose phosphate isomerase from Aspergillus oryzae, acetamidase from Aspergillus nidulans, amyloglucosidase from Fusarium venenatum (WO 00/56900), Daria from Fusarium venenatum (WO 00/56900), Quinn from Fusarium 00 venenatum (WO 00/56900) / 56900), trypsin-like protease from Fusarium oxysporum (WO 96/00787), beta-glucosidase from Thchoderma reesei, cellobiohydrolase I from Trichoderma reesei, cellobiohydrolase II from Trichoderma reesei, Endoglucanase I from Trichoderma reesei, Endoglucanase II from Trichoderma reesei, Endoglucanase III from Trichoderma reesei, Endoglucanase IV from Trichoderma reesei, Endoglucanase V from Trichoderma reesei, Xylanase I from Trichoderma reesei, Trichodermaesei reesei betaxylanase II, as well as Trichodermaesei reesei reesei xylanasei NA2-tpi promoter (a hybrid of the promoters of the genes for Aspergillus niger neutral alfamylase and Aspergillus oryzae triose phosphate isomerase); and their mutant, truncated, and hybrid promoters.
In a yeast host, useful promoters are derived from the genes for Saccharomyces cerevisiae enolase (ENO-1), Saccharomyces cerevisiae galactokinase (GAL1), Saccharomyces cerevisiae alcohol dehydrogenase / glyceraldehyde3-phosphate dehydrogenase (ADH1, ADH2, ADH2 ), cough phosphate isomerase from Saccharomyces cerevisiae (TPI), metallothionin from Saccharomyces cerevisiae (CUP1) and 3-phosphoglycerate kinase from Saccharomyces cerevisiae. Other useful promoters for yeast host cells are described in Romanos et al., 1992, Yeast 8: 423-488.
The control sequence can also be a suitable transcription terminator sequence, a sequence recognized by a host cell to terminate transcription. The terminator sequence is operably linked to the 3 'end of the nucleotide sequence encoding the polypeptide. Any terminator that is functional in the host cell of choice can be used in the present invention.
Terminators for filamentous fungal host cells can be obtained from the genes for Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, Aspergillus niger alpha-glucosidase and Fusarium oxysys niger trypsporum-like protease. Terminators for yeast host cells can be derived from the genes for Saccharomyces cerevisiae enolase, Saccharomyces cerevisiae cytochrome C (CYC1), and Saccharomyces cerevisiae glyceraldehyde-3-phosphate dehydrogenase. Other useful terminators for yeast host cells are described in Romanos et al., 1992, supra.
The control sequence can also be a suitable leader sequence, an untranslated region of a mRNA that is important for translation by the host cell. The leader sequence is operably linked to the 5 'end of the nucleotide sequence encoding the polypeptide. Any leader sequence that is functional in the host cell of choice can be used in the present invention.
Leader sequences for filamentous fungal host cells can be obtained from the Aspergillus oryzae TAKA amylase and Aspergillus nidulans triose phosphate isomerase genes.
ES 2 561 427 T3
The leader sequences suitable for yeast host cells are derived from the genes for Saccharomyces cerevisiae enolase (ENO-1), Saccharomyces cerevisiae 3-phosphoglycerate kinase, Saccharomyces cerevisiae alpha-factor and alcohol dehydrogenase / glyceraldehyde-3-phosphate Saccharomyces cerevisiae dehydrogenase (ADH2 / GAP).
The control sequence can also be a polyadenylation sequence, a sequence operably linked to the 3 'end of the nucleotide sequence and which, when transcribed, is recognized by the host cell as a signal to add polyadenosine residues to the transcribed mRNA. Any polyadenylation sequence that is functional in the host cell of choice can be used in the present invention.
Polyadenylation sequences for filamentous fungal host cells can be obtained from the genes for Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, Fusarium oxysporum trypsin-like protease and Aspergillus n / geralpha-glucosidase.
Useful polyadenylation sequences for yeast host cells are described in Guo and Sherman, 1995, Molecular Cellular Biology 15: 5983-5990.
The control sequence can also be a signal peptide coding region that codes for an amino acid sequence attached to the amino terminus of a polypeptide and that directs the encoded polypeptide into the secretory pathway of the cell. The 5 'end of the coding sequence of the nucleotide sequence may inherently contain a signal peptide coding region linked naturally in reading frame translation with the coding region segment that codes for the secreted polypeptide. Alternatively, the 5 'end of the coding sequence may contain a signal peptide coding region that is foreign to the coding sequence. The foreign signal peptide coding region may be required when the coding sequence does not naturally contain a signal peptide coding region. Alternatively, the foreign signal peptide coding region can simply replace the natural signal peptide coding region to enhance secretion of the polypeptide. However, any signal peptide coding region that targets the polypeptide expressed in the secretory pathway of a host cell of choice, ie, secreted within a culture medium, can be used in the present invention.
Effective peptide coding region signals for bacterial host cells are peptide coding region signals derived from the genes of Bacillus Maltogenic Amylase NCIB 11837, Bacillus stearothermophilus alphaamylase, Bacillus licheniformis subtilisin, beta-lactamase from Bacillus licheniformis, neutral proteases from Bacillus stearothermophilus (nprT, nprS, nprM) and prsA from Bacillus subtilis. Other signal peptides are described in Simonen and Palva, 1993, Microbiological Reviews 57: 109-137.
The effective peptide coding region signals for filamentous fungal host cells are the peptide coding region signals derived from the genes of Aspergillus oryzae TAKa amylase, Aspergillus niger neutral amylase, Aspergillus niger glucoamylase, Aspergillus niger proteinase. Rhizomucor miehei, cellulase from Humicola insolens, endoglucanase V from Humicola insolens and lipase from Humicola lanuginosa.
Signal peptides for yeast host cells are derived from the Saccharomyces cerevisiae alphafactor and Saccharomyces cerevisiae invertase genes. Other useful signals from the coding region of the peptide are described in Romanos et al., 1992, supra.
The control sequence can also be a propeptide coding region that codes for an amino acid sequence positioned at the amino terminus of a polypeptide. The resulting polypeptide is known as a proenzyme or propolypeptide (or a zymogen, in some cases). A propolypeptide is generally inactive and can be converted to a mature, active polypeptide by catalytic or autocatalytic cleavage of the propeptide from the propolypeptide. The coding region of the propeptide can be obtained from the genes for alkaline protease from Bacillus subtilis (aprE), neutral protease from Bacillus subtilis (nprf), alpha-factor from Saccharomyces cerevisiae, aspartic proteinase from Rhizomucor miehei and laccase from Mycelphilaphthoramo WO 95/33836).
When both signal peptide and propeptide regions are present at the amino terminus of a polypeptide, the propeptide region is positioned close to the amino terminus of a polypeptide and the signal peptide region is positioned close to the amino terminus of the propeptide region.
It may also be desirable to add regulatory sequences that allow regulation of the expression of the polypeptide with respect to the growth of the host cell. Examples of regulatory systems are those that cause gene expression to turn on or off in response to chemical or physical stimuli, including the presence of a regulatory compound. Regulatory systems in prokaryotic systems include the lac, tec, and tip operator systems. In yeast, the ADH2 system or the GAL1 system can be used. In filamentous fungi, the TAKA alpha-amylase promoter, Aspergillus niger glucoamylase promoter, and Aspergillus oryzae glucoamylase promoter can be used as regulatory sequences. Other examples of regulatory sequences are those that allow gene amplification. In eukaryotic systems, these include the dihydrofolate reductase gene that is amplified in the presence of methotrexate and the metallothionein genes that are amplified with heavy metals. In these cases, the nucleotide sequence encoding the polypeptide would be operably linked to the regulatory sequence.
ES 2 561 427 T3
Also described herein are recombinant expression vectors comprising a polynucleotide encoding the polypeptide of the present invention, a promoter, and transcriptional and translational stop signals. The various nucleic acid and sequence controls described herein can be linked to produce a recombinant expression vector that may include one or more convenient restriction sites to allow insertion or substitution of the nucleotide sequence encoding the polypeptide. sites. Alternatively, a nucleotide sequence encoding the polypeptide of the present invention can be expressed by inserting the nucleotide sequence or a nucleic acid construct comprising the sequence into an appropriate expression vector. In creating the expression vector, the coding sequence is located in the vector so that the coding sequence is operably linked with the appropriate sequence controls for expression.
The recombinant expression vector can be any vector (eg, a plasmid or virus) that can be conveniently subjected to recombinant DNA procedures and can roughly express the nucleotide sequence. The choice of vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced. Vectors can be linear or closed circular plasmids.
The vector may autonomously be a replicating vector, that is, a vector that exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, eg, a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome. The vector can contain any means to ensure self-replication. Alternatively, the vector may be one that, when introduced into the host cell, integrates within the genome and replicates together with the chromosome or chromosomes into which it has been integrated. In addition, a single vector or plasmid or two or more vectors or plasmids that together contain the total DNA that is introduced into the genome of the host cell, or a transposon, can be used.
The vectors described herein preferably contain one or more selectable markers that allow easy selection of transformed, transfected, translated, or the like cells. A selectable marker is a gene whose product provides biocidal or viral resistance, resistance against heavy metals, prototrophy against auxotrophs, and the like.
Examples of selectable bacterial markers are the dal genes from Bacillus subtilis or Bacillus licheniformis, or markers that confer antibiotic resistance such as resistance against ampicillin, kanamycin, chloramphenicol or tetracycline. Suitable markers for yeast host cells are ADE2, HIS3, LEU2, LYS2, MET3, TRP1, and URA3. Selectable markers for use in a filamentous fungal host cell include, but are not limited to, amdS (acetamidase), argB (ornithine carbamoyltransferase), bar (phosphinothricin acetyltransferase), hph (hygromycin phosphotransferase), niaD (nitrate reductase), pyr-G (orotidine reductase), pyr-G (orotidine reductase) 5'-phosphate decarboxylase), sC (sulfate adenyltransferase) and trpC (anthranilate synthase), as well as their equivalents. In some embodiments the Aspergillus nidulans or Aspergillus oryzae amdS and pyrG genes and the Streptomyces hygroscopicus bar gene are used in an Aspergillus cell.
The vectors described in this document preferably contain one or more elements that allow the integration of the vector within the genome of the host cell or the autonomous replication of the vector in the cell independent of the genome. For integration into the host cell genome, the vector may rely on the sequence of the polynucleotide encoding the polypeptide or any other element of the vector for integration into the genome by homologous or non-homologous recombination. Alternatively, the vector may contain additional nucleotide sequences to direct integration by homologous recombination within the host cell genome at a precise location (s) on the chromosome (s). To increase the probability of integration at a precise location, the integrational elements should preferably contain a sufficient number of nucleic acids, such as 100 to 10,000 base pairs, preferably 400 to 10,000 base pairs, and most preferably 800 to 10,000. base pairs, which have a high degree of identity with the corresponding target sequence to enhance the likelihood of homologous recombination. The integrational elements can be any sequence that is homologous to the target sequence in the genome of the host cell. Furthermore, the integrating elements can be non-coding or coding nucleotide sequences. On the other hand, the vector can be integrated into the genome of the host cell by non-homologous recombination. For autonomous replication, the vector may further comprise an origin of replication that allows the vector to autonomously replicate in the host cell in question. The origin of replication can be any replicator plasmid that mediates autonomous replication that functions in a cell. The term "origin of replication" or "replicating plasmid" is defined herein as a nucleotide sequence that allows a plasmid or vector to replicate in vivo.
Examples of bacterial origins of replication are the origins of replication of plasmids pBR322, pUC19, pACYC177, and pACYC184 that allow replication in E. coli, and pUB1 10, pE194, pTA1060, and pAMpi that allow replication in Bacillus.
Examples of origins of replication for use in a yeast host cell are the 2 micron origin of replication, ARS1, ARS4, the combination of ARS1 and CEN3, and the combination of ARS4 and CEN6.
ES 2 561 427 T3
Examples of useful origins of replication in a filamentous fungal cell are AMA1 and ANSI (Gems et al., 1991, Gene 98: 61-67; Cullen et al., 1987, Nucleic Acids Research 15: 9163-9175; WO 00 / 24883). The isolation of the AMA1 gene and the construction of plasmids or vectors comprising the gene can be achieved according to the methods described in WO 00/24883.
More than one copy of a polynucleotide of the present invention can be inserted into the host cell to increase the production of the gene product. An increase in the number of copies of the polynucleotide can be obtained by integrating at least one additional copy of the sequence into the genome of the host cell or by including an amplifiable selectable marker gene with the polynucleotide where cells containing the amplified copies of the selectable marker gene , and thus additional copies of the polynucleotide, can be selected to grow cells in the presence of the appropriate selectable agent.
The procedures used to ligate the elements described above to construct the recombinant expression vectors of the present invention are well known to those of skill in the art (see, eg, Sambrook et al., 1989, supra).
Also described herein are recombinant host cells comprising a polynucleotide encoding the polypeptide of the present invention, which are advantageously used in the recombinant production of the polypeptides. A vector comprising a polynucleotide encoding the polypeptide of the present invention is introduced into a host cell such that the vector is maintained as a chromosomal integrant or as a self-replicating extra-chromosomal vector as described above. The term "host cell" encompasses any progeny of a parenteral cell that is not identical to the parenteral cell due to mutations that occur during replication. The choice of a host cell will largely depend on the gene encoding the polypeptide and its source.
The host cell can be a single-celled microorganism, eg, a prokaryotic cell, or a non-single-celled microorganism, eg, a eukaryotic cell. Useful single-celled microorganisms are bacterial cells such as gram positive bacteria including, but not limited to, a Bacillus cell, eg, Bacillus alkalophils, Bacillus amilolicuefaciens. Bacillus brevis, Bacillus circulans, Bacillus clausii, Bacillus coagulans, Bacillus lautus, Bacillus lentus, Bacillus licheniformis, Bacillus megaterium, Bacillus stearothermophilus, Bacillus subtilis and Bacillus thuringiensis; or a Streptomyces cell, eg, Streptomyces lividans and Streptomyces murinus, or gram negative bacteria such as E. coli and Pseudomonas sp. In one aspect, the bacterial host cell is a Bacillus lentus, Bacillus licheniformis, Bacillus stearothermophilus, or Bacillus subtilis cell. In another aspect, the Bacillus cell is an alkalophilic Bacillus. Introduction of a vector into a bacterial host cell can be accomplished, for example, by transforming the protoplast (see, for example, Chang and Cohen, 1979, Molecular General Genetics 168: 111-115), using competent cells (see, e.g. Young and Spizizen, 1961, Journal of Bacteriology 81: 823-829, or Dubnau and Davidoff-Abelson, 1971, Journal of Molecular Biology 56: 209-221), electroporation (see, for example, Shigekawa and Dower, 1988 , Biotechniques 6: 742-751), or conjugation (see, for example, Koehlery Thome, 1987, Journal of Bacteriology 169: 5771-5278).
Also described herein is a host cell which may be a eukaryotic cell, such as a mammalian, insect, plant, or fungal cell.
A host cell can be a fungal cell. Fungi, as used herein, include Ascomycota, Basidiomycota, Chytridiomycota, and Zygomycota (as defined in Hawksworth et al., En, Ainsworth and Bisby's Dictionary of The Fungi, 8<sup>to</sup> edition, 1995, CAB International, University Press, Cambridge, UK) as well as oomycetes (as cited in Hawksworth et al., 1995, supra, p. 171) and all mytosporic fungi (Hawksworth et al., 1995, supra). In another aspect, the fungal host cell is a yeast cell. Yeast, as used herein, includes Asco sporogene yeast (Endomycetals), Basidium sporogene yeast, and yeasts belonging to Fungi Imperfecti (Blastomycetes). Since the classification of yeast may change in the future, for the purposes of this invention, yeast will be defined as described in Biology and Activities of Yeast (Skinner, FA, Passmore, SM, and Davenport, RR, eds, Soc . App. Bacteriol. Symposium Series No. 9, 1980).
A host cell can be a Candida, Hansenula, Kluyveromyces, Pichia, Saccharomyces, Schizosaccharomyces or Yarrowia cell.
A host cell can be a Saccharomyces carlsbergensis, Saccharomyces cerevisiae, Saccharomyces diastaticus, Saccharomyces douglasii, Saccharomyces kluyveri, Saccharomyces norbensis, or Saccharomyces oviformis cells. In another aspect, the yeast host cell is a Kluyveromyces lactis cell. In another aspect, the yeast host cell is a Yarrowia lipolytica cell.
A host cell can be a filamentous fungal cell. Filamentous fungi include all filamentous forms of the Eumycota and Oomycota subdivision (as defined in Hawksworth et al., 1995, supra). Filamentous fungi are generally characterized by a mycelial wall composed of chitin, cellulose, glucan, chitosan, mannan, and other complex polysaccharides. Vegetative growth is by hyphal elongation and carbohydrate catabolism is necessarily aerobic. In contrast, vegetative growth
ES 2 561 427 T3 by yeasts, such as Saccharomyces cerevisiae, is by sprouting a single-celled thallus and carbohydrate catabolism can be disruptive.
A host cell can be a cell of Acremonium, Aspergillus, Aureobasidium, Bjerkandera, Ceriporiopsis, Coprinus, Coriolus, Cryptococcus, Filibasidium, Fusarium, Humicola, Magnaporthe, Mucor, Myceliophthora, Neocallimastix, Neurospora, Penchaecilcesia, Penchaecilcesia, Penchaecilcesium Pleurotus, Schizophyllum, Talaromyces, Thermoascus, Thielavia, Tolypocladium, Trametes or Trichoderma.
A host cell can be an Aspergillus awamori, Aspergillus fumigatus, Aspergillus foetidus, Aspergillus japonicus, Aspergillus nidulans, Aspergillus niger, or Aspergillus oryzae cell. In another aspect, the filamentous tungus host cell is a cell of Fusarium bactridioides, Fusarium cerealis, Fusarium crookwellense, Fusarium culmorum, Fusarium graminearum, Fusarium graminum, Fusarium heterosporum, Fusarium negundi, Fusarium oxysporum, Fusarium reticulatum, Fusarium roseum, Fusarium sambuarium, Fusarium sambuariumum. sarcochroum, Fusarium sporotrichioides, Fusarium sulphureum, Fusarium torulosum, Fusarium trichothecioides or Fusarium venenatum. In another aspect, the filamentous tungus host cell is a cell of Bjerkandera adusta, Ceriporiopsis aneirina, Ceriporiopsis aneirina, Ceriporiopsis caregiea, Ceriporiopsis gilvescens, Ceriporiopsis pannocinta, Ceriporiopsis rivulosa, Ceriporiopsis subrufa, Ceriporiopsis subvermisolusicolaus, Coprusleirssoirssolaus cinereosicola. lanuginosa, Mucor miehei, Myceliophthora thermophila, Neurospora crassa, Penicillium purpurogenum, Phanerochaete chrysosporium, Phlebia radiata, Pleurotus eryngii, Thielavia terrestris, Trametes villosa, Trametes versicolor, Trichoderma harzianum, Trichoderma koningii, Trichoderma longibrachiatum, Trichoderma reesei or Trichoderma viride. Tungus cells can be transformed by a process involving protoplast formation, protoplast transformation, and cell wall regeneration in a manner known per se. Suitable procedures for the transformation of Aspergillus and Trichoderma host cells are described in EP 238 023 and Yelton et al., 1984, Proceedings of the National Academy of Sciences USA 81: 1470-1474. Suitable methods for transforming Fusarium species are described in Malardier et al., 1989, Gene 78: 147-156 and WO 96/00787. Yeast can be transformed using the procedures described in Becker and Guarente, En Abelson, JN and Simon, MI, editors, Guide to Yeast Genetics and Molecular Biology, Methods in Enzymology, Volume 194, pp 182-187, Academic Press, Inc., New York; Ito et al., 1983, Journal of Bacteriology 153: 163; and Hinnen et al., 1978, Proceedings of the National Academy of Sciences USA 75; 1920.
The present invention also relates to methods for producing a polypeptide of the present invention, comprising: (a) cultivating a cell, which in its wild-type form is capable of producing the polypeptide, under conditions favorable for the production of the polypeptide; and (b) recovering the polypeptide. Preferably the cell is of the genus Aspergillus and more preferably of Aspergillus fumigatus.
The present invention also relates to methods for producing a polypeptide of the present invention, comprising: (a) cultivating a host cell under conditions favorable for the production of the polypeptide; and (b) recovering the polypeptide.
In the production methods of the present invention, cells are cultured in a nutrient medium suitable for the production of the polypeptide using methods well known in the art. For example, the cell can be cultured by shake flask culture and small-scale or large-scale fermentation (including continuous, batch, fed-batch, or solid-state fermentations) in laboratory or industrial fermenters performed in a suitable medium and low. conditions that allow the polypeptide to be expressed and / or isolated. The cultivation takes place in a suitable nutrient medium comprising carbon and nitrogen sources and inorganic salts, using procedures known in the art. Suitable media are available from commercial suppliers or can be prepared according to published compositions (eg, American Type Culture Collection catalogs). If the polypeptide is secreted into the nutrient medium, the polypeptide can be recovered directly from the medium. If the polypeptide is not secreted into the medium, it can be recovered from cell lysates.
Polypeptides can be detected using methods known in the art that are specific for the polypeptides. These detection methods can include the use of specific antibodies, the formation of an enzyme product, or the disappearance of an enzyme substrate.
For example, an enzyme assay can be used to determine the activity of the polypeptide as described herein.
The resulting polypeptide can be recovered using methods known in the art. For example, the polypeptide can be recovered from the nutrient medium by conventional procedures including, but not limited to, centrifugation, filtration, extraction, spray drying, evaporation, or precipitation. The polypeptides of the present invention can be purified by a variety of procedures known in the art including, but not limited to, chromatography (eg, ion exchange, affinity, hydrophobic, isofocus and size exclusion chromatography), electrophoretic procedures (eg, preparative isoelectric focusing), differential solubility (e.g. ammonium sulfate precipitation), SDS-PAGE or extraction
ES 2 561 427 T3 (see, for example, Protein Purification, J. -C. Janson and Lars Ryden, ed., VCH Publishers, New York, 1989) to obtain substantially pure polypeptides.
In one aspect, the amino acid modification at position 110 is an amino acid substitution.
In some embodiments, sequence identity is measured relative to SEQ ID No. 1, wherein the amino acid sequence according to SEQ ID No. 1 further comprises a signal peptide sequence, such as its natural signal peptide sequence.
In some embodiments, the polypeptide according to the invention has at least 90, 92 or 95% identity with SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention has a β-coiled fold.
According to the invention, the amino acid modification at position 110 is an amino acid substitution.
According to the invention, the amino acid modification at position 110 is a substitution on any other different amino acid residue selected from the group consisting of: alanine, asparagine, cysteine, glutamic acid or tryptophan.
In some embodiments according to the invention, the amino acid modification at position 110 is a substitution on any other different amino acid residue selected from the group consisting of: alanine, asparagine, cysteine, glutamic acid, tryptophan.
In some embodiments according to the invention, the amino acid modification at position 110 is a substitution on any other different amino acid residue selected from the group consisting of: glutamic acid, tryptophan, alanine, and cysteine.
In some embodiments according to the invention, the amino acid modification at position 110 is an alanine substitution.
In some embodiments, the polypeptide according to the invention has a total number of amino acids of less than 250, such as less than 240, such as less than 230, such as less than 220, such as less than 210, such as less than 200 amino acids, such as in the range of 160 to 240, such as in the range of 160 to 220 amino acids.
In some embodiments, the polypeptide according to the invention comprises one or more modifications at any one or more of the amino acid positions: 11, 12, 13, 34, 54, 77, 81, 99, 104, 113, 114, 118 , 122, 141, 154, 159, 162, 164, 166 and 175, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of: 11F, 12F, 54Q, 54W, 122D, 113A, 13Y, 113D, 175L, 122F, 34K, 99Y , 104W, 141Q, 154R, 159D, 175K, 81I, 166F, 162E, 162D, 164F, 114D, 114Y, 114F, 118V, 175K, 77L, 77M, 77V, and 77Y, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of: D11F, G12F, N54Q, R122D, Y113A, G13Y, Y113D, N141Q, Q175L, R122F, G34K, K99Y , T104W, K154R, N159D, Q175K, V81I, Y166F, S162E, S162D, W164F, N114D, N114Y, N114F, I118V, I77L, I77M, I77V, and I77Y, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises one or more modification or modifications at any one or more of the amino acid positions: 13, 99, 104, 113, 122, 154, 159 and 175, the (s ) position (s) as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises a substitution or substitutions at amino acid positions: 13, 99, 104, 113, 122, 154, 159 and 175, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention further comprises one or more modification (s) at any one or more of amino acid positions: 114 and 166, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention further comprises one or more substitution or substitutions at any one or more of amino acid positions: 114 and 166, the one (s) being determined
ES 2 561 427 T3 position (s) as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises a substitution or substitutions in at least four of the following amino acid positions: 13, 99, 104, 113, 114, 122, 154, 159, 166 and 175, being determined the position (s) as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises a substitution or substitutions at amino acid positions: 13, 99, 104, 113, 114, 122, 154, 159 and 175, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises a substitution or substitutions at amino acid positions: 13, 99, 104, 113, 122, 154, 159, 166 and 175, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises a substitution or substitutions at amino acid positions: 13, 99, 104, 113, 122, 154, 159, and 175, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of: 13Y, 99Y, 104W, 110A, 113D, 114D, 114F, 122F, 154R, 159D, 166F, 175K , and 175L, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention has at least five, six, seven, eight, nine or ten amino acid substitutions compared to the sequence selected from SEQ ID No. 1 with which it has the highest identity.
In some embodiments, the polypeptide according to the invention has at least nine or ten amino acid substitutions.
In some embodiments, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of:
to. D11F, R122D, and T110A;
b. D11F, R122D, T110A, and Y113A;
c. G13Y, T110A, Y113D, R122D, and Q175L;
d. G13Y, T110A, Y113D, R122F, and Q175L;
and. G13Y, G34K, T110A, Y113D, R122D, and Q175L;
F. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175K;
g. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, Q175 and V81I;
h. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, Y166F, and Q175L;
i. G13Y, T110A, Y113D, R122D, K154R, N159D and Q175L;
j. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D and Q175L;
k. G13Y, T110A, Y113D, R122D, S162E, and Q175L;
l. G13Y, T110A, Y113D, R122D, S162D, and Q175L;
m. G13Y, T110A, Y113D, R122D, W164F and Q175L;
n. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175L;
or. G13Y, K99Y, T104W, T110A, Y113D, N114Y, R122F, K154R, N159D and Q175L;
p. G13Y, K99Y, T104W, T110A, Y113D, N114F, R122F, K154R, N159D and Q175L;
q. G13Y, K99Y, T104W, T110A, Y113D, I118V, R122F, K154R, N159D, and Q175L;
r. G13Y, K99Y, T104W, T110A, Y113D, N114Y, R122F, K154R, N159D and Q175K;
ES 2 561 427 T3
s. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175K;
t. G13Y, I77L, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175L;
or. G13Y, I77M, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175L;
v. G13Y, I77S, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D and Q175L;
w. G13Y, I77V, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175L;
x. G13Y, I77Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D and Q175L
Y. G13Y, K99Y, T104W, T110A, Y113D, R122F, N141Q, K154R, N159D, Q175L;
z. G13Y, N54Q, K99Y, T104W, T110A, Y113D, R122F, N141Q, K154R, N159D, Q175;
aa.G13Y, N54W, K99Y, T104W, T110A, Y113D, R122F, 141Q, K154R, N159D, 175L;
bb.G13Y, N54Q, K99Y, T104W, T110A, Y113D, N114F, R122F, K154R, N159D, Q175L;
DC. G13Y, K99Y, T104W, T110A, Y113D, N114F, R122F, 141Q, K154R, N159D, Q175L; and dd.G13Y, 54Q, K99Y, T104W, T110A, Y113D, N114F, R122F, 141Q, K154R, N159D, Q175L;
the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of:
to. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175K;
b. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, Y166F, and Q175L;
c. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D and Q175L;
d. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175L;
and. G13Y, K99Y, T104W, T110A, Y113D, N114F, R122F, K154R, N159D and Q175L;
the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention has bran solubilizing activity.
In some embodiments, the polypeptide according to the invention is in isolated form.
The term "isolated", as used herein, means that the polypeptide is at least substantially free of at least one other component with which the sequence is naturally associated in nature.
In some embodiments according to the invention, the amino acid modification at position 110 is not T110D.
In some embodiments, the polypeptide with xylanase activity does not have an aspartic acid at position 110.
In some embodiments, the polypeptide according to the invention has better xylanase activity compared to the amino acid sequence of B. subtilis shown as SEQ ID No. 1 as measured in a xylanase activity assay.
In some embodiments, the polypeptide according to the invention has improved xylanase activity as a result of the modification at position 110.
The polypeptide according to the invention has better bran solubilization activity compared to the amino acid sequence of B. subtilis shown as SEQ ID No. 1 as measured in a bran solubilization activity assay.
The polypeptide according to the invention has better bran solubilization activity as a result of the modification at position 110.
In some embodiments, the polypeptide according to the invention has lower sensitivity with respect to a xylanase inhibitor.
ES 2 561 427 T3
In some embodiments, the polypeptide according to the invention has an amino acid sequence comprising modifications at positions selected from the list consisting of:
a) 13/110/113/122/154/159/175;
b) 13/99/104/110/113/122/154/159/166/175;
c) 13/99/104/110/113/114/122/154/159/175;
d) 13/110/113/122/175;
e) 13/99/104/110/113/122/154/159/175;
f) 13/99/104/110/113/122/154/159/175;
g) 13/99/104/110/113/114/122/154/159/175;
h) 13/99/104/110/113/114/122/154/159/175;
i) 13/99/104/110/113/114/122/154/159/175;
j) 13/99/104/110/113/114/122/154/159/175;
k) 13/77/99/104/110/113/122/154/159/175;
l) 13/81/99/104/110/113/122/154/159/175;
m) 13/110/113/122/164/175;
n) 13/110/113/122/162/175;
o) 13/110/113/122/175;
p) 11/122/110/113;
q) 13/77/99/104/110/113/122/154/159/175;
r) 11/122/110;
s) 13/34/110/113/122/175;
t) 13/77/99/104/110/113/122/154/159/175;
u) 13/77/99/104/110/113/122/154/159/175;
v) 13/99/104/110/113/118/122/154/159/175;
w) 13/110/113/122/162/175;
x) 13/77/99/104/110/113/122/154/159/175;
y) 13/99/104/110/113/122/141/154/159/175;
z) 13/54/99/104/110/113/122/141/154/159/175;
aa) 13/54/99/104/110/113/122/141/154/159/175;
bb) 13/54/99/104/110/113/114/122/154/159/175;
cc) 13/99/104/110/113/114/122/141/154/159/175; and dd) 13/54/99/104/110/113/114/122/141/154/159/175;
the position (s) being determined as the corresponding position of the subtilis amino acid sequence shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention has an amino acid sequence comprising amino acid substitutions selected from the list consisting of:
a) 13Y / 110A / 113D / 122D / 154R / 159D / 175L;
b) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 166F / 175L;
ES 2 561 427 T3
c) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
d) 13Y / 110A / 113D / 122F / 175L;
e) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
f) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175K;
g) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175K;
h) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175L;
i) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175L;
j) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175K;
k) 13Y / 77L / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
l) 13Y / 81I / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
m) 13Y / 110A / 113D / 122D / 164F / 175L;
n) 13Y / 110A / 113D / 122D / 162D / 175L;
o) 13Y / 110A / 113D / 122D / 175L;
p) 11F / 122D / 110A / 113A;
q) 13Y / 77Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
r) 11F / 122D / 110A;
s) 13Y / 34K / 110A / 113D / 122D / 175L;
t) 13Y / 77V / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
u) 13Y / 77M / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
v) 13Y / 99Y / 104W / 110A / 113D / 118V / 122F / 154R / 159D / 175L;
w) 13Y / 110A / 113D / 122D / 162E / 175L;
x) 13Y / 77S / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
y) 13Y / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
z) 13Y / 54Q / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
aa) 13Y / 54W / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
bb) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
cc) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L; and dd) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L;
the position (s) being determined as the corresponding position of the subtilis amino acid sequence shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention has an amino acid sequence of SEQ ID No. 1 comprising amino acid substitutions selected from the list consisting of:
a) G13Y / T110A / Y113D / R122D / K154R / N159D / Q175L;
b) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Y166F / Q175L;
c) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L;
d) G13Y / T110A / Y113D / R122F / Q175L;
e) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
ES 2 561 427 T3
f) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175K;
g) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175K;
h) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175L;
i) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175L;
j) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175K;
k) G13Y / I77L / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
l) G13Y / V81I / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
m) G13Y / T110A / Y113D / R122D / W164F / Q175L;
n) G13Y / T110A / Y113D / R122D / S162D / Q175L;
o) G13Y / T110A / Y113D / R122D / Q175L;
p) D11F / R122D / T110A / Y113A;
q) G13Y / I77Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
r) D11F / R122D / T110A;
s) G13Y / G34K / T110A / Y113D / R122D / Q175L;
t) G13Y / I77V / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
u) G13Y / I77M / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
v) G13Y / K99Y / T104W / T110A / Y113D / I118V / R122F / K154R / N159D / Q175L;
w) G13Y / T110A / Yl13D / R122D / S162E / Q175L; Y
x) G13Y / I77S / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L
y) G13Y / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q175L;
z) G13Y / N54Q / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q1 75L;
aa) G13Y / N54W / K99Y / T104W / T110A / Y113D / R122F / 141Q / K154R / N159D / 17 5L;
bb) G13Y / N54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q 175L;
cc) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N159D / Q17 5L; and dd) G13Y / 54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N159 D / Q175L.
In some embodiments, the polypeptide according to the invention has an amino acid sequence, consisting of amino acid substitutions selected from the list consisting of:
a) 13Y / 110A / 113D / 122D / 154R / 159D / 175L;
b) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 166F / 175L;
c) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
d) 13Y / 110A / 113D / 122F / 175L;
e) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
f) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175K;
g) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175K;
h) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175L;
i) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175L;
j) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175K;
ES 2 561 427 T3
k) 13Y / 77L / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
l) 13Y / 81I / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
m) 13Y / 110A / 113D / 122D / 164F / 175L;
n) 13Y / 110A / 113D / 122D / 162D / 175L;
o) 13Y / 110A / 113D / 122D / 175L;
p) 11F / 122D / 110A / 113A;
q) 13Y / 77Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
r) 11F / 122D / 110A;
s) 13Y / 34K / 110A / 113D / 122D / 175L;
t) 13Y / 77V / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
u) 13Y / 77M / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
v) 13Y / 99Y / 104W / 110A / 113D / 118V / 122F / 154R / 159D / 175L;
w) 13Y / 110A / 113D / 122D / 162E / 175L;
x) 13Y / 77S / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
y) 13Y / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
z) 13Y / 54Q / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
aa) 13Y / 54W / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
bb) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
cc) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L; and dd) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L, the position (s) being determined as the corresponding position of the amino acid sequence of subtilis shown as SEQ ID No. 1.
In some embodiments, the polypeptide according to the invention has an amino acid sequence of SEQ ID No. 1, consisting of amino acid substitutions selected from the list consisting of:
a) G13Y / T110A / Y113D / R122D / K154R / N159D / Q175L;
b) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Y166F / Q175L;
c) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L;
d) G13Y / T110A / Y113D / R122F / Q175L;
e) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
f) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175K;
g) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175K;
h) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175L;
i) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175L;
j) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175K;
k) G13Y / I77L / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
l) G13Y / V81I / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
m) G13Y / T110A / Y113D / R122D / W164F / Q175L;
ES 2 561 427 T3
n) G13Y / T110A / Y113D / R122D / S162D / Q175L;
o) G13Y / T110A / Y113D / R122D / Q175L;
p) D11F / R122D / T110A / Y113A;
q) G13Y / I77Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
r) D11F / R122D / T110A;
s) G13Y / G34K / T110A / Y113D / R122D / Q175L;
t) G13Y / I77V / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
u) G13Y / I77M / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
v) G13Y / K99Y / T104W / T110A / Y113D / I118V / R122F / K154R / N159D / Q175L;
w) G13Y / T110A / Y113D / R122D / S162E / Q175L; Y
x) G13Y / I77S / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L
y) G13Y / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q175L;
z) G13Y / N54Q / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q1 75L;
aa) G13Y / N54W / K99Y / T104W / T110A / Y113D / R122F / 141Q / K154R / N159D / 175 L;
bb) G13Y / N54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q1 75L;
cc) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N159D / Q17 5L; and dd) G13Y / 54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N159D / Q175L.
In some embodiments, the polypeptide according to the invention is not SEQ ID No. 25.
In some embodiments, the polypeptide according to the invention does not have a sequence selected from the list consisting of:
SEQ ID No. 57 of international patent application WO0238746;
SEQ ID No. 62 of international patent application WO0238746;
SEQ ID No. 59 of international patent application WO0238746;
SEQ ID No. 53 of international patent application WO0238746;
SEQ ID No. 65 of international patent application WO0238746;
SEQ ID No. 56 of international patent application WO0238746;
SEQ ID No. 64 of international patent application WO0238746;
SEQ ID No. 52 of international patent application WO0238746;
SEQ ID No. 63 of international patent application WO0238746;
SEQ ID No. 61 of international patent application WO0238746;
SEQ ID No. 60 of international patent application WO0238746;
SEQ ID No. 58 of international patent application WO0238746;
SEQ ID No. 55 of international patent application WO0238746;
SEQ ID No. 12 of international patent application WO0238746;
SEQ ID No. 11 of international patent application WO0238746;
SEQ ID No. 21 of international patent application WO0068396; Y
SEQ ID No. 22 of international patent application WO0068396.
ES 2 561 427 T3
In some embodiments of the present invention, the amino acid sequence is used for large-scale applications.
Preferably, the amino acid sequence is produced in an amount of from 1 g per liter to about 100 g per liter of the total cell culture volume after culturing the host organism.
The present invention also relates to a composition comprising the amino acid sequences and / or nucleotide sequences encoding a xylanase as described herein.
The composition of the present invention can lead to improving the aroma, flavor, smoothness, consistency, texture, body, mouthfeel, stability, viscosity, gel breakage, structure and / or organoleptic properties and nutrition of consumer products containing said composition. Furthermore, the composition of the present invention can also be used in combination with other components of consumer products to impart such enhancements.
Although it is preferred that the composition of the present invention is used to improve aroma, flavor, smoothness, consistency, texture, body, mouthfeel, stability, viscosity, gel breakage, structure, surface smoothness and / or organoleptic properties and nutrition of products for consumption containing said composition, The present invention also covers the use of the composition of the present invention as a component of pharmaceutical combinations with other components to deliver medical or physiological benefit to the consumer. Accordingly, the composition of the present invention can be used in combination with other components.
Examples of other components include one or more of: thickening agents, gelling agents, emulsifiers, binders, glass modifiers, sweeteners (including artificial sweeteners), rheology modifiers, stabilizers, antioxidants, colorants, enzymes, vehicles, carriers, excipients, diluents , lubricating agents, flavoring agents, coloring agents, suspending agents, disintegrants, granulation binders, etc. These other components can be natural. These other components can be prepared using chemical and / or enzymatic techniques.
As used herein, the term "thickening or gelling agent," as used herein, refers to a product that prevents separation by reducing or preventing the movement of particles, whether droplets of immiscible liquids, air, or insoluble solids. Thickening occurs when individual hydrated molecules cause an increase in viscosity, retarding separation. Gelation occurs when hydrated molecules join together to form a three-dimensional network that traps the particles, immobilizing them thereby.
The term "stabilize", as used herein, is defined as an ingredient or combination of ingredients that prevents a product (eg, a food product) from changing over time.
The term "emulsify," as used herein, refers to an ingredient (eg, an ingredient in a food product) that prevents separation of emulsions. Emulsions are two immiscible substances, one present in the form of drops, contained within the other. Emulsions may consist of oil-in-water emulsions, in which the droplets or dispersed phase is oil and the continuous phase is water; or water-in-oil, in which water becomes the dispersed phase and the continuing phase is oil. Foams, which are gas-in-liquids and suspensions, which are solid-in-liquids, can also be stabilized through the use of emulsifiers. Aeration can occur in a three-phase system where the air is trapped by a liquid oil and then stabilized by agglomerated fat crystals stabilized with an emulsifier. Emulsifiers have a polar group with an affinity for water (hydrophilic) and a non-polar group that attracts oil (lipophilic). These are absorbed at the interfaces of the two substances, providing an interfacial film that acts to stabilize the emulsion. The hydrophilic / lipophobic properties of emulsifiers are affected by the structure of the molecule. These properties are identified by the hydrophilic / lipophobic balance (BHL) value. Low BHL values indicate higher lipophilic tendencies that are used to stabilize oil-petticoat emulsions. High BHL values are assigned to hydrophilic emulsifiers, typically used in oil-in-water emulsions. These values are derived from simple systems. Because foods often contain other ingredients that affect emulsifier properties, BHL values may not always be a reliable value for emulsifier selection.
As used herein, the term binder refers to an ingredient (eg, a food ingredient) that binds the product together through a physical or chemical reaction. During bonding, for example, water is absorbed, providing a bonding effect. However, binders can absorb into other liquids, such as oils, keeping them within the product. In the context of the present invention, binders would typically be used in solid or low moisture products, for example baked goods: cakes, donuts, bread and others.
The term "crystal modifier", as used herein, refers to an ingredient (eg, a food ingredient) that affects the crystallization of both fat and water. Ice crystal stabilization is important for two reasons. The first is directly related to the stability of the product from
ES 2 561 427 T3 from a separation perspective. The more freeze / thaw cycles a product encounters, the larger the ice crystals. These large crystals can break the structure of the product, both that found in nature, as in the case of cell walls, or that are created by union. Since the water is no longer held in place, the product may exhibit syneresis or oozing after thawing.
Second, in the case of a product eaten frozen, these large crystals give rise to an undesirable, gritty mouthfeel.
Vehicles or carriers means materials suitable for the administration of the compound and include any such material known in the art such as, for example, any liquid, gel, solvent, liquid diluent, solubilizer or the like, which are non-toxic and which do not interact with any. of the components of the composition in a pernicious way.
Examples of nutritionally acceptable vehicles include, for example, water, saline solutions, alcohol, silicone, waxes, petrolatum, vegetable oils, polyethylene glycols, propylene glycol, liposomes, sugars, gelatin, lactose, amylose, magnesium stearate, talc, surfactants, silicic acid , viscous paraffin, perfume oils, diglycerides and fatty acid monoglycerides, petroetheral fatty acid esters, hydroxymethyl cellulose, polyvinylpyrrolidone and the like.
Examples of excipients include one or more of: microcrystalline cellulose and other celluloses, lactose, sodium citrate, calcium carbonate, dibasic calcium phosphate, glycine, starch, milk sugar, and high molecular weight polyethylene glycols.
Examples of disintegrating agents include one or more of: starch (preferably corn, potato, or tapioca starch), sodium starch glycolate, croscarmellose sodium, and certain complex silicates.
Examples of granulation binders include one or more of: polyvinylpyrrolidone, hydroxypropylmethylcellulose (HPMC), hydroxypropylcellulose (HPC), sucrose, maltose, gelatin, and acacia.
Examples of lubricating agents include one or more of: magnesium stearate, stearic acid, glyceryl behenate, and talc.
Examples of diluents include one or more of: water, ethanol, propylene glycol, and glycerin and combinations thereof.
Other components can be used simultaneously (eg, when in admixture or even when administered by different routes) or sequentially (eg, they can be administered by different routes).
As used herein, the term "components suitable for animal or human consumption" means a compound that is or can be added to the composition of the present invention as a supplement that can provide a nutritional benefit, a fiber substitute, or provide a general effect. beneficial to the consumer. The ingredients can be used in a wide variety of products that require gelling, texturing, stabilization, suspension, film formation and structuring, retention of juiciness, without providing unnecessary viscosity. Preferably, the ingredients will be able to improve the shelf life and stability of the viable culture.
Illustratively, the components can be prebiotic agents such as alginate, xanthan, pectin, locust bean gum (LBG), inulin, guar gum, galacto-oligosaccharide (GOS), fructo-oligosaccharide (FOS), lactosaccharide, soy, palatinose, isomalto-oligosaccharides, gluco-oligosaccharides and xyl-oligosaccharides.
The composition of the present invention can be used as - or in the preparation of - a food. Here, the term food is used in a broad sense - and it covers food for human beings as well as food for animals (that is, a meal). In a preferred aspect, the food is for human consumption.
The food can be in the form of a solution or as a solid, depending on the use and / or the mode of application and / or the mode of administration.
When used as - or in the preparation of - a food - such as a functional food, the composition of the present invention can be used in conjunction with one or more of: a nutritionally acceptable carrier, a nutritionally acceptable diluent, a nutritionally acceptable excipient, a nutritionally acceptable adjuvant, a nutritionally active ingredient.
The composition of the present invention can be used as a food ingredient.
As used herein, the term "food ingredient" includes a formulation that is or can be added to functional or edible foods as a nutritional supplement and / or fiber supplement. The term food ingredient, as used herein, also refers to formulations that can be used at low levels in a wide variety of products that require gelling, texturing, stabilization,
ES 2 561 427 T3 suspension, film formation and structuring, retention of juiciness and better sensation on the palate, without adding viscosity.
The food ingredient can be in the form of a solution or as a solid - depending on the use and / or the mode of application and / or the mode of administration.
The composition of the present invention can be - or can be added to - food supplements.
The composition of the present invention can be - or can be added to - functional foods.
As used herein, the term "functional food" means a food that is capable of providing not only a nutritional effect and / or a taste satisfaction, but is also capable of providing a superior beneficial effect to the consumer.
Accordingly, functional foods are ordinarily foods that have components or ingredients (such as those described herein) incorporated within these that impart to the food a specific functional effect - for example medical or physiological benefit - other than a purely effect. nutritious.
Although there is no legal definition of a functional food, most parties with an interest in this area agree that there are foods in the market that have specific health effects.
Some functional foods are nutraceutical. Here, the term "nutraceutical" means a food that is capable of providing not only a nutritional effect and / or a taste satisfaction, but is also capable of supplying a therapeutic effect (or other beneficial effect) to the consumer. Nutraceuticals across the traditional lines of division between food and medicine.
Surveys have suggested that consumers place the greatest emphasis on functional food claims related to heart disease. Cancer prevention is another aspect of nutrition that consumers are very interested in, but surprisingly this is the area that consumers think they can exercise the least control over. In fact, according to the World Health Organization, at least 35% of cancer cases are related to diet. In addition, claims related to osteoporosis, intestinal health and the effects of obesity are also key factors that are likely to prompt the purchase of functional food and direct market development.
The composition of the present invention can be used in the preparation of food products such as one or more of: jams, marmalades, jellies, dairy products (such as milk or cheese), meat products, poultry products, fish products and bakery products.
Illustratively, the composition of the present invention can be used as ingredients for soft drinks, fruit juices or a beverage comprising whey protein, healthy teas, coca drinks, milk drinks and lactic acid bacteria drinks, yogurt and yogurt liquid, cheese, ice cream, ice cream and desserts, pastries, cookies and cakes, snacks, breakfast cereals, instant noodles and Cup Noodles, instant soups and cup soups, Balanced foods and beverages, sweeteners, better textured snacks, fiber bars, stable baking pastes, frostings, chocolate bakery filling, cheesecake flavoring filling, shortbread flavoring filling, cake and frosting from Masanut, thermos-stable bakery filling, instant bakery filling creams, cookie filling, ready-to-use bakery filling, hypocaloric filling, nutritional drink for adults, acidified soy / juice drink, aseptic / retort chocolate drink, bar mixes, beverage powders, calcium-supplemented soy / whole and chocolate milk, calcium-supplemented coffee drink.
A composition according to the present invention can further be used as an ingredient in food products such as American cheese sauce, anti-caking agent for shredded and shredded cheese, seasoned potatoes, cream cheese, fat-free sour cream with dry mixed whipped dressing , frozen / thawed milk whipping cream, frozen / thawed stable shakes, low-fat and light natural Cheddar cheese, Swiss-type low-fat yogurt, aerated frozen desserts and original bars, packaged ice cream, easy labeling, more economical and tolerant packaged ice creams, low-fat ice cream, creamy ice cream, barbecue sauce, sauce for melted cheese, cottage cheese dressing, dry mixed Alfredo sauce, mix sauce of cheeses, tomato sauce mixed dry and others.
For certain aspects, the edible is preferably a beverage.
For certain aspects, the edible is preferably a bakery product - such as bread, Danish pastries, cookies or cakes.
The present invention also provides a method for preparing a food or a food ingredient, the method comprising the xylanase produced by the process of the present invention or the composition according to the present invention with another food ingredient. The method of preparing a food ingredient is also another aspect of the present invention.
ES 2 561 427 T3
In a general sense, a polypeptide with xylanase activity of the invention can be used to solubilize and / or degrade insoluble materials of the arabinoxylan-containing plant cell wall, alter, for example reduce, the viscosity derived from the presence of hemicellulose or arabinoxylan in a solution or system comprising plant cell wall materials. Typically, such plant cell wall materials will comprise one or more xylanase inhibitors.
Specifically, a polypeptide with xylanase activity of the invention can be used in the processing of plant materials for use as edibles, such as animal feed, in the production of starch, in baking, in the production of bio-ethanol from material cellulosic and in the processing of wood pulp to make paper.
A polypeptide with xylanase activity of the invention can be used to process plant materials such as cereals that are used in foodstuffs including animal feed. As used herein, the term cereal means any type of grain used for food and / or any grass that produces this grain such as, but not limited to, any wheat, ground wheat, barley, corn, sorghum, rye, oats. , triticale and rice or their combinations. In a preferred embodiment, the cereal is a wheat cereal.
The xylan in the food and / or the food supplement is modified by contacting the xylan with the polypeptide with xylanase activity of the present invention.
As used herein, the term "reduce" includes, but is not limited to, spraying, coating, impregnating, or layering the food and / or food supplement with the xylanase-active polypeptide of the present invention.
In one embodiment, the food and / or food supplement of the present invention can be prepared by mixing the polypeptide with xylanase activity directly with a food and / or food supplement. Illustratively, the polypeptide with xylanase activity can be contacted (eg, by spraying) into a cereal-based food and / or food supplement such as ground wheat, corn or soy flour.
It is also possible to incorporate the polypeptide with xylanase activity into a second (and different) food and / or food or drinking water which is then added to the food and / or food supplement of the present invention. Accordingly, it is not essential that the polypeptide with xylanase activity provided by the present invention be incorporated into the cereal-based food and / or food supplement, although such incorporation forms a particularly preferred aspect of the present invention.
In one embodiment of the present invention, the food and / or food supplement can be combined with other food and / or food components to produce a cereal-based food and / or meal. Said other food and / or food components may include one or more other enzyme supplements (preferably thermostable), food with vitamins and / or food supplements, mineral food and / or food supplements and food with amino acids and / or food supplements. The resulting (combined) food and / or food supplement possibly comprising several different types of compounds can then be mixed in an appropriate amount with the other food and / or food components such as cereal and protein supplements to form a human food and / or an animal feed.
In a preferred embodiment, the food and / or food supplement of the present invention can be prepared by mixing different enzymes with the appropriate activities to produce an enzyme mixture. Illustratively, a cereal-based food and / or food supplement formed from, for example, ground wheat or corn can be contacted (eg, by spraying) both simultaneously or sequentially with the xylanase enzyme and other enzymes with appropriate activities. . These enzymes can include, but are not limited to, any one or more of an amylase, a glucoamylase, a mannanase, a galactosidase, a phytase, a lipase, a phospholipase, a galactolipase, a glucanase, an arabinofuranosidase, a feruliol esterase, a pectinase, a protease, a glucose oxidase, a hexose oxidase and a xylanase. Enzymes with the desired activities can be mixed for example with the xylanase of the present invention both before contacting these enzymes with a cereal-based food and / or food supplement or alternatively said enzymes can be contacted simultaneously or sequentially in each cereal-based supplement. The food and / or food supplement is then in turn mixed with a cereal-based food and / or meal to prepare the final food and / or meal. It is also possible to formulate the food and / or food supplement as a solution of the individual enzyme activities and then mix this solution with a food and / or food material before processing the food and / or food supplement into pellets or as a mixture.
The present invention provides the use of a polypeptide with xylanase activity of the invention in a process for preparing a foodstuff. Typical bakery (baked) products according to the present invention include bread - such as bars, rolls, buns, pizza bases, etc. - donuts, tortillas, cakes, cookies, crackers, crackers, etc. The preparation of foodstuffs, such as bakery products is well known in the art. Mass production, for example, is described in Example 4. The use of a polypeptide with xylanase activity of the invention to alter baking behavior is described in Example 4.
ES 2 561 427 T3
A polypeptide with xylanase activity of the invention can also be used in the production of starch from plant materials derived from cereals and tubers, such as potatoes.
A polypeptide with xylanase activity of the invention can also be used in the processing of wood pulp, for example, in the preparation of paper.
Processing of cellulosic material for the production of bio-ethanol
A polypeptide with xylanase activity of the invention can also be used in the hydrolysis of plant cellulosic materials for the production of fermentable sugars in bioethanol.
In some particular embodiments, the polypeptide with xylanase activity according to the invention has optimal xylanase activity at dough processing temperatures, such as in the range of about 20 to about 40 ° C. In some embodiments, the polypeptide with xylanase activity according to the invention is inactivated during the baking process.
In some alternative embodiments, the polypeptide with xylanase activity according to the invention has higher thermostability and / or optimum temperature when compared to the corresponding wild-type enzyme that retains activity after heat treatment. Both of these features are known to those of skill in the art.
Examples
Example 1 - Xylanase Directed Mutagenesis and Expression
Specific Bacillus subtilis xylanase mutants were obtained using a construct comprising the ribosome binding site from pET24a (ctagaaataattttgtttaactttaagaaggagatatacat) fused to the wild-type xylanase gene without the signal sequence (atggctagcacagactactggcaa -------- tggtagcacagactactggcaa) and were transferred to the pCRBlunt vector (InVitrogen, Carlsbad, CA, USA). This resulted in constitutive expression of xylanase in TOP10 cells (InVitrogen) after transformation with the constructed vector, provided the orientation of the gene is in a clockwise direction. The targeted mutation in the gene was then obtained using the QuickChange mutagenesis kit (Stratagene, La Jolla, CA, USA) according to the manufacturers protocol. Mutants were verified by sequencing. Sufficient production of the verified mutants was obtained by growing the transformed TOP10 cells in a volume of 1 L.
Example 2 - Bran solubilization studies of xylanase mutants
The inventors used wheat bran as a substrate to evaluate the specific activity of xylanase variants as it is used in commercial applications.
Bran substrate:
As an example, the bran could be wheat bran obtained from dry milling of wheat using a laboratory-scale Chopin CD Auto-mill (Chopin Technologies, France), using the parameters and conditions provided by the supplier, to grind the wheat into the wheat flour and the bran. The obtained bran fraction can be used as a substrate in the bran solubilization test. In this Example, wheat was used as the cereal source.
Bran solubilization test:
A suspension of wheat bran in buffer (0.1 M) - di-sodium hydrogen phosphate (0.2 M), pH 5.0 is prepared at a bran concentration of 1.33% (w / w) . From this suspension, 750 ml aliquots are transferred into Eppendorph tubes with shaking. Each tube of substrate is preheated for 5 minutes at 40 ° C. From there, 250 ml of enzyme solution are added, making the final substrate concentration 1%. Three dilutions (in duplicate) are prepared from each of the xylanases, increasing the enzymatic concentration (0.33, 1.0 and 3.0 mg xylanase / grams of bran) at each determination time (0.30, 60 and 240 minutes). As a control, a heat denatured solution of the xylanase is used. The reaction is terminated at the given times by transferring the tubes to an incubator set at 95 ° C. Heat denatured samples are kept at 4 ° C until all enzymatic reactions are complete. When all enzymatic reactions are complete, the Eppendorph tubes are centrifuged to obtain a clear supernatant. The ability of the enzymes to solubilize the bran is expressed as the increase in OD410, determined by the increase in the reduction of the end groups using PAHBAH reagents (Lever, 1972).
Briefly, the resulting reduction in end groups is reacted with PAHBAH to form a colored reaction product, which can be quantified to an OD of OD410.
The above bran solubilization assay is sensitive to the secondary activity of active enzymes in residual starch on the bran substrate.
ES 2 561 427 T3
Bacillus subtilis xylanase purification protocol:
E. coli TOP10 cells that had expressed xylanase were harvested by centrifugation (20 minutes, 3500 xg, 20 ° C) and resuspended in 50 mM Tris, 2 mM EDTA, pH 7.4. The cells were opened by adding 1 mg / ml of lysozyme (ICN Biomedicals, Costa Mesa, CA, USA, Cat. No. 100831), shaking the mixture for 2 hours at room temperature, freezing and thawing , followed by sonication. The pH was adjusted to 4.0 using 1M HCl followed by centrifugation (20 minutes, 3500 xg, 20 ° C). The supernatant containing the xylanase was desalted using PD-10 disposable desalting columns (Amersham Bioscience, Sweden) equilibrated and eluted with 50 mM sodium acetate, pH 4.5. The desalted sample was loaded onto a 10 ml SOURCE 15S column (Amersham Bioscience, Sweden) pre-equilibrated with 50 mM sodium acetate, pH 4.5. The column was then washed with equilibration buffer and eluted with a linear NaCl gradient (50 mM sodium acetate, 0.35 M NaCl, pH 4.5). The fractions containing xylanase activity were pooled and used for further analysis.
Similar protocols can be adapted to xylanase variants derived from XynA from other than Bacillus subtilis with a significantly different pI from Bacillus subtilis XynA.
Table 1. Xylanase bran solubilization activity expressed as, maximum optical density, the slope index of xylanase mutants, relative to optical density and slope compared to BS1 xylanase (Bacillus s ubtilis enzyme shown as SEQ.ID No. 1) and BS3 xylanase (the Bacillus subtilis variant shown as SEQ.ID No. 23)
<td>Modifications made to SEQ. ID N ° 1</td><td>Slope OD / h</td><td>Maximum OD</td><td>Relative slope versus BS1</td><td>OD Max. relative to BS1</td><td>Relative slope versus BS3</td><td>OD Max. relative to BS3</td>
<td>None (BS1)</td><td> 0,23</td><td> 0,69</td><td> 100</td><td> 100</td><td> 140</td><td> 140</td>
<td>D11F / R122D (BS3)</td><td> 0,16</td><td> 0,49</td><td> 72</td><td> 72</td><td> 100</td><td> 100</td>
<td>D11F / R122D / T110 A</td><td> 0,25</td><td> 0,75</td><td> 110</td><td> 110</td><td> 154</td><td> 154</td>
<td>D11F / R122D / T110 A / Y113A</td><td> 0,27</td><td> 0,80</td><td> 117</td><td> 117</td><td> 163</td><td> 163</td>
<td>G13Y / T110A / Y113 D / R122D / Q175L</td><td> 0,27</td><td> 0,82</td><td> 119</td><td> 119</td><td> 167</td><td> 167</td>
<td>G13Y / T110A / Y113 D / R122F / Q175L</td><td> 0,37</td><td> 1,12</td><td> 164</td><td> 164</td><td> 229</td><td> 229</td>
<td>G13Y / G34K / T110A / Y113D / R122D / Q1 75L</td><td> 0,25</td><td> 0,74</td><td> 108</td><td> 108</td><td> 150</td><td> 150</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R12 2F / K154R / N159D / Q175K</td><td> 0,37</td><td> 1,11</td><td> 162</td><td> 162</td><td> 226</td><td> 226</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175 / V81I</td><td> 0,29</td><td> 0,87</td><td> 128</td><td> 128</td><td> 178</td><td> 178</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Y166F / Q175L</td><td> 0,39</td><td> 1,18</td><td> 172</td><td> 172</td><td> 241</td><td> 241</td>
<td>G13Y / T110A / Y113D / R122D / K154R / N159D / Q175L</td><td> 0,40</td><td> 1,19</td><td> 173</td><td> 173</td><td> 242</td><td> 242</td>
ES 2 561 427 T3
<td>Modifications made to SEQ. ID N ° 1</td><td>Slope OD / h</td><td>Maximum OD</td><td>Relative slope versus BS1</td><td>OD Max. relative to BS1</td><td>Relative slope versus BS3</td><td>OD Max. relative to BS3</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 0,37</td><td> 1,11</td><td> 162</td><td> 162</td><td> 226</td><td> 226</td>
<td>G13Y / T110A / Y113D / R122D / S162E / Q175L</td><td> 0,18</td><td> 0,53</td><td> 78</td><td> 78</td><td> 109</td><td> 109</td>
<td>G13Y / T110A / Y113D / R122D / S162D / Q175L</td><td> 0,28</td><td> 0,83</td><td> 121</td><td> 121</td><td> 169</td><td> 169</td>
<td>G13Y / T110A / Y113D / R122D / W164F / Q175L</td><td> 0,28</td><td> 0,83</td><td> 121</td><td> 121</td><td> 169</td><td> 169</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175L</td><td> 0,34</td><td> 1,02</td><td> 149</td><td> 149</td><td> 208</td><td> 208</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175L</td><td> 0,35</td><td> 1,04</td><td> 152</td><td> 152</td><td> 212</td><td> 212</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L</td><td> 0,38</td><td> 1,15</td><td> 169</td><td> 169</td><td> 235</td><td> 235</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / I118V / R122F / K154R / N159D / Q175L</td><td> 0,21</td><td> 0,63</td><td> 92</td><td> 92</td><td> 128</td><td> 128</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175K</td><td> 0,33</td><td> 0,98</td><td> 144</td><td> 144</td><td> 201</td><td> 201</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175K</td><td> 0,35</td><td> 1,05</td><td> 153</td><td> 153</td><td> 214</td><td> 214</td>
<td>G13Y / I77L / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 0,31</td><td> 0,93</td><td> 136</td><td> 136</td><td> 190</td><td> 190</td>
ES 2 561 427 T3
<td>Modifications made to SEQ. ID N ° 1</td><td>Slope OD / h</td><td>Maximum OD</td><td>Relative slope versus BS1</td><td>OD Max. relative to BS1</td><td>Relative slope versus BS3</td><td>OD Max. relative to BS3</td>
<td>G13Y / I77M / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 0,22</td><td> 0,67</td><td> 98</td><td> 98</td><td> 137</td><td> 137</td>
<td>G13Y / I77V / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 0,23</td><td> 0,69</td><td> 101</td><td> 101</td><td> 141</td><td> 141</td>
<td>G13Y / I77Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 0,27</td><td> 0,80</td><td> 117</td><td> 117</td><td> 163</td><td> 163</td>
Example 3 - Analysis of xylanase activity and relative inhibition by cereal xylanase inhibitors
The mutants of Example 2 were analyzed for xylanase activity and relative sensitivity to a xylanase inhibitor using the protocols presented below and according to the following guidelines.
Xylanase assay (endo-p-1,4-xylanase activity)
Samples were diluted in citric acid (0.1 M) - di-sodium hydrogen phosphate buffer (0.2 M), pH 5.0, to obtain approx. OD590 = 0.7 in this test. Three different dilutions of the sample were pre-incubated for 5 minutes at 40 ° C. At a time = 5 minutes, 1 Xylazyme tablet (cross-linked, stained xylan substrate, Megazyme, Bray, Ireland) was added to the enzyme solution in a reaction volume of 1 ml. At time = 15 minutes, the reaction was terminated by adding 10 ml of TRIS / 2% NaOH, pH 12. Controls were prepared using 1000 ml of buffer instead of the enzyme solution. The reaction mixture was centrifuged (1500 xg, 10 minutes, 20 ° C) and the OD of the supernatant was measured at 590 nm. One unit of xylanase (UX) is defined as xylanase activity increasing OD590 by 0.025 per minute.
Determination of specific activity:
The optical density at 280 nm of the purified samples was measured to determine the xylanase protein concentration. A theoretically calculated specific OD280 (Gasteiger et al., 2003) of 0.25 units / mg x ml was used to test the calculation of the specific activity of the Bacillus subtilis XynA-derived variants. Xylanase activity was determined as described above.
Xylanase Inhibitor Assay
A 100 ml inhibitor preparation (containing various concentrations of xylanase inhibitor (for quantification, see quantification of xylanase inhibitor below)), 250 ml of xylanase solution (containing 12 Xylanase UX / ml) were mixed. ) and 650 ml of buffer (0.1 M citric acid - 0.2 M disodium hydrogen phosphate buffer, 1% BSA (Sigma-Aldrich, USA), pH 5.0). The mixture was thermostatted for 5 minutes at 40.0 ° C. At time = 5 minutes, a Xylazyme tablet (cross-linked, stained xylan substrate, Megazyme, Bray, Ireland) was added. At a time = 15 minutes, the reaction was terminated by adding 10 ml of TRIS / 2% NaOH, pH 12. The reaction mixture was centrifuged (1500 xg, 10 minutes, 20 ° C) and the supernatant was measured at 590 nm . Xylanase inhibition was calculated as% residual activity, compared to control. Controls were prepared in the same way, but replacing the inhibitor solution with water.
Quantification of the xylanase inhibitor:
UIX (Xylanase Inhibitor Unit) is defined as the amount of inhibitor that decreases by 1 UX of Bacillus subtilis XynA xylanase (Seq ID No 1) to 0.5 UX under the conditions described below.
ES 2 561 427 T3
250 ml of xylanase solution containing 12 UX / ml, approx. 100 ml of xylanase inhibitor solution and McIlvaine buffer, pH 5, to achieve a reaction volume of 1000 ml is pre-incubated for 5 minutes at 40 ° C. At = 5 minutes, 1 Xylazyme tablet is added to the reaction mixture. At t = 15 minutes, the reaction is terminated by adding 10 ml of TRIS / 2% NaOH, pH 12. The solution is filtered and the absorbance of the supernatant is measured at 590 nm. By choosing several different inhibitor concentrations in the above assay, it is possible to create a plot of OD versus inhibitor concentration. Using the slope (a) and the cut with the axis (b), from this plot and the concentration of the xylanase, it is possible to calculate the amount of UIX in a given inhibitor solution (equation 1).
Equation 1 UIX = ((b / 2) / - a) / x
X = Units of xylanase (UX) in the assay
Inhibitor preparation:
A crude inhibitor preparation (containing both TAXI and XIP, hereinafter referred to as inhibitor preparation) was prepared from 1 kg of wheat flour (Triticum aestivum). The inhibitor preparation was extracted from the flour using water in a 1: 3 (w / w) ratio followed by centrifugation (3500 xg, 20 minutes, 4 ° C). The extract was kept at 65 ° C for 40 minutes, centrifuged (3500 xg, 20 minutes, 4 ° C) and desalted using disposable PD-10 desalting columns (Amersham Bioscience, Sweden) pre-equilibrated with sodium phosphate buffer 20 mM, pH 7. The concentration of TAXI in the inhibitor preparation was determined as described above. The protocol for the purification and quantification of TAXI is described elsewhere (Sibbesen and Sorensen, 2001). As an example only, the TAXI in the preparation could be SEQ ID No. 24 or a sequence with 90% identity thereto.
TABLE 2. Xylanase activity (UX / mg) and xylanase inhibitor sensitivity of the mutants indicated as residual xylanase activity at increasing concentrations of xylanase inhibitor (UIX / ml assay).
<td>Modifications made to SEQ ID No. 1</td><td>Specific Activity UX / mg</td><td>% Activity @ 5.6 IUX / ml</td><td>% Activity @ 33.5 UIX / ml</td><td>% Activity @ 50 UIX / ml</td>
<td>None (BS1)</td><td> 23,000</td><td> 29</td><td></td><td></td>
<td>D11F R122D (BS3)</td><td> 8,400</td><td> 100</td><td> 100</td><td> 95</td>
<td>D11F / R122D / T110A</td><td> 14,992</td><td> 98</td><td> 100</td><td></td>
<td>D11F / R122D / T110A / Y113A</td><td> 13,362</td><td> 99</td><td></td><td></td>
<td>G13Y / T110A / Y113D / R122D / Q175L</td><td> 59,571</td><td> 50</td><td></td><td></td>
<td>G13Y / T110A / Y113D / R122F / Q175L</td><td> 53,855</td><td></td><td> 65</td><td></td>
<td>G13Y / G34K / T110A / Y113D / R122D / Q175L</td><td> 15,876</td><td></td><td> 97</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175K</td><td> 47,975</td><td></td><td> 72</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175 / V81I</td><td> 41,791</td><td></td><td> 46</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Y166F / Q175L</td><td> 53,331</td><td></td><td> 68</td><td></td>
<td>G13Y / T110A / Y113D / R122D / K154R / N159D / Q175L</td><td> 54,924</td><td></td><td> 32</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 54,811</td><td></td><td> 64</td><td></td>
<td>G13Y / T110A / Y113D / R122D / S162E / Q175L</td><td> 55,249</td><td></td><td> 44</td><td></td>
<td>G13Y / T110A / Y113D / R122D / S162D / Q175L</td><td> 52,735</td><td></td><td> 40</td><td></td>
ES 2 561 427 T3
<td>Modifications made to SEQ ID No. 1</td><td>Specific Activity UX / mg</td><td>% Activity @ 5.6 IUX / ml</td><td>% Activity @ 33.5 UIX / ml</td><td>% Activity @ 50 UIX / ml</td>
<td>G13Y / T110A / Y113D / R122D / W164F / Q175L</td><td> 51,884</td><td></td><td> 29</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175L</td><td> 47,445</td><td></td><td> 79</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175L</td><td> 46,263</td><td></td><td> 78</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L</td><td> 42,077</td><td></td><td> 79</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / I118V / R122F / K154R / N159D / Q175L</td><td> 27,363</td><td></td><td> 79</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175K</td><td> 35,906</td><td></td><td> 84</td><td></td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175K</td><td> 46,939</td><td></td><td> 79</td><td></td>
<td>G13Y / I77L / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 48,177</td><td></td><td> 75</td><td></td>
<td>G13Y / I77M / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 28,412</td><td></td><td> 46</td><td></td>
<td>G13Y / I77S / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 12,003</td><td></td><td> 20</td><td></td>
<td>G13Y / I77V / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 35,907</td><td></td><td> 45</td><td></td>
<td>G13Y / I77Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 33,236</td><td></td><td> 37</td><td></td>
Example 4 - Baking behavior of mutants
Baking was done using a small-scale Danish roll recipe (Table 3), using both wheat flour and whole wheat flour.
Table 3 Recipe used for the production of bread.
<td>Ingredients</td><td>Mini skala</td>
<td colspan="2">ml og</td>
<td>Flour</td><td> 50</td>
<td>Dry yeast</td><td> 1</td>
<td>Salt</td><td> 0,8</td>
<td>Sugar</td><td> 0,8</td>
<td>Water</td><td>400 BU - 2%</td>
Note: Water is water absorption @ 400BU determined by farinograph analysis of flour (i.e. a maximum dough consistency of 400 - added water based on water absorption determination using a Brabrender farinograph, Brabender, Germany). If the enzymes are added to the donut, they are added as a liquid solution and by substituting the same amount of water.
ES 2 561 427 T3
Preparation of the dough and baking
The flour and dry ingredients were mixed for one minute in a 50 gram farinograph (Brabender, Duisburg, Germany); thereafter water was added and mixing was continued for another five minutes.
After mixing, four lumps of dough were prepared, each containing 10 grams of flour. These were molded into bread using a hand moulder. The loaves were put into baking trays and placed in a sealed container (with a lid) and allowed to stand at room temperature for 10 minutes. From this, the loaves were tested at 34 ° C, 85% relative humidity (RH), for 45 minutes and finally baked at 230 ° C for five minutes in a Bago oven (Bago-line, Faborg, Denmark) .
The loaves were chilled for 20 minutes before evaluation (weight, volume measurement, crumb and crust evaluation).
Table 4 Baking behavior of mutants - increase in bread volume (ml / g) and relative volume compared to the control (without added enzyme) and BS3 (SEQ ID No. 1 with modifications D11F and R122D) that show a behavior of superior baking compared to XynA wild-type xylanase from Bacillus sub. 15 (SEQ ID No. 1).
<td>Modifications made to Seq ID No 1</td><td>Vol. Of bread @ 0.04 mg / kg of flour</td><td>Increase in vol. relative vs. control, %</td><td>Increase in vol. relative vs. BS3,%</td>
<td>G13Y / G34K / T110A / Y113D / R122D / Q175L</td><td> 4,22</td><td> 41,89</td><td> 20</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175K</td><td> 2,90</td><td> 21,93</td><td> 7,54</td>
<td>G13Y / V81I / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 2,80</td><td> 18,02</td><td> 4,09</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Y166F / Q175L</td><td> 2,82</td><td> 18,86</td><td> 4,83</td>
<td>G13Y / T110A / Y113D / R122D / K154R / N159D / Q175L</td><td> 2,81</td><td> 18,08</td><td> 4,15</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 2,89</td><td> 21,74</td><td> 7,24</td>
<td>G13Y / T110A / Y113D / R122D / S162E / Q175L</td><td> 2,75</td><td> 13,55</td><td> 1,99</td>
<td>G13Y / T110A / Y113D / R122D / S162D / Q175L</td><td> 2,82</td><td> 15,54</td><td> 4,48</td>
<td>G13Y / T110A / Y113D / R122D / W164F / Q175L</td><td> 2,78</td><td> 14,02</td><td> 3,10</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175L</td><td> 2,81</td><td> 16,44</td><td> 4,11</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175L</td><td> 2,73</td><td> 13,26</td><td> 1,26</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L</td><td> 2,80</td><td> 16,22</td><td> 3,74</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / I118V / R122F / K154R / N159D / Q175L</td><td> 2,83</td><td> 17,58</td><td> 4,95</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175K</td><td> 2,89</td><td> 20,65</td><td> 7,34</td>
ES 2 561 427 T3
<td>Modifications made to Seq ID No 1</td><td>Vol. Of bread @ 0.04 mg / kg of flour</td><td>Increase in vol. relative vs. control, %</td><td>Increase in vol. relative vs. BS3,%</td>
<td>G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175K</td><td> 2,77</td><td> 14,73</td><td> 2,63</td>
<td>G13Y / I77L / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 2,81</td><td> 15,08</td><td> 4,32</td>
<td>G13Y / I77M / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 2,70</td><td> 12,43</td><td> 0,17</td>
<td>G13Y / I77S / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 2,53</td><td> 5,40</td><td> (6,09)</td>
<td>G13Y / I77V / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 2,60</td><td> 8,19</td><td> (3,63)</td>
<td>G13Y / I77Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td><td> 2,73</td><td> 13,81</td><td> 1,38</td>
Example 5 - Effect of the modification of residue 110 in Bacillus subtilis XynA xylanase (SEQ ID NO. 1) or equivalent position in other xylanases of family 11.
Xylanases:
The mutated xylanases in this example are Bacillus subtilis XynA wild-type xylanase (SEQ ID No. 1), a variant of Trichoderma reesei Xyn2 xylanase (SEQ ID No. 2), and Thermomyces XynA wild-type xylanase. lanuginosus (sEq ID No. 3).
The mutated residue is T110 in Bacillus subtilis XynA wild-type xylanase (SEQ ID No. 1), the equivalent position, T120, in Trichoderma reesei xylanase (SEQ ID No. 2) and the equivalent position, T120, in XynA wild-type xylanase from Thermomyces lanuginosus (SEQ ID No. 3). The following mutations were prepared in Bacillus subtilis XynA wild-type xylanase (SEQ ID No. 1): T110H, T110Y, T110S, T110R, T110F, T110Q, T110G, T110K, T110L, T110M, T110I, T110T, T110N, T110E, T110W, T110A and T110C. In both Trichoderma reesei xylanase (SEQ ID No. 2) and Thermomyces lanuginosus XynA wild-type xylanase (SEQ ID No. 3) the equivalent position, T120, was mutated. The mutations made are for the amino acids of alanine.
Mutations, expression, purification and determination of the specific activity of wild-type xylanases or their variants are carried out as described in Examples 1, 2 and 3. Except for purification of the Trichoderma xylanase variant reesei, the Thermomyces lanuginosus XynA wild-type xylanase and its variant T120A; here the purification protocol was modified to reflect its pI.
Table 5. Specific activity determined as xylanase protein in UX / mg of Bacillus subtilis XynA wild-type xylanase (SEQ ID No. 1), Bacillus subtilis XynA xylanase variant (T110A), Trichoderma reesei xylanase (SEQ ID No. 2), the Xyn2 xylanase variant from Trichoderma reesei (T120A), the wild-type XynA xylanase from Thermomyces lanuginosus (SEQ ID NO. 3), and the XynA xylanase variant from Thermomyces lanuginosus (T120A) .
<td>Xylanase</td><td>Specific activity, UX / mg</td>
<td>Bacillus subtilis XynA wild-type xylanase (SEQ ID No. 1)</td><td> 23.000</td>
<td>Bacillus subtilis XynA xylanase variant (T110A)</td><td> 25874</td>
<td>Bacillus subtilis XynA xylanase variant (T110N)</td><td> 23104</td>
<td>Bacillus subtilis XynA xylanase variant (T110E)</td><td> 24782</td>
<td>Bacillus subtilis XynA xylanase variant (T110W)</td><td> 25478</td>
<td>Bacillus subtilis XynA xylanase variant (T110C)</td><td> 26390</td>
<td>Trichoderma reesei xylanase (SEQ ID No. 2)</td><td> 17.500</td>
<td>Trichoderma reesei xylanase variant (T120A)</td><td> 36797</td>
<td>XynA wild-type xylanase from Thermomyces lanuginosus (SEQ ID No 3)</td><td> 31.300</td>
<td>XynA xylanase variant from Thermomyces lanuginosus (T120A)</td><td> 36066</td>
ES 2 561 427 T3
In all cases, the T110A mutation in Bacillus subtilis XynA wild-type xylanase (SEQ ID No. 1) or the equivalent position (T120) in Trichoderma reesei xylanase (SEQ ID No. 2) or wild-type xylanase of XynA from Thermomyces lanuginosus (SEQ ID No 3) results in significantly higher specific activity.
In Bacillus subtilis XynA wild-type xylanase (SEQ ID No. 1) also mutations T110E, T110N, T110W, and T110C result in increased specific activity. Although the present invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. In fact, various modifications of the described modes of carrying out the invention that are obvious to those skilled in biochemistry and biotechnology or related fields are intended to fall within the scope of the following claims.
Example 6 - Activity of xylanase variants on water insoluble substrate versus insoluble substrate.
Xylanase variants of BACSU_XynA and TRIRE_Xyn2 were generated using xylanase site-directed mutagenesis and expression in E. coli.
Assay to determine the activity in non-extractable substrate with water, act. WU-AX (insoluble substrate):
Samples were diluted in citric acid (0.1 M) - di-sodium hydrogen phosphate buffer (0.2 M), pH 5.0, to obtain approx. an OD590 = 0.7 in this test. Three different dilutions of the sample were pre-incubated for 5 minutes at 40 ° C. At a time = 5 minutes, 1 Xylazyme tablet (cross-linked, stained xylan substrate, Megazyme, Bray, Ireland) was added to the enzyme solution in a reaction volume of 1 ml. At time = 15 minutes, the reaction was terminated by adding 10 ml of TRIS / 2% NaOH, pH 12. Controls were prepared using 1000 ml of buffer instead of enzyme solution. The reaction mixture was centrifuged (1500 xg, 10 minutes, 20 ° C) and the OD of the supernatant was measured at 590 nm. One xylanase unit (WU-AX act) is defined as xylanase activity increasing OD590 by 0.025 per minute.
The substrate (arabinoxylan extracted from wheat, cross-linked and dyed) used in the above test is a good approximation to the corresponding substrate in commercial applications.
The following assay was used to determine activity on water-extractable substrate, WE-AX act (soluble substrate).
The method used is a modified version of the method described by Lever (Lever, M. Analytical Biochemistry, 47, 273-279, 1972). Soluble wheat arabinoxylan (medium viscosity, obtainable from Megazyme, Bray, Ireland) was used as a substrate in a buffer system containing 50 mM NaOAc, pH 5. The substrate concentration was 0.5%. Xylanase activity was measured by quantifying the formation of reducing ends using PAHBAH reagents. The amount of reducing ends formed and thus the xylanase activity was determined from a xylose standard curve. Hereinafter referred to as act. by WE-AX.
Structures used to develop new variants:
Table 6 shows the variant xylanase structures used. Y5 corresponds to SEQ ID NO. two.
<td>ID</td><td>Variant</td>
<td> #154</td><td>BACSU_XynA- G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L</td>
<td> #160</td><td>BACSU_XynA- G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L</td>
<td>Y5</td><td>TRIRE_Xyn2-T2C / T28C / K58R / + 191D</td>
<td>Y5-T120A</td><td>TRIRE_Xyn2-T2C / T28C / K58R / T120A / + 191D</td>
The mutations introduced and the results obtained are illustrated in Table 7.
Table 7 Mutations introduced and results obtained. The structures used are in bold.
<td>Mutant</td><td>act of WU-AX</td><td>act of WE-AX</td><td>WU-AX / WE-AX</td>
<td># 154 / N141Q</td><td> 1,965</td><td> 13</td><td> 146</td>
<td># 154 / N54Q / N141Q</td><td> 1,611</td><td> 10</td><td> 159</td>
<td># 160 / N54Q</td><td> 1,203</td><td> 7</td><td> 161</td>
<td># 160 / N141Q</td><td> 1,785</td><td> 10</td><td> 175</td>
<td># 154 / N54W / N141Q</td><td> 824</td><td> 7</td><td> 118</td>
<td># 160 / N54W / N141Q</td><td> 1,005</td><td> 6</td><td> 169</td>
ES 2 561 427 T3
<td>Mutant</td><td>act of WU-AX</td><td>act of WE-AX</td><td>WU-AX / WE-AX</td>
<td>Y5 / S63W</td><td> 918</td><td> 25</td><td> 36</td>
<td>Y5</td><td> 35,550</td><td> 1,487</td><td> 24</td>
<td> #154</td><td> 10,350</td><td> 106</td><td> 98</td>
<td> #160</td><td> 5,400</td><td> 34</td><td> 157</td>
Sequence listing (amino acids in bold are the amino acid, which corresponds to T110 of SEQ ID No.1):
The amino acid sequence of mature Bacillus subtilis wild-type xylanase (SEQ ID No 1):
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRT
INYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTT
TRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQV MA TEGYQSSGSSNVTVW
The amino acid sequence of the mature xylanase from Trichoderma reesei (SEQ ID No. 2), also referred to herein as Y5:
QCIQPGTGYNNGYFYSYWNDGHGGVTYCNGPGGQFSVNWSNSGNFVGGKGWQPGTKN
RVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIY
RTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVE GYFSSGSASITVSD
The amino acid sequence of XynA wild-type mature xylanase from Thermomyces lanuginosus (SEQ ID No. 3):
QTTPNSEGWHDGYYYSWWSDGGAQATYTNLEGGTYEISWGDGGNLVGGKGWNPGLNA RAIHFEGVYQPNGNSYLAVYGWTRNPLVEYYIVENFGTYDPSSGATDLGTVECDGSIYRLG KTTRVGGNLVGGKGWNPGLNA RAIHFEGVYQPNGNSYLAVYGWTRNPLVEYYIVENFGTYDPSSGATDLGTVECDGSIYRLG KTTRVGGNLVGGKGWNPGLNA RAIHFEGVYQPNGNSYLAVYGWTRNPLVEYYIVENFGTYDPSSGATDLGTVECDGSIYRLG KTTRVEGRDAPSIDQDYWNGSQRFCHTVDAPSIDQDYWNGTSVKFCHTVDAPSIDGTQRTSNGTV
The amino acid sequence of mature xylanase from Streptomyces viridosporus (Seq ID No 4):
WTDAQGTVSMDLGSGGTYSTQWRNTGNIFVAGKGWSTGGRKTVNYSGTFNPSGNAYLT LYGWTTGPLIEYYIVDNWGTYRPTGKYKGTVTSDGGTYDIYKTTRYNAPSIEGTKTFDQYWMRGNWNGSIMGTISATGMHGNDAQTVSIMGTYRPTGMHGNDA
Seq ID No 5 (gi | 139868 | sp | P18429.1 | XYNA BACSU RecName: Full = Endo-1,4-beta-xylanase A; Short = xylanase; A; Alt Name: Full = 1,4-beta- D-xylan xylanhydrolase A):
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNW
5NTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTR5PLIEYYVVDSWGTYR
PTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTOYWSVROSKRPTGSNATITFSNH
VNAWKSHGMNLGSNWAYOVMATEGYO5SGSSNVTVW
Seq ID No 6 (gi | 2302074 | emb | CAA03092.11 protein product not named [not identified]):
ES 2 561 427 T3
MROKKLTLILAFLVCFALTLPAEIIOAOIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGG
TFSAOWNNVNNILFRKGKKFNETOTHOOVGNMSINYGANFQPNGNAYLCVYGWTVDPLV
EYYIVDSWGNWRPPGATPKGTITVDGGTYDIYETLRVNOPSIKGIATFKOYW5VRRSKRT
SGTISVSNHFRAWENLGMNMGKMYEVALTVEGYOSSGSANVYSNTLRINGNPLSTISND E5ITLDKNN
Seq ID No 7 (g¡ | 167246404 | gb | ABZ24364.11 Sequence 5 of US patent 7314743):
MVSFTSLLAASPPSRASCRPAAEVESVAVEKROTIQPGTGYNNGYFYSYWNDGHGGVTYT
NGPGGOFSVNWSNSGNFVGGKGWOPGTKNKVINFSGSYNPNGNSYL5VYGWSRNPLJE
YYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTORVNOPSIIGTATFYQYWSVRRNHRSS
GSVNTANHFNAWAOOGLTLGTMDYOIVAVEGYFS5GSASITVS
Seq ID No 8 (g¡ | 5969551 | gb | AAE10889.11 Sequence 2 of US patent 5817500):
MVGFTPVALAALAATGALAFPAGNATELEKROTTPNSEGWHDGYYYSWWSDGGAQATYT
NLEGGTYEISWGDGGNLVGGKGWNPGLNARAIHFEGVYOPNGNSYLAVYGWTRNPLVEY
YIVENFGTYDPSSGATDLGTVECDGSIYRLGKTTRVNAPSIDGTOTFDQYWSVRODKRTS
GTVOTGCHFDAWARAGLNVNGDHYYQIVATEGYFSSGYARITVADVG
Seq ID No 9 (gi | 76059070 | emb | CAJ30753.11 unnamed protein product [Paeníbacíllus pabuli]) '.
MFKFGKKLLTWLAASMSFGVFAATTGATDYWONWTDGGGTVNAVNGSGGNYSVNWO
NTGNFVVGKGWTYGTPNRVVNYNAGVFSP5GNGYLTFYGWTRNALIEYYWDNWGTYRP
TGTYKGTVTSDGGTYDIYTTM RYNQPSIDGYSTFPOYWSVROSKRPIGVNSOITFQNHVN
AWASKGMYLGNSWSYOVMATEGYOSSGSSNVTVW
Seq ID No 10 (gi | 74197761 | emb | CAJ29666.1 | unnamed protein product [Bacillus halodurans]):
MFKFVTKVLTVVIAATISFCLSAVPASANTYWOYWTDGGGTVNATNGPGGNYSVTWRDT
GNFVVGKGWEIGSPNRTIHYNAGVWEPSGNGYLTLYGWTRNOLIEYYVVDNWGTYRPTG
THRGTWSDGGTYDIYTTMRYNAPSIDGTOTFOQFWSVROSKRPTGNNVSITFSNHVNA
WRNAGMNLGSSWSYOVLATEGYOSSGRSNVTVW
Seq ID No 11 (gi | 4756811 | emb | CAB42305.11 protein product not named [not identified]):
MROKKLTFILAFLVCFALTLPAEIIOAOIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGG
TFSAOWNNVNNILFRKGKKFNETQTHOOVGNMSINYGANFQPNGNAYLCVYGWTVDPLV
EYYIVDSWGNWRPPGATPKGTITVDGGTYDIYETLRVNOP5IKGIATFKOYW5VRRSKRT
SGTISVSNHFRAWENLGMNMGKMYEVALTVEGYOSSGSANVY5NTLRINGNPLSTISND KSITLDKNN
Seq ID No 12 (gi | 2293951 | emb | CAA02246.11 unnamed protein product [Bacillus subtilis] from Bacillus subtilis:
(US document 5306633)):
ES 2 561 427 T3
MFKFKKKFLVGLTAAFMSISMFSATASAAGTDYWQNWTDGGGTVNAVNGSGGNYSVNW
SNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYR
PTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDNTTFTOYWSVROSKRPTGSNAAITFSNH
VNAWKSHGMNLGSNWAYQVLATEGYKSSGSSNVTVW
Seq ID No 13 (gi | 42688917 | gb | AAS31735.11 Sequence 14 of US patent 6682923):
MNLRKLRLLFVMCIGLTLILTAVPAHARTITNNEMGNHSGYDYELWKDYGNTSMTLNNGG
AFSAGWNNIGNALFRKGKKFDSTRTHHQLGNISINYNASFNPGGNSYLCVYGWTOSPLAE
YYIVDSWGTYRPTGAYKGSFYADGGTYDIYETTRVNOPSIIGIATFKQYWSVROTKRTSGT
VSVSAHFRKWESLGMPMGKMYETAFTVEGYO5SGSANVMTNOLFIGN
Seq ID No 14 (gi | 10040204 | emb | CAC07798.1 | unnamed protein product [Penicillium funiculosum]) '.
MKLFLAAIVLCATAATAFPSELAQRAAGDLSKRQSITTSOTGTNNGYYYSFWTNGGGEVTY
TNGDNGEY5VTWVDCGDFTSGKGWNPANAOTVTY5GEFNPSGNAYLAVYGWTTDPLVE
YYILESYGTYNPSSGLTSLGOVTSDGGTYDIYSTORVNOPSIEGTSTFNOYWSVRTEKRVG
GTVTTANHFAAWKALGLEMGTYNYMIV5TEGYE55GSSTITV5
Seq ID No 15 (gi | 2302074 | emb | CAA03092.11 protein product not named [not identified]):
OIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGGTFSAOWNNVNNILFRKGKKFNETQT
HOQVGNMSINYGANFOPNGNAYLCVYGWTVDPLVEYYIVDSWGNWRPPGATPKGTITVD
GGTYDIYETLRVNOPSIKGIATFKQYWSVRRSKRTSGTISVSNHFRAWENLGMNMGKMY
EVALTVEGYOSSGSANVYSNTLRINGNPLSTISNDESITLDKNN
Seq ID No 16 (gi | 167246404 | gb | ABZ24364.11 Sequence 5 of US patent 7314743):
OTIOPGTGYNNGYFYSYWNDGHGGVTYTNGPGGOFSVNWSNSGNFVGGKGWQPGTKN
KVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIY
RTORVNOPSIIGTATFYOYWSVRRNHRSSGSVNTANHFNAWAOOGLTLGTMDYOIVAVE
GYFSSGSASITV5
Seq ID No 17 (gi | 76059070 | emb | CAJ30753.1 | unnamed protein product [Paenibacillus pabuli]) '.
TDYWONWTDGGGTVNAVNGSGGNYSVNWQNTGNFVVGKGWTYGTPNRVVNYNAGVF
SPSGNGYLTFYGWTRNALIEYYVVDNWGTYRPTGTYKGTVTSDGGTYDIYTTMRYNOPSI
DGYSTFPOYWSVROSKRPIGVNSOITFONHVNAWASKGMYLGNSWSYOVMATEGYO5S
GSSNVTVW
Seq ID No 18 (gi | 74197761 | emb | CA329666.11 unnamed protein product [Bacillus halodurans]) '.
ES 2 561 427 T3
NTYWQYWTDGGGTVNATNGPGGNYSVTWRDTGNFVVGKGWEIGSPNRTIHYNAGVWE
PSGNGYLTLYGWTRNQLIEYYVVDNWGTYRPTGTHRGTVVSDGGTYDIYTTMRYNAPSID
GTOTFQOFWSVROSKRPTGNNV5ITFSNHVNAWRNAGMNLG55WSYQVLATEGYQSSG
RSNVTVW
Seq ID No 19 (gi | 4756811 | emb | CAB42305.11 unnamed protein product):
OIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGGTFSAOWNNVNNILFRKGKKFNETOT
HOOVGNMSINYGANFOPNGNAYLCVYGWTVDPLVEYYIVDSWGNWRPPGATPKGTITVD
GGTYDIYETLRVNQPSIKGIATFKQYWSVRRSKRTSGTISVSNHFRAWENLGMNMGKMY
EVALTVEGYOSSGSANVYSNTLRINGNPLSTISNDKSITLDKNN
Seq ID No 20 (gi | 2293951 | emb | CAA02246.11 unnamed protein product [Bacillus subtilis] from Bacíllus subtilis:
(US document 5306633)):
AGTDYWONWTDGGGTVNAVNGSGGNYSVNWSNTGNFWGKGWTTGSPFRTINYNAGV WAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTWNFWGKGWTTGSPFRTINYNAGV WAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTWVWNAPSKGDNTTNAVFSTOVEGPTHOVGNTVSTOKSVEGPTNTTNAVSTOKTVNEGPTSVGNTVS
Seq ID No 21 (g¡ | 42688917 | gb | AAS31735.11 Sequence 14 of US patent 6682923):
RTITNNEMGNHSGYDYELWKDYGNTSMTLNNGGAFSAGWNNIGNALFRKGKKFDSTRT
HHOLGNISINYNASFNPGGNSYLCVYGWTQSPLAEYYIVDSWGTYRPTGAYKGSFYADGG
TYDIYETTRVNOPSIIGIATFKQYWSVROTKRTSGTVSVSAHFRKWESLGMPMGKMYETA
FTVEGYOSSGSANVMTNQLFIGN
Seq ID No 22 (gi | 10040204 | emb | CAC07798.1 | unnamed protein product [Penicillium funiculosum]):
AFPSELAORAAGDLSKROSITTSQTGTNNGYYYSFWTNGGGEVTYTNGDNGEYSVTWVD
CGDFTSGKGWNPANAQTVTYSGEFNPSGNAYLAVYGWTTDPLVEYYILESYGTYNPSSGL
TSLGOVTSDGGTYDIYSTORVNOPSIEGTSTFNOYWSVRTEKRVGGTVTTANHFAAWKA
LGLEMGTYNYMIVSTEGYESSGSSTITVS or ------------------------------------------------ ---- SEQ ID No 23 shows the amino acid sequence of the mature Bacillus subtilis xylanase variant, BS3 (wild type with D11F / R122D mutations):
ASTDYWQNWTFGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGV
WAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPS
IDGDDTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQ SSGSSNVTVW
Seq ID No 24 shows the sequence of the mature wheat xylanase inhibitor sequence:
ES 2 561 427 T3
MPPVLLLVLAASLVALPSCQSLPVLAPVTKDPATSLYTIPFH DGASLVLDVAGPLVWSTCDG
GQPPAEIPCSSPTCLLANAYPAPGCPAPSCGSDKHDKPCTAYPYNPVSGACAAGSLSHTRF VANTTDGSKPVSKVNVGVLAACAPSKLLASLPRGSTGVAGLANSGLALPAQVASAQKVAN RFLLCLPTGGPGVAIFGGGPVPWPQFTQSMPYTPLVTKGGSPAHYISARSIVVGDTRVPVP EGALATGGVMLSTRLPYVLLRPDVYRPLMDAFTKALAAQHANGAPVARAVEAVAPFGVCY DTKTLGNNLGGYAVPNVQLGLDGGSDWTMTGKNSMVDVKQGTACVAFVEMKGVAAGD GRAPAVILGGAQMEDFVLDFDMEKKRLGFSRLPHFTGCGGL
Seq ID No 25 (Sequence 11 from US 6,682,923):
ASTDWWENWTIGGGIVNAVNGSGGNYSVNWSNTGNFDVAKGWTTGSPFRTINYNAGV WAPNGWGELELYGWTRSPLIEYLVVDSWGTNRPTGTYKGTVKSDGGTYDIYTDTRYNYP QEDGFTVGSQNATDTRYNYP QEDGFTVGSQNATWNYNAGV WAPNGWGELELYGWTRSPLIEYLVVDSWGTNRPTGTYKGTVKSDGGTYDIYTDTRYNYP QEDGFTVGSQNATDTRYNYP QEDGFTVGSQNATDTRYNYP SQEGSDRGTQNATDTRYNYP QEDGDRGTQNATN
Embodiments of the invention:
In one embodiment, the polypeptide according to the invention has a coiled β-fold.
In one embodiment, the polypeptide according to the invention is wherein the amino acid modification at position 110 is an amino acid substitution.
In one embodiment, the polypeptide according to the invention is wherein the amino acid modification at position 110 is a substitution on any different amino acid residue selected from the group consisting of: alanine, asparagine, cysteine, glutamic acid, tryptophan .
In one embodiment, the polypeptide according to the invention is wherein the amino acid modification at position 110 is a substitution on any different amino acid residue selected from the group consisting of: glutamic acid, tryptophan, alanine and cysteine.
In one embodiment, the polypeptide according to the invention is wherein the amino acid modification at position 110 is an alanine substitution.
In one embodiment, the polypeptide according to the invention having a total number of amino acids of less than 250, such as less than 240, such as less than 230, such as less than 220, such as less than 210, such as less of 200 amino acids, such as in the range of 160 to 240, such as in the range of 160 to 220 amino acids.
In one embodiment, the polypeptide according to the invention comprises one or more modifications at any one or more of the amino acid positions: 11, 12, 13, 34, 54, 77, 81, 99, 104, 113, 114, 118 , 122, 141, 154, 159, 162, 164, 166 and 175, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1 .
In one embodiment, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of: 11F, 12F, 54Q, 54W, 122D, 113A, 13Y, 113D, 141Q, 175L, 122F, 34K , 99Y, 104W, 154R, 159D, 175K, 811, 166F, 162E, 162D, 164F, 114D, 114Y, 114F, 118V, 175K, 77L, 77M, 77V, and 77Y, the position (s) being determined (s) as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of: D11F, G12F, N54Q, R122D, Y113A, G13Y, Y113D, N141Q, Q175L, R122F, G34K, K99Y , T104W, K154R, N159D, Q175K, V81I, Y166F, S162E, S162D, W164F, N114D, N114Y, N114F, I118V, I77L, I77M, I77V, and I77Y, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises one or more modifications at any one or more of the amino acid positions: 13, 99, 104, 113, 122, 154, 159 and 175, the one (s) being
ES 2 561 427 T3 position (s) determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises the substitution (s) at amino acid positions: 13, 99, 104, 113, 122, 154, 159 and 175, the position (s) being ) determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention further comprises one or more modifications at any one or more of the amino acid positions: 114 and 166, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention further comprises one or more substitutions at any one or more of the amino acid positions: 114 and 166, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises the substitution (s) in at least four of the following amino acid positions: 13, 99, 104, 113, 114, 122, 154, 159, 166, and 175, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises the substitution (s) at amino acid positions: 13, 99, 104, 113, 114, 122, 154, 159 and 175, the position (s) being (s) determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises the substitution (s) at amino acid positions: 13, 99, 104, 113, 122, 154, 159, 166 and 175, the position (s) being (s) determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises the substitution (s) at amino acid positions: 13, 99, 104, 113, 122, 154, 159, and 175, the position (s) being ( ones) determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of: 13Y, 99Y, 104W, 110A, 113D, 114D, 114F, 122F, 154R, 159D, 166F, 175K , and 175L, the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention is wherein the amino acid sequence of said polypeptide has at least five, six, seven, eight, nine or ten amino acid substitutions compared to the sequence selected from SEQ ID No. 1 with the one with the highest identity.
In one embodiment, the polypeptide according to the invention is wherein the amino acid sequence of said polypeptide has at least nine or ten amino acid substitutions.
In one embodiment, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of:
to. D11F, R122D, and T110A;
b. D11F, R122D, T110A, and Y113A;
c. G13Y, T110A, Y113D, R122D and Q175L;
d. G13Y, T110A, Y113D, R122F, and Q175L;
and. G13Y, G34K, T110A, Y113D, R122D, and Q175L;
F. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175K;
g. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, Q175 and V81I;
h. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, Y166F, and Q175L;
i. G13Y, T110A, Y113D, R122D, K154R, N159D and Q175L;
j. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D and Q175L;
k. G13Y, T110A, Y113D, R122D, S162E, and Q175L;
l. G13Y, T110A, Y113D, R122D, S162D, and Q175L;
ES 2 561 427 T3
m. G13Y, T110A, Y113D, R122D, W164F and Q175L;
n. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175L;
or. G13Y, K99Y, T104W, T110A, Y113D, N114Y, R122F, K154R, N159D and Q175L;
p. G13Y, K99Y, T104W, T110A, Y113D, N114F, R122F, K154R, N159D and Q175L;
q. G13Y, K99Y, T104W, T110A, Y113D, I118V, R122F, K154R, N159D, and Q175L;
r. G13Y, K99Y, T104W, T110A, Y113D, N114Y, R122F, K154R, N159D and Q175K;
s. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175K;
t. G13Y, I77L, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175L;
or. G13Y, I77M, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175L;
v. G13Y, I77S, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D and Q175L;
w. G13Y, I77V, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175L;
x. G13Y, I77Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D and Q175L
Y. G13Y, K99Y, T104W, T110A, Y113D, R122F, N141Q, K154R, N159D, and Q175L;
z. G13Y, N54Q, K99Y, T104W, T110A, Y113D, R122F, N141Q, K154R, N159D, and Q175;
aa.G13Y, N54W, K99Y, T104W, T110A, Y113D, R122F, 141Q, K154R, N159D, and 175L;
bb.G13Y, N54Q, K99Y, T104W, T110A, Y113D, N114F, R122F, K154R, N159D, and Q175L;
DC. G13Y, K99Y, T104W, T110A, Y113D, N114F, R122F, 141Q, K154R, N159D, and Q175L;
dd.G13Y, 54Q, K99Y, T104W, T110A, Y113D, N114F, R122F, 141Q, K154R, N159D, and Q175L;
the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention comprises one or more amino acid substitutions selected from the group consisting of:
to. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175K;
b. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, Y166F, and Q175L;
c. G13Y, K99Y, T104W, T110A, Y113D, R122F, K154R, N159D, and Q175L;
d. G13Y, K99Y, T104W, T110A, Y113D, N114D, R122F, K154R, N159D and Q175L;
and. G13Y, K99Y, T104W, T110A, Y113D, N114F, R122F, K154R, N159D and Q175L;
the position (s) being determined as the corresponding position of the amino acid sequence of B. subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention has bran solubilizing activity.
In one embodiment, the polypeptide according to the invention is in isolated form.
In one embodiment, the polypeptide according to the invention is wherein the amino acid modification at position 110 is not T110D.
In one embodiment, the polypeptide according to the invention having better xylanase activity compared to the amino acid sequence of B. subtilis shown as SEQ ID No. 1 as measured in a xylanase activity assay.
In one embodiment, the polypeptide according to the invention has improved xylanase activity as a result of the modification at position 110.
In one embodiment, the polypeptide according to the invention has better bran solubilization activity compared to the amino acid sequence of B. subtilis shown as SEQ ID No. 1 as measured in a bran solubilization activity assay.
ES 2 561 427 T3
In one embodiment, the polypeptide according to the invention has improved bran solubilization activity as a result of the modification at position 110.
In one embodiment, the polypeptide according to the invention has a lower sensitivity to the xylanase inhibitor.
In one embodiment, the polypeptide according to the invention is wherein said polypeptide has an amino acid sequence comprising modifications at positions selected from the list consisting of:
a) 13/110/113/122/154/159/175;
b) 13/99/104/110/113/122/154/159/166/175;
c) 13/99/104/110/113/114/122/154/159/175;
d) 13/110/113/122/175;
e) 13/99/104/110/113/122/154/159/175;
f) 13/99/104/110/113/122/154/159/175;
g) 13/99/104/110/113/114/122/154/159/175;
h) 13/99/104/110/113/114/122/154/159/175;
i) 13/99/104/110/113/114/122/154/159/175;
j) 13/99/104/110/113/114/122/154/159/175;
k) 13/77/99/104/110/113/122/154/159/175;
l) 13/81/99/104/110/113/122/154/159/175;
m) 13/110/113/122/164/175;
n) 13/110/113/122/162/175;
o) 13/110/113/122/175;
p) 11/122/110/113;
q) 13/77/99/104/110/113/122/154/159/175;
r) 11/122/110;
s) 13/34/110/113/122/175;
t) 13/77/99/104/110/113/122/154/159/175;
u) 13/77/99/104/110/113/122/154/159/175;
v) 13/99/104/110/113/118/122/154/159/175;
w) 13/110/113/122/162/175;
x) 13/77/99/104/110/113/122/154/159/175;
y) 13/99/104/110/113/122/141/154/159/175;
z) 13/54/99/104/110/113/122/141/154/159/175;
aa) 13/54/99/104/110/113/122/141/154/159/175;
bb) 13/54/99/104/110/113/114/122/154/159/175;
cc) 13/99/104/110/113/114/122/141/154/159/175; and dd) 13/54/99/104/110/113/114/122/141/154/159/175, the position (s) being determined as the corresponding position of the amino acid sequence of subtilis shown as SEQ ID No. 1.
ES 2 561 427 T3
In one embodiment, the polypeptide according to the invention is wherein said polypeptide has an amino acid sequence comprising the amino acid substitution selected from the list consisting of:
a) 13Y / 110A / 113D / 122D / 154R / 159D / 175L;
b) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 166F / 175L;
c) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
d) 13Y / 110A / 113D / 122F / 175L;
e) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
f) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175K;
g) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175K;
h) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175L;
i) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175L;
j) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175K;
k) 13Y / 77L / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
l) 13Y / 81I / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
m) 13Y / 110A / 113D / 122D / 164F / 175L;
n) 13Y / 110A / 113D / 122D / 162D / 175L;
o) 13Y / 110A / 113D / 122D / 175L;
p) 11F / 122D / 110A / 113A;
q) 13Y / 77Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
r) 11F / 122D / 110A;
s) 13Y / 34K / 110A / 113D / 122D / 175L;
t) 13Y / 77V / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
u) 13Y / 77M / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
v) 13Y / 99Y / 104W / 110A / 113D / 118V / 122F / 154R / 159D / 175L;
w) 13Y / 110A / 113D / 122D / 162E / 175L;
x) 13Y / 77S / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
y) 13Y / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
z) 13Y / 54Q / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
aa) 13Y / 54W / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
bb) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
cc) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L; and dd) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L;
the position (s) being determined as the corresponding position of the amino acid sequence of subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention is wherein said polypeptide has an amino acid sequence of SEQ ID No. 1 comprising the amino acid substitution selected from the list consisting of:
a) G13Y / T110A / Y113D / R122D / K154R / N159D / Q175L;
ES 2 561 427 T3
b) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Y166F / Q175L;
c) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L;
d) G13Y / T110A / Y113D / R122F / Q175L;
e) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
f) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175K;
g) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175K;
h) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175L;
i) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175L;
j) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175K;
k) G13Y / I77L / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
l) G13Y / V81I / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
m) G13Y / T110A / Y113D / R122D / W164F / Q175L;
n) G13Y / T110A / Y113D / R122D / S162D / Q175L;
o) G13Y / T110A / Y113D / R122D / Q175L;
p) D11F / R122D / T110A / Y113A;
q) G13Y / I77Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
r) D11F / R122D / T110A;
s) G13Y / G34K / T110A / Y113D / R122D / Q175L;
t) G13Y / I77V / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
u) G13Y / I77M / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
v) G13Y / K99Y / T104W / T110A / Y113D / I118V / R122F / K154R / N159D / Q175L;
w) G13Y / T110A / Y113D / R122D / S162E / Q175L; Y
x) G13Y / I77S / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L
y) G13Y / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q175L;
z) G13Y / N54Q / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q1 75L;
aa) G13Y / N54W / K99Y / T104W / T110A / Y113D / R122F / 141Q / K154R / N159D / 17 5L;
bb) G13Y / N54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q 175L;
cc) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N159D / Q17 5L; and dd) G13Y / 54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N 159D / Q175L.
In one embodiment, the polypeptide according to the invention is wherein said polypeptide has an amino acid sequence, consisting of amino acid substitution selected from the list consisting of:
a) 13Y / 110A / 113D / 122D / 154R / 159D / 175L;
b) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 166F / 175L;
c) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
d) 13Y / 110A / 113D / 122F / 175L;
e) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
f) 13Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175K;
ES 2 561 427 T3
g) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175K;
h) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175L;
i) 13Y / 99Y / 104W / 110A / 113D / 114D / 122F / 154R / 159D / 175L;
j) 13Y / 99Y / 104W / 110A / 113D / 114Y / 122F / 154R / 159D / 175K;
k) 13Y / 77L / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
l) 13Y / 81I / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
m) 13Y / 110A / 113D / 122D / 164F / 175L;
n) 13Y / 110A / 113D / 122D / 162D / 175L;
o) 13Y / 110A / 113D / 122D / 175L;
p) 11F / 122D / 110A / 113A;
q) 13Y / 77Y / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
r) 11F / 122D / 110A;
s) 13Y / 34K / 110A / 113D / 122D / 175L;
t) 13Y / 77V / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
u) 13Y / 77M / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L;
v) 13Y / 99Y / 104W / 110A / 113D / 118V / 122F / 154R / 159D / 175L;
w) 13Y / 110A / 113D / 122D / 162E / 175L; Y
x) 13Y / 77S / 99Y / 104W / 110A / 113D / 122F / 154R / 159D / 175L
y) 13Y / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
z) 13Y / 54Q / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
aa) 13Y / 54W / 99Y / 104W / 110A / 113D / 122F / 141Q / 154R / 159D / 175L;
bb) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 154R / 159D / 175L;
cc) 13Y / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L; and dd) 13Y / 54Q / 99Y / 104W / 110A / 113D / 114F / 122F / 141Q / 154R / 159D / 175L, the position (s) being determined as the corresponding position of the amino acid sequence of subtilis shown as SEQ ID No. 1.
In one embodiment, the polypeptide according to the invention is wherein said polypeptide has an amino acid sequence of SEQ ID No. 1, consisting of the amino acid substitution selected from the list consisting of:
a) G13Y / T110A / Y113D / R122D / K154R / N159D / Q175L;
b) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Y166F / Q175L;
c) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q175L;
d) G13Y / T110A / Y113D / R122F / Q175L;
e) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
f) G13Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175K;
g) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175K;
h) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175L;
i) G13Y / K99Y / T104W / T110A / Y113D / N114D / R122F / K154R / N159D / Q175L;
ES 2 561 427 T3
j) G13Y / K99Y / T104W / T110A / Y113D / N114Y / R122F / K154R / N159D / Q175K;
k) G13Y / I77L / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
l) G13Y / V81I / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
m) G13Y / T110A / Y113D / R122D / W164F / Q175L;
n) G13Y / T110A / Y113D / R122D / S162D / Q175L;
o) G13Y / T110A / Y113D / R122D / Q175L;
p) D11F / R122D / T110A / Y113A;
q) G13Y / I77Y / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
r) D11F / R122D / T110A;
s) G13Y / G34K / T110A / Y113D / R122D / Q175L;
t) G13Y / I77V / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
u) G13Y / I77M / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L;
v) G13Y / K99Y / T104W / T110A / Y113D / I118V / R122F / K154R / N159D / Q175L;
w) G13Y / T110A / Y113D / R122D / S162E / Q175L; Y
x) G13Y / I77S / K99Y / T104W / T110A / Y113D / R122F / K154R / N159D / Q175L
y) G13Y / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q175L;
z) G13Y / N54Q / K99Y / T104W / T110A / Y113D / R122F / N141Q / K154R / N159D / Q1 75L;
aa) G13Y / N54W / K99Y / T104W / T110A / Y113D / R122F / 141Q / K154R / N159D / 17 5L;
bb) G13Y / N54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / K154R / N159D / Q 175L;
cc) G13Y / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N159D / Q17 5L; and dd) G13Y / 54Q / K99Y / T104W / T110A / Y113D / N114F / R122F / 141Q / K154R / N159D / Q175L.
In one embodiment, the polypeptide according to the invention is not SEQ ID No. 25.
In one aspect, the present invention relates to a method for preparing a polypeptide according to any of claims 1-44, said method comprising expressing a nucleotide sequence encoding said polypeptide; and optionally isolating and / or purifying the polypeptide after expression.
In one aspect, the present invention relates to a nucleotide sequence encoding a polypeptide according to the invention.
One aspect relates to a composition comprising the polypeptide according to the invention or the nucleotide sequence according to the invention in admixture with a non-toxic component.
One aspect relates to the use of the polypeptide according to the invention or the nucleotide sequence according to the invention in admixture with a non-toxic component or a composition according to embodiment 52 in a method for modifying plant materials.
References
Collins, T., Gerday, C. and Feller, G. (2005) FEMS Microbiol Rev., 29 (1), 3-23.
Courtin, C., Roelants, A. and Delcour, J. (1999). Fractionation-reconstitution experiments provide insight into the role of endoxylanases in bread-making. Journal of Agricultural and Food Chemistry. 47. 1870-1877.
Coutinho, PM and Henrissat, B. (1999) Carbohydrate-Active Enzymes server at URL: http://afmb.cnrs-mrs.fr/CAZY/.
D'Appolonia, BL and MacArthur, LA (1976). Comparison of bran and endosperm pentosans in immature and mature wheat. Cereal Chem. 53. 711-718.
Debyser, W. and Delcour, JA (1998). Inhibitors of cellolytic, xylanolytic and β-glucanolytic enzymes. WO 98/49278.
Contents117
39 members in 15 offices
Priority claims5
| Document | Office | Kind | Date |
|---|---|---|---|
| 08172749 | European Patent Office (EPO) | A | |
| 08172749 | European Patent Office (EPO) | – | |
| 146155P | United States of America | – | |
| 14615509 | United States of America | P | |
| 2009050351 | Denmark | W |
Members39
| Document | Office | Kind | |
|---|---|---|---|
| US4293659A | United States of America | A | |
| JPS57139A | Japan | A | |
| CA1132288A | Canada | A | |
| US4366109A | United States of America | A | |
| JPH0135855B2 | Japan | B2 | |
| CA2747223A1 | Canada | A1 | |
| WO2010072224A1 | World Intellectual Property Organization (WIPO) | A1 | |
| AU2009329607A1 | Australia | A1 | |
| MX2011006645A | Mexico | A | |
| KR20110104539A | Republic of Korea | A | |
| EP2382309A1 | European Patent Office (EPO) | A1 | |
| CN102292436A | China | A | |
| US2011312058A1 | United States of America | A1 | |
| EA201170878A1 | Eurasian Patent Organization (EAPO) | A1 | |
| JP2012513206A | Japan | A | |
| EP2382309A4 | European Patent Office (EPO) | A4 | |
| ZA201104429B | South Africa | B | |
| AU2009329607B2 | Australia | B2 | |
| UA103216C2 | Ukraine | C2 | |
| CN104293747A | China | A | |
| US8951751B2 | United States of America | B2 | |
| JP5713918B2 | Japan | B2 | |
| US2015175992A1 | United States of America | A1 | |
| BRPI0924177A2 | Brazil | A2 | |
| JP2015146812A | Japan | A | |
| EP2382309B1 | European Patent Office (EPO) | B1 | |
| US9249403B2 | United States of America | B2 | |
| ES2561427T3This record | Spain | T3 | |
| DK2382309T3 | Denmark | T3 | |
| EP3037528A2 | European Patent Office (EPO) | A2 | |
| EP3037528A3 | European Patent Office (EPO) | A3 | |
| EP3037528B1 | European Patent Office (EPO) | B1 | |
| DK3037528T3 | Denmark | T3 | |
| EP3444343A1 | European Patent Office (EPO) | A1 | |
| CA2747223C | Canada | C | |
| BRPI0924177B1 | Brazil | B1 | |
| EP3444343B1 | European Patent Office (EPO) | B1 | |
| DK3444343T3 | Denmark | T3 | |
| ES2845202T3 | Spain | T3 |
Numbers
- Publication
- 2561427
- Application
- 9834135
Titles2
- Spanish
- Polipéptidos con actividad de xilanasa
- English
- Polypeptides with xylanase activity
Classification
- CPC, 6
- C12N9/2482
- C12Y302/01008
- A23L29/06
- C12N9/248
- A61K38/47
- C07K14/32
- IPC, 2
- C12N9 24
- A23L29 00