Wnt and frizzled receptors as targets for immunotherapy in head and neck squamous cell carcinomas

Description of equivalent WO 2004042028 A2

WNT AND FRIZZLED RECEPTORS AS TARGETS FOR

IMMUNOTHERAPY IN HEAD AND NECK

SQUAMOUS CELL CARCINOMAS

CROSS-REFERENCES TO RELATED APPLICATIONS

[0001] This patent application claims the benefit of the filing date of U.S. Patent Application No. 10/285,976 filed November 1, 2002, which are incorporated herein by reference. Related applications U.S. Provisional Application No. 60/287,995, filed May 1, 2001; PCT US02/13802, filed May 1, 2002; USSN 09/847,102 filed May 1, 2001; and PCT/IB02/02887 filed May 1, 2002 axe also herein incorporated by reference.

STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT [0002] This invention was made with U.S. Government support under Grant AR 44850 awarded by the National Institutes of Health. The Government may have certain rights in this invention.

FIELD OF INVENTION [0003] This application relates to proteins involved in the Wnt/frizzled signaling pathway. More specifically, it involves the role of these proteins in proliferative disorders.

BACKGROUND OF THE INVENTION [0004] Many cancers arise from differentiated tissues that are slowly dividing. The initial malignant population may have developed from a small, rapidly proliferating population of residual tissue stem cells or cells with a less differentiated subcellular profile. A strategy for targeting tumor cells that are antigenically distinct from mature differentiated cells could be useful in the treatment of cancer, particularly for controlling microscopic spread of disease. Malignant cells may express receptors used in embryonic patterning, which may serve as immunologic targets distinct from mature differentiated tissue. [0005] In embryogenesis body patterning is related to the axial expression of different proteins. The proximal-distal axis is controlled by fibroblast growth factor (Vogel, A. et al., "Involvement of FGF-8 in initiation, outgrowth and patterning of the vertebrate limb," Development, 122:1737-1750 (1996); Vogel, A. an licKle, C, "J_ L -4 maintains polaπzmg activity of posterior limb bud cells in vivo and in vitro," Development 119:199-206 (1993); Niswander, L. et al, "FGF-4 replaces the apical ectodermal ridge and directs outgrowth and patterning of the limb," Cell 75:579-587 (1993)), anterior-posterior axis by Sonic hedgehog (Riddle, R. D. et al, "Sonic hedgehog mediates the polarizing activity of the ZPA," Cell

75:1401-1416 (1993)), and the dorsal ventral axis by wingless (Parr, B. A. et al, "Mouse Wnt genes exhibit discrete domains of expression in the early embryonic CNS and limb buds," Development 119:247-261 (1993); Riddle, R. D. et al, "Induction of the LIM homeobox gene Lmxl by Wnt7a establishes dorsoventral pattern in the vertebrate limb," Cell 83:631- 640 (1995); Vogel, A. et al, "Dorsal cell fate specified by chick Lmxl during vertebrate limb development," Nature 378:716-720 (1995)). These factors are closely cross-regulated in development. The secretion of Wnt (wingless) is stimulated by Sonic hedgehog (SHH) signaling and conversely the expression of SHH is supported by the continued presence of wingless. SHH in turn influences fibroblast growth factor (FGF) expression (Niswander, L. et al, "A positive feedback loop coordinates growth and patterning in the vertebrate limb," Nature 371:609-612 (1994); Niswander, L., et al, "Function of FGF-4 in limb development," MolReprodDev 39:83-88; discussion 88-89 (1994); Laufer, E. et al, "Sonic hedgehog and Fgf-4 act through a signaling cascade and feedback loop to integrate growth and patterning of the developing limb bud," Cell 79:993-1003 (1994)). Wingless is a ligand for a G-coupled protein receptor named frizzled, which mediates a complex signaling cascade (Vinson, C. R. and Adler, P. N., "Directional non-cell autonomy and the transmission of polarity information by the frizzled gene of Drosophila," Nature 329:549-551 (1987)). Transcriptional regulation is also mediated by SHH cell surface interaction with its ligand, Patched. Patched tonically inhibits signaling through Smoothened until it binds to SHH. These pathways are illustrated in Figure 1, which has been adapted from reviews by others (Hunter, T., "Oncoprotein networks," Cell 88:333-346 (1997); Ng, J. K. et al, "Molecular and cellular basis of pattern formation during vertebrate limb development," Curr Top Dev Biol 41 :37-66 (1999); Ramsdell, A. F. and Yost, H. J., "Molecular mechanisms of vertebrate left-right development," Trends Genet 14:459-465 (1998)). [0006] Head and neck squamous cell carcinoma (HNSCC) is the sixth most common cancer in developed countries, and of the 44,000 annual cases reported in the United States approximately 11,000 will result in an unfavorable outcome (Landis, S. H. et al, "Cancer statistics," CA Cancer J Clin. 49, 8-31 (1999); Parkin, D. M. et al, "Global cancer statistics," CA Cancer J Clin. 49, 33-64 (1999)). Although metastatic HNSCC can respond to chemotherapy and radiotherapy, it is seldom adequately controlled. Therefore, it is important to identify new molecular determinants on HNSCC that may be potential targets for chemotherapy or immunotherapy.

[0007] In APC-deficient colon carcinoma, beta-catenin accumulates and is constitutively complexed with nuclear Tcf-4 (Sparks, A. B. et al, "Mutational analysis of the APC/beta- catenin/Tcf pathway in colorectal cancer," Cancer Res 58:1130-1134 (1998)). Other colon carcinomas and melanomas also contain constitutive nuclear Tcf-4/beta-catenin complexes as a result of mutations in the N terminus of beta-catenin that render it insensitive to downregulation by APC, and GSK3 beta (Morin, P. J. et al, "Activation of beta-catenin-Tcf signaling in colon cancer by mutations in beta-catenin or APC," Science 275: 1787-1790

(1997); Rubinfeld, B. et al. "Stabilization of beta-catenin by genetic defects in melanoma cell lines," Science 275:1790-1792 (1997)). This results in the unregulated expression of Tcf-4 oncogenic target genes, such as c-myc, cyclin Dl, and c-jun (He, T. C. et al, "Identification of c-MYC as a target of the APC pathway," Science 281:1509-1512 (1998); Shtutman, M. et al, "The cyclin Dl gene is a target of the beta-catenin LEF-1 pathway," Proc. Nat'l. Acad Sci. USA 96:5522-5527 (1999); Li, L. et al, "Disheveled proteins lead to two signaling pathways. Regulation of LEF-1 and c-Jun N-terminal kinase in mammalian cells," JBiol Chem 274:129-134 (1999)). The expression of covalently linked beta-catenin and LEF-1 has been directly demonstrated to result in the oncogenic transformation of chicken fibroblasts (Aoki, M. et al, "Nuclear endpoint of Wnt signaling: neoplastic transformation induced by transactivating lymphoid-enhancing factor 1," Proc. Nat'l. Acad. Sci. USA 96:139-144 (1999)). Similar mechanisms leading to deregulation of Tcf target gene activity are likely to be involved in melanoma (Rimm, D. L. et al, "Frequent nuclear/cytoplasmic localization of beta-catenin without exon 3 mutations in malignant melanoma," Am JPathol 154:325-329 (1999)), breast cancer (Bui, T. D. et al, "A novel human Wnt gene, WNT10B, maps to 12ql3 and is expressed in human breast carcinomas," Oncogene 14:1249-1253 (1997)), heptocellular carcinoma (de La Coste, A. et al, "Somatic mutations of the beta-catenin gene are frequent in mouse and human heptocellular carcinomas," Proc Nat'l. Acad. Sci. USA 95:8847-8851 (1998)), ovarian cancer (Palacios, J., and Gamallo, C, "Mutations in the beta- catenin gene (CTNNBl) in endometrioid ovarian carcinomas," Cancer Res 58:1344-1347 (1998)), endometrial cancer (Ikeda, T., "Mutational analysis of the CTNNBl (beta-catenin) gene in human endometrial cancer: frequent mutations at codon 34 that cause nuclear accumulation," Oncol Rep 7:323-326 (2000)), medulloblastoma (Hamilton, S.R. et al, "The molecular basis of Turcot's syndrome," N. EnglJMed 332:839-847 (1995)), pilomatricomas (Chan, E. F. et al. "A common human skin tumour is caused by activating mutations in beta- catenin," Nat. Genet 21:410-413 (1999)), and prostate cancer (Iozzo, R. N. et al, "Aberrant expression of the growth factor Wnt-5A in human malignancy," Cancer Res 55:3495-3499 (1995)). [0008] Other growth regulation pathways in tumors have also attracted recent interest. Many epithelial tumors express excess amounts of epidermal growth factor-receptor tyrosine kinases, particularly epidermal growth factor receptor (EGFR, or ErbB-1), and HER2 (ErbB- 2) (Coussens, L. et al, "Tyrosine kinase receptor with extensive homology to EGF receptor shares chromosomal location with neu oncogene," Science 230: 1132-1139 (1985); King, C. R. et al. , "Amplification of a novel v-erbB-related gene in a human mammary carcinoma," Science 229:974-976 (1985)). HER2 is transmembrane tyrosine kinase receptor, which dimerizes with another member of the EGFR family to form an active dimeric receptor (Akiyama, T. et al, "The product of the human c-erbB-2 gene: a 185-kilodalton glycoprotein with tyrosine kinase activity," Science 232:1644-1646 (1986)). The resulting phosphorylation of tyrosine residues initiates complex signaling pathways that ultimately lead to cell division. HER2 is overexpressed in 25 to 30 percent of breast cancers, usually as a result of gene amplification (Slamon, D. J. et al, "Studies of the HER-2/neu proto-oncogene in human breast and ovarian cancer," Science 244:707-712 (1989)). A high level of this protein is associated with an adverse prognosis (Slamon, D. J. et al, "Human breast cancer: correlation of relapse and survival with amplification of the HER-2/neu oncogene," Science 235:177-182 (1987); Ravdin, P. M. and Chamness, G. C, "The c-erbB-2 proto-oncogene as a prognostic and predictive marker in breast cancer: a paradigm for the development of other macromolecular markers~a review," Gene 159:19-27 (1995)). [0009] In the past decade there has been tremendous progress in identifying genetic and molecular changes that occur during the transformation of malignant cells. Many malignant cells have a less differentiated phenotype, and a higher growth fraction than normal in adult tissues. These basic characteristics are similar to immature or embryonic cells. During the development of the embryo, various cell surface receptors and ligands direct tissue pattern formation, and cellular differentiation (Hunter, T., "Oncoprotein networks," Cell 88, 333-346 (1997); Νg, J. K. et al, "Molecular and cellular basis of pattern formation during vertebrate limb development," Curr Top Dev Biol. 41, 37-66 (1999); Ramsdell,. A. F. and Yost, H. J., "Molecular mechanisms of vertebrate left-right development," Trends Genet. 14, 459-465 (1998)). The expression of these receptors and ligands is often no longer required in fully matured adult tissues. Because they are expressed on the cell surface, the receptors and ligands important for morphologic patterning and tissue differentiation could be targets for the immunotherapy of tumors that have arisen from residual immature cells, or that have undergone de-differentiation.

[0010] Genes of the wingless (Wnt) and frizzled (Fzd) class have an established role in cell morphogenesis and cellular differentiation (Parr, B. A. et al, "Mouse Wnt genes exhibit discrete domains of expression in the early embryonic CNS and limb buds," Development, 119, 247-261 (1993); Riddle, R. D. et al, "Induction of the LIM homeobox gene Lmxl by WNT7a establishes dorsoventral pattern in the vertebrate limb," Cell 83, 631-640 (1995); Vogel, A. et al, (1995) "Dorsal cell fate specified by chick Lmxl during vertebrate limb development," Nature 378, 716-720 (1995)). The Wnt proteins are extracellular ligands for the Fzd receptors, which resemble typical G protein coupled receptors (GPCRs). The first member of the 19 known human Wnt genes, Wnt-1, was initially discovered because of its oncogenic properties (Nusse, R. and Varmus, H. E., "Many tumors induced by the mouse mammary tumor virus contain a pro virus integrated in the same region of the host genome," Cell 31, 99-109 (1982)). The Wnt glycoproteins bind to one or more of the 10 known, 7 transmembrane domain G-protein coupled Fzd receptors, to initiate a chain of signaling events that often culminates in the stabilization and nuclear translocation of β-catenin, with resultant heterodimerization with one of the four members of the LEF/TCF family of transcription factors (Cadigan, K. M. and Nusse, R., "Wnt signaling: a common theme in animal development," Genes Dev., 11, 3286-3305 (1997); Miller, J. R. et al, "Mechanism and function of signal transduction by the Wnt/β-catenin and Wnt/Ca2+ pathways," Oncogene 18, 7860-7872 (1999)). These transcription factor complexes control the activities of specific Wnt target genes, including developmental regulators and other genes involved in coordinating cell proliferation, cell-cell interactions, and cell-matrix interactions (Vogel, A. and Tickle, C, "FGF-4 maintains polarizing activity of posterior limb bud cells in vivo and in vitro," Development 119:199-206 (1993)). The overexpression of β-catenin and LEF-1 has been demonstrated to result in the oncogenic transformation of chicken fibroblasts (Aoki, M. et al, "Nuclear endpoint of Wnt signaling: neoplastic transformation induced by transactivating lymphoid-enhancing factor 1," Proc. Nat'l. Acad. Sci. USA 96, 139-144 (1999)).

[0011] A recent survey using microarray techniques showed that most HNSCC overexpress mRNAs of the Wnt family (Leethanakul, C. et al, "Distinct pattern of expression of differentiation and growth-related genes in squamous cell carcinomas of the head and neck revealed by the use of laser capture microdissection and cDNA arrays," Oncogene 19, 3220- 3224 (2000)). However, the various Wnt mRNAs are very homologous, and hybridization in microarrays often cannot distinguish between closely related templates. [0012] A murine monoclonal antibody 4DS binds with high affinity to the extracellular domain of HER2, thereby blocking its function in signal transduction (Hudziak, R.M. et al. "pl85HER2 monoclonal antibody has antiproliferative effects in vitro and sensitizes human breast tumor cells to tumor necrosis factor," Mol Cell Biol 9: 1165-1172 (1989); Fendly, B.M. et al. "Characterization of murine monoclonal antibodies reactive to either the human epidermal growth factor receptor or HER2/neu gene product," Cancer Res 50:1550-1558 (1990); Fendly, B.M. et al. "The extracellular domain of HER2/neu is a potential immunogen for active specific immunotherapy of breast cancer," J Biol Response Mod 9:449-455 (1990)). In experimental models of breast cancer, it was active in vitro and in vivo, and had greater anti-tumor effects when combined with chemotherapy Hudziak, R.M. et al. "pi 85HER2 monoclonal antibody has antiproliferative effects in vitro and sensitizes human breast tumor cells to tumor necrosis factor," Mol Cell Biol 9:1165-1172 (1989); Pietras, R. J. et al, "Antibody to HER-2/neu receptor blocks DNA repair after cisplatin in human breast and ovarian cancer cells," Oncogene 9:1829-1838 (1994). A recently completed phase 3 randomized clinical trial of a humanized form of 4DS monoclonal antibody, trastuzumab (Herceptin; Genentech, Inc, South San Francisco, CA), demonstrated efficacy against some forms of breast tumors overexpressing HER2 (Slamon, D.J. et al, "Use of chemotherapy plus a monoclonal antibody against HER2 for metastatic breast cancer that overexpresses HER2," N Engl J Med 344:783-792 (2001).

SUMMARY OF THE INVENTION [0013] The present invention provides methods to identify specific Wnt and/or Fzd proteins that are overexpressed in cancer cells. Overexpression can refer to increased levels of particular Wnt and/or Fzd protein levels in cancers cells releative to levels of the same Wnt and /or Fzd protein in non-cancer cells of the same tissue type. Alternatively, overexpression can refer to increased levels of particular Wnt and/or Fzd levels in cancers cells relative to levels of different Wnt and /or Fzd proteins in the same cancer cells. Additionally in some cancers, the Wnt and/or Fzd protein will be overexpressed when compared to both the same Wnt and/or Fzd protein in a non-cancer cells of the same tissue type, and different Wnt and/or Fzd proteins in the same cancer cells.

[0014] In one aspect, the present invention provides a method of inhibiting the proliferation or survival of breast cancer cells, in breast cancer cells that overexpress a Wnt protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. 1 he Wnt protein can be Wnt7b, Wnt-lOb, or Wnt-14. The breast cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway, hi preferred embodiments, agent is an anti- Wnt antibody that specifically binds Wnt7b, Wnt-1 Ob, or Wnt-14. In a further embodiment, the anti-Wnt antibody facilitates cellular toxicity or killing by complement. In another aspect of the invention, the Wnt protein is overexpressed when compared to another Wnt protein in the same cancer cells. In a further aspect, the Wnt protein is required for proliferation or survival of the cancer cell. [0015] The invention also provides a method of treating a patient with a breast cancer, where the cancer cells overexpress a Wnt protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Wnt protein can be Wnt7b, Wnt-lOb, or Wnt-14. The breast cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway. In preferred embodiments, agent is an anti-Wnt antibody that specifically binds Wnt7b, Wnt- lOb, or Wnt-14. In a further embodiment, the anti-Wnt antibody facilitates cellular toxicity or killing by complement. In another aspect of the invention, the Wnt protein is overexpressed when compared to another Wnt protein in the same cancer cells, i a further aspect, the Wnt protein is required for proliferation or survival of the cancer cell. [0016] In one aspect, the invention provides a method of inhibiting the proliferation or survival of chronic lymphocytic leukemia cells that overexpress a Wnt protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Wnt protein can be Wnt3 and Wnt- 16. The chronic lymphocytic leukemia cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway. In preferred embodiments, the agent is an anti- Wnt antibody that specifically binds Wnt3, or Wnt-16. In a further embodiment, the anti- Wnt antibody facilitates cellular toxicity or killing by complement. In another aspect of the invention, the Wnt protein is overexpressed when compared to another Wnt protein in the same cancer cells, h a further aspect, the Wnt protein is required for proliferation or survival of the cancer cell.

[0017] The invention also provides, a method of treating a patient with chronic lymphocytic leukemia, where the chronic lymphocytic leukemia cells overexpress a Wnt protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Wnt protein can be Wnt3 and Wnt- 16. The chronic lymphocytic leukemia cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway, hi preferred embodiments, the agent is an anti-Wnt antibody that specifically binds Wnt3, or Wnt-16. h a further embodiment, the anti-Wnt antibody facilitates cellular toxicity or killing by complement. In another aspect of the invention, the Wnt protein is overexpressed when compared to another Wnt protein in the same cancer cells. In a further aspect, the Wnt protein is required for proliferation or survival of the cancer cell.

[0018] h one aspect, the invention provides a method of inhibiting the proliferation or survival of mantle zone lymphoma cells that overexpress a Wnt protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Wnt protein can be Wnt-16. The mantle zone lymphoma cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway, hi preferred embodiments, the agent is an anti-Wnt antibody that specifically binds Wnt-16. In a further embodiment, the anti-Wnt antibody facilitates cellular toxicity or killing by complement, h another aspect of the invention, the Wnt protein is overexpressed when compared to another Wnt protein in the same cancer cells, h a further aspect, the Wnt protein is required for proliferation or survival of the cancer cell. [0019] The invention also provides, a method of treating a patient with mantle zone lymphoma, when the mantle zone lymphoma cells overexpress a Wnt protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Wnt protein can be Wnt-16. The mantle zone lymphoma cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells, hi some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway. In preferred embodiments, the agent is an anti-Wnt antibody that specifically binds Wnt-16. In a further embodiment, the anti-Wnt antibody facilitates cellular toxicity or killing by complement, hi another aspect of the invention, the Wnt protein is overexpressed when compared to another Wnt protein in the same cancer cells. In a further aspect, the Wnt protein is required for proliferation or survival of the cancer cell. [0020] hi one aspect, the present invention provides a method of inhibiting the proliferation or survival of breast cancer cells that overexpress a Fzd protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Fzd protein can be Fzd3, Fzd4, Fzd6,

Fzd7, or Fzd 10. The breast cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway. In preferred embodiments, the agent is an anti-Fzd antibody that specifically binds Fzd3, Fzd4, Fzd6, Fzd7, or FzdlO. In a further embodiment, the anti-Fzd antibody facilitates cellular toxicity or killing by complement. In another aspect, the Fzd protein is overexpressed when compared to another Fzd protein in the same cancer cells, h a further aspect, wherein the Fzd protein is required for proliferation or survival of the cancer cell. [0021] The invention also provides a method of treating a patient with a breast cancer, where the breast cancer cells overexpress a Fzd protein when compared to non-cancer cells. The Fzd protein can be Fzd3, Fzd4, Fzd6, Fzd7, or FzdlO. The breast cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells, h some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway, h preferred embodiments, the agent is an anti-Fzd antibody that specifically binds Fzd3, Fzd4, Fzd6,

Fzd7, or FzdlO. In a further embodiment, the anti-Fzd antibody facilitates cellular toxicity or killing by complement. In another aspect, the Fzd protein is overexpressed when compared to another Fzd protein in the same cancer cells, h a further aspect, wherein the Fzd protein is required for proliferation or survival of the cancer cell. [0022] In one aspect, the invention provides a method of inhibiting the proliferation or survival of chronic lymphocytic leukemia cells that overexpress a Fzd protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Fzd protein can be Fzd3. The chronic lymphocytic leukemia cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the chronic lymphocytic leukemia cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway. In a preferred embodiment, the agent is an anti-Fzd antibody that specifically binds Fzd3. In a further embodiment, the anti- Fzd antibody facilitates cellular toxicity or killing by complement. In another aspect, the Fzd protein is overexpressed when compared to another Fzd protein in the same cancer cells, hi a further aspect, wherein the Fzd protein is required for proliferation or survival of the cancer cell.

[0023] The invention also provides a method of treating a patient with chronic lymphocytic leukemia, wherein the chronic lymphocytic leukemia cells overexpress a Fzd protein in a Wnt/Fzd signaling pathway when compared to non-cancer cells. The Fzd protein can be Fzd3. The chronic lymphocytic leukemia cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the chronic lymphocytic leukemia cells. In some embodiments, the agent is an antagonist of the Wnt/Fzd signaling pathway. In a preferred embodiment, the agent is an anti-Fzd antibody that specifically binds Fzd3. h a further embodiment, the anti-Fzd antibody facilitates cellular toxicity or killing by complement. In another aspect, the Fzd protein is overexpressed when compared to another Fzd protein in the same cancer cells. In a further aspect, wherein the .Fzd protein is required tor proliferation or survival of the cancer cell.

[0024] In one aspect the present invention provides a method of inhibiting the proliferation or survival of cancer cells that overexpress a Wnt protein when compared to non-cancer cells, and that also overexpress a downstream wnt/fzd regulated gene product compared to non- cancer cells. The cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antibody directed against the overexpressed Wnt protein. In a further embodiment, the Wnt protein is also overexpressed when compared to another Wnt protein in the same cancer cells, hi another embodiment, Wnt protein is required for proliferation or survival of the cancer cell. As an example, the proliferation of breast cancer cells that overexpresses Wnt7b, Wnt-lOb, or Wnt- 14 and also overexpresses cyclin Dl, c-myc, and WISP family member can be inhibited by an antibody that binds specifically to Wnt7b, Wnt-lOb, or Wnt-14. [0025] The mvention also provides a method of treating a patient with a cancer containing cells that that overexpress a Wnt protein when compared to non-cancer cells, and that also overexpress a downstream wnt/fzd regulated gene product compared to non-cancer cells. The cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antibody directed against the overexpressed Wnt protein, h a further embodiment, the Wnt protein is also overexpressed when compared to another Wnt protein in the same cancer cells. In another embodiment, Wnt protein is required for proliferation or survival of the cancer cell. As an example, a patient with breast cancer containing cells that overexpresses Wnt7b, Wnt-lOb, or Wnt-14 and also overexpresses cyclin Dl, c-myc, and WISP family member can be inhibited by an antibody that binds specifically to Wnt7b, Wnt-lOb, or Wnt-14. [0026] In one aspect the present invention provides a method of inhibiting the proliferation or survival of cancer cells that overexpress a Fzd protein when compared to non-cancer cells, and that also overexpress a downstream wnt/fzd regulated gene product compared to non- cancer cells. The cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antibody directed against the overexpressed Fzd protein, h a further embodiment, the Fzd protein is also overexpressed when compared to another Fzd protein in the same cancer cells, h another embodiment, Fzd protein is required for proliferation or survival of the cancer cell. As an example, the proliferation of breast cancer cells that overexpresses Fzd3, Fzd4, Fzd6, Fzd7, or FzdlO and that also overexpresses cyclin Dl, c-myc, and WISP family member can be inhibited by an antibody that binds specifically to Fzd3, Fzd4, Fzd6, Fzd7, or FzdlO. [0027] The invention also provides a method of treating a patient with a cancer containing cells that that overexpress a Fzd protein when compared to non-cancer cells, and that also overexpress a downstream wnt/fzd regulated gene product compared to non-cancer cells. The cancer cells are contacted with an agent that inhibits the Wnt/Fzd signaling pathway in the cancer cells. In some embodiments, the agent is an antibody directed against the overexpressed Fzd protein, h a further embodiment, the Fzd protein is also overexpressed when compared to another Fzd protein in the same cancer cells. In another embodiment, Fzd protein is required for proliferation or survival of the cancer cell. As an example, a patient with breast cancer containing cells that overexpresses Fzd3, Fzd4, Fzd6, Fzd7, or FzdlO and also overexpresses cyclin Dl, c-myc, and WISP family member can be inhibited by an antibody that binds specifically to Fzd3, Fzd4, Fzd6, Fzd7, and FzdlO. [0028] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-1 encoding nucleic acid, and specifically hybridizes to the same sequence the polynucleotides: 5'- CGAACCTGCTTACAGACTCCAA-3' and 5'-CAGACGCCGCTGTTTGC-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-1 in a biological sample, by contacting the sample with the isolated polynucleotide so that hybridization with the Wnt-1 nucleic acid can be detected. [0029] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-2 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GGATGACCAAGTGTGGGTGTAAG-3* and 5'-GTGCACATCCAGAGCTTCCA-3*. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-2 in a biological sample, by contacting the sample with the isolated polynucleotide so that hybridization with the Wnt-2 encoding nucleic acid present can be detected. [0030] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-2b encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GGCACGAGTGATCTGTGACAATA-3' and 5'-CGCATGATGTCTGGGTAACG-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-2b in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the wnt-_db encoding nucleic acid present can be detected.

[0031] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-3 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'-

CTGGGCCAGCAGTACACATCT-3' and 5'-GGCATGATCTCGATGTAATTGC-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-3 in a biological sample by contacting the sample with the isolated polynucleotide ao that specific hybridization with the Wnt-3 encoding nucleic acid present can be detected.

[0032] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-3a encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- CCCGTGCTGGACAAAGCT-3' and 5*-TCTGCACATGAGCGTGTCACT-3\ The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-3 a in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-3 a encoding nucleic acid present can be detected. [0033] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-4 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GGAGGAGACGTGCGAGAAAC -3' and 5'- CAGGTTCCGCTTGCACATCT -3' The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-4 in a biological sample, bycontacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-4 encoding nucleic acid present can be detected.

[0034] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-5a encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- TCTCCTTCGCCCAGGTTGTA-3' and 5'-CTTCTGACATCTGAACAGGGTTATTC-3*. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-5a in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-5a encoding nucleic acid present can be detected. [0035] In another aspect, the invention provides an isolated polynucleotide oi less than about 100 nucleotides that specifically hybridizes to a Wnt-5b encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- CCAACTCCTGGTGGTCATTAGC -3' and 5*- TGGGCACCGATGATAAACATC -3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-5b in a biological sample, by contacting the sample with the isolated polynucleotide of claim 99, under conditions to permit so that specific hybridization with the Wnt-5b encoding nucleic acid present can be detected. [0036] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-6 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- TCCGCCGCTGGAATTG -3* and 5'- AGGCCGTCTCCCGAATGT -3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-6 in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-6 encoding nucleic acid present can be detected.

[0037] hi another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-7a encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GACGCCATCATCGTCATAGGA-3' and 5'-GGCCATTGCGGAACTGAA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-7a in a biological sample, by comprising contacting the sample with the isolated polynucleotide sothat specific hybridization with the Wnt-7a encoding nucleic acid present can be detected. [0038] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-7b encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- TGAAGCTCGGAGCACTGTCA -3' and 5'- GGCCAGGAATCTTGTTGCA -3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-7b in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt- 7b encoding nucleic acid present can be detected.

[0039] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-8a encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GCAGAGGCGGAACTGATCTT-3' and 5'-CGACCCTCTGTGCCATAGATG-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-8a in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-8a encoding nucleic acid present can be detected.

[0040] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-8b encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- AATCGGGAGACAGCATTTGTG -3* and 5'- ATCTCCAAGGCTGCAGTTTCTAGT -3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-8b in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-8b encoding nucleic acid present can be detected. [0041] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt- 10a encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- CTGGGTGCTCCTGTTCTTCCTA -3' and 5'- GAGGCGGAGGTCCAGAATG -3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt- 10a in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt- 10a encoding nucleic acid present can be detected.

[0042] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-lOb encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'-

CCTCGCGGGTCTCCTGTT-3' and 5'-AGGCCCAGAATCTCATTGCTTA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-lOb in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-lOb encoding nucleic acid present can be detected.

[0043] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-11 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- CGTGTGCTATGGCATCAAGTG-3' and 5'-GCAGTGTTGCGTCTGGTTCA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-11 in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Wnt-11 encoding nucleic acid present can be detected. [0044] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-14 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides 5'- GGGCAGACGGTCAAGCAA-3' and 5'-CCAGCCTTGATCACCTTCACA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-14 in a biological sample, by contacting the sample with the isolated polynucleotides so that specific hybridization with the Wnt-14 encoding nucleic acid present can be detected.

[0045] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Wnt-16 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'-

GCCAATTTGCCGCTGAAC-3' and 5'-CGGCAGCAGGTACGGTTT-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Wnt-16 in a biological sample, by contacting the sample with the isolated so that specific hybridization with the Wnt-16 encoding nucleic acid present can be detected. [0046] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzdl encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- CACCTTGTGAGCCGACCAA-3' and 5'-CAGCACTGACCAAATGCCAAT-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzdl in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Fzdl encoding nucleic acid present can be detected.

[0047] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd2 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'-

TTTCTGGGCGAGCGTGAT-3' and 5'-AAACGCGTCTCCTCCTGTGA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd2 in a biological sample, by contacting the sample with with the polynucleotide so that specific hybridization with the Fzd2 encoding nucleic acid present can be detected. [0048] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd3 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- TGGCTATGGTGGATGATCAAAG-3' and 5'-TGGAGGCTGCCGTGGTA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd3 in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Fzd3 encoding nucleic acid present can be detected. [0049] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd4 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GGCGGCATGTGTCTTTCAGT-3' and 5'-GAATTTGCTGCAGTTCAGACTCTCT-3*. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd4 in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Fzd4 encoding nucleic acid present can be detected.

[0050] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd5 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- CGCGAGCACAACCACATC-3' and 5*-AGAAGTAGACCAGGAGGAAGACGAT-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd5 in a biological sample,by contacting the sample with the isolated polynucleotide so that specific hybridization with the Fzd5 encoding nucleic acid present can be detected. [0051] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd6 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- ACAAGCTGAAGGTCATTTCCAAA-3' and 5'-GCTACTGCAGAAGTGCCATGAT-3*. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd6 in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization between Fzd6 encoding nucleic acid present can be detected.

[0052] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd7 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: ->'- CAACGGCCTGATGTACTTTAAGG-3* and 5'-CATGTCCACCAGGTAGGTGAGA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd7 in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Fzd7 encoding nucleic acid present can be detected.

[0053] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd8 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GCTCGGTCATCAAGCAACAG-3' and 5'-ACGGTGTAGAGCACGGTGAAC-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd8 in a biological sample, bycontacting the sample with the isolated polynucleotide so that specific hybridization with the Fzd8 encoding nucleic acid present can be detected. [0054] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a Fzd9 encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'- GCGCTCAAGACCATCGTCAT-3' and 5'-ATCCGTGCTGGCCACGTA-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding Fzd9 in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization with the Fzd9 encoding nucleic acid present can be detected.

[0055] In another aspect, the invention provides an isolated polynucleotide of less than about 100 nucleotides that specifically hybridizes to a FzdlO encoding nucleic acid, and specifically hybridizes to the same sequence as the polynucleotides: 5'-

GCCGCCATCAGCTCCAT-3' and 5'-TCATGTTGTAGCCGATGTCCTT-3'. The invention also provides a method of specifically detecting the presence or absence of a nucleic acid encoding FzdlO in a biological sample, by contacting the sample with the isolated polynucleotide so that specific hybridization between FzdlO encoding nucleic acid present can be detected.

DEFINITIONS

[0056] The terms "Wnt protein" or "Wnt ligand" refer to a family of mammalian proteins related to the Drosophila segment polarity gene, wingless, humans, the Wnt family of genes typically encode 38 to 43 kDa cysteine rich glycoproteins having hydrophobic signal sequence, and a conserved asparagine-linked oligosaccharide consensus sequence {see e.g., Shimizu et al Cell Growth Differ 8:1349-1358 (1997)). The Wnt family contains at least 19 mammalian members. Exemplary Wnt proteins include Wnt-1, Wnt-2, Wnt-2b (also known as Wnt-13) Wnt-3, Wnt-3A, Wnt-4, Wnt-5A, Wnt-5B, Wnt-6, Wnt-7A, Wnt-7B, Wnt-8A, Wnt-8B, Wnt-IOA, Wnt-IOB, Wnt-11, Wnt 14, Wnt 15, and Wnt 16. The sequence of exemplary wnt proteins are set forth in the informal sequence listing. As explained below, certain cancers are associated with particular Wnt proteins. For example, head and neck squamous cell carcinoma cells are associated with Wnt-5a, Wnt-7a, Wnt-lOb, or Wnt-13. Glioblastoma is associated with Wnt-1 or Wnt-lOb. Burkitt lymphoma and chronic lymphocytic leukemia are associated with Wnt-1 or Wnt-lOb. Malignant lymphocytes overexpress Wnt-6, Wnt-14, or Wnt-16. Breast cancer is associated with overexpression of wnt5a, wnt7b, wntlOb, and wntl4. [0057] The terms "frizzled protein" or "frizzled receptor" refer to a family of mammalian proteins related to the Drosophila frizzled genes, which play a role in the development of tissue polarity. The Frizzled family comprises at least 10 mammalian genes. Exemplary human Frizzled receptors include Frizzled 1, Frizzled2, Frizzled3, Frizzled4, Frizzled5, Frizzledό, Frizzled7, Frizzledδ, Frizzled9 and FrizzledlO. The sequence of exemplary Frizzled receptors are set forth in the informal sequence listing. The mammalian homologues of the Drosophila frizzled protein share a number of common structural motifs. The N terminus located at the extracellular membrane surface is followed by a signal sequence, a domain of 120 amino acids with an invariant pattern of 10 cysteine residues, and a highly divergent region of 40-100 largely variable hydrophilic amino acids. Putative hydrophobic segments form seven membrane-spanning helices linked by hydrophilic loops, ending with the C terminus located at the intracellular face of the membrane. The cysteine-rich domains (CRDs) and the transmembrane segments are strongly conserved, suggesting a working model in which an extracellular CRD is tethered by a variable linker region to a bundle of seven membrane-spanning-helices. Frizzled protein receptors are, therefore, involved in a dynamic model of transmembrane signal transduction analogous to G-protein-coupled receptors with amino-terminal ligand binding domains.

[0058] In addition to the Wnt ligands, a family of secreted frizzled-related proteins (sFRPs) has been isolated. sFRPs appear to function as soluble endogenous modulators of Wnt signaling by competing with the membrane-spanning frizzled receptors for the binding of secreted Wnt ligands. sFRPs, therefore, modulate apoptosis susceptibility, exerting an antagonistic effect on programmed cell death. sFI<-Fs can either antagonize Wnt function by binding the protein and blocking access to its cell surface signaling receptor, or they can enhance Wnt activity by facilitating the presentation of ligand to the frizzled receptors. To date, sFRPs have not yet been linked causatively to cancer. [0059] The term "agent" or grammatical equivalents as used herein describes any molecule, either naturally occurring or synthetic, e.g., protein (for example an antibody or sFRP), oligopeptide (e.g., from about 5 to about 25 amino acids in length, preferably from about 10 to 20 or 12 to 18 amino acids in length, preferably 12, 15, or 18 amino acids in length), small chemical molecule, polysaccharide, lipid (e.g., a sphingolipid), fatty acid, polynucleotide, oligonucleotide, etc., that directly or indirectly inhibits a Wnt/Fzd signaling pathway.

[0060] The terms "antagonists" or "inhibitors" of Wnt signaling or of the wnt/Fzd signaling pathway refer to compounds that, e.g., bind to Wnt or Frizzled proteins, or partially or totally block or inhibit Wnt/Fzd signaling as measured in known assays for Wnt/Fzd signaling (e.g., measurement of β catenin levels, or oncogene expression controlled by Tcf and Lef transcription factors or other downstream wnt/fzd regulated gene products). Inhibitors, include antibodies directed against Wnt or Fzd proteins, and modified versions of Wnt or Frizzled proteins, as well as naturally occurring and synthetic ligands, antagonists, agonists, antibodies, small chemical molecules, and the like. Assays for detecting inhibitors or agaonists of the invention are described in more detail below. [0061] A "cancer cell that overexpresses a Wnt or Frizzled protein" is a cancer cell in which expression of a particular Wnt protein is at least about 2 times, usually at least about 5 times the level of expression in a non-cancer cell from the same tissue type. In some embodiments, wnt and/or fzd expression in a cancer cell is compared to wnt and/or fzd expression in a non-cancer cell of a different tissue-type or a panel of non-cancer cells of a different tissue type, hi addition, expression of particular Wnt and/or Frizzled proteins can be compared to other Wnt and/or Frizzled proteins in the same cell. Those proteins that are overexpressed in cancer cells compared to non-cancer cells and that are overexpressed compared to other Wnt and/or Frizzled proteins in the same cancer cell are generally preferred. Methods for determining the level of expression of a particular gene are well known in the art. Such methods include RT-PCR, real time PCR, use of antibodies against the gene products, and the like.

[0062] The terms "wnt signaling", "wnt/fzd" signaling and "fzd signaling" are used interchangeably. [0063] A "Wnt/Fzd signaling pathway" refers to activation ot an intracellular signal transduction pathway that is initiated by an interaction between a specific Wnt protein and a specific Fzd protein. Generally, the Wnt/Fzd interaction will be binding of a Wnt protein to a Fzd receptor, leading to activation of a signal transduction pathway. In some instances activation of the Wnt/Fzd signaling pathway will lead to induction of downstream wnt and/or fzd inducible genes. A "downstream wnt/fzd regulated gene product" is a protein or RNA that is upregulated, or otherwise regulated, as a result of signaling by a wnt/fzd transduction pathway. [0064] "Proliferation of a cancer cell" refers to cell division and increase in the number of cancer cells. "Inhibition of proliferation" refers to a decrease in the rate of proliferation (e.g., cellular division), cessation of proliferation (e.g., entry into GO phase or senescense), or death of a cell, including necrotic cell death.

[0065] "Inhibition of survival of a cancer cell" refers to induction or relief of inhibition of a programmed cell death process, e.g., apoptosis. [0066] The term "contact" or "contacting" is used herein interchangeably with the following: combined with, added to, mixed with, passed over, incubated with, flowed over, etc.

[0067] "Nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Exemplary wnt and fzd nucleic acids are found in the informal sequence listing. The term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).

[0068] Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Thus, the terms "a Wnt encoding nuleic acid" and "a Fzd encoding nucleic acid" include both coding and complementary noncoding sequences. Specifically, degenerate codon substitutions maybe achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al, J. Biol. Chem. 260:2605-2608 (1985); Rossolini et al, Mol. Cell. Probes 8:91-98 (1994)). The term nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.

[0069] As used herein, "antibody" includes reference to an immunoglobulin molecule immunologically reactive with a particular antigen, and includes both polyclonal and monoclonal antibodies. The term also includes genetically engineered forms such as chimeric antibodies (e.g., humanized murine antibodies) and heteroconjugate antibodies (e.g., bispecific antibodies).. The term "antibody" also includes antigen binding forms of antibodies, including fragments with antigen-binding capability (e.g., Fab', F(ab')₂, Fab, Fv and rlgG. See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, IL). See also, e.g., Kuby, J., Immunology, 3^rd Ed., W.H. Freeman & Co., New York (1998). The term also refers to recombinant single chain Fv fragments (scFv). The term antibody also includes bivalent or bispecific molecules, diabodies, triabodies, and tetrabodies. Bivalent and bispecific molecules are described in, e.g., Kostelny et al. (1992) J Immunol 148:1547, Pack and Pluckthun (1992) Biochemistry 31:1579, Hollinger et al, 1993, supra, Gruber et al. (1994) J Immunol :5368, Zhu et al. (1997) Protein Sci 6:781, Hu et al. (1996) Cancer Res. 56:3055, Adams et al. (1993) Cancer Res. 53:4026, and McCartney, et al. (1995) Protein Eng. 8:301.

[0070] An antibody immunologically reactive with a particular antigen can be generated by recombinant methods such as selection of libraries of recombinant antibodies in phage or similar vectors, see, e.g., Huse et al, Science 246: 1275-1281 (1989); Ward et al, Nature 341:544-546 (1989); and Vaughan et al, Nature Biotech. 14:309-314 (1996), or by immunizing an animal with the antigen or with DNA encoding the antigen. [0071] Typically, an immunoglobulin has a heavy and light chain. Each heavy and light chain contains a constant region and a variable region, (the regions are also known as "domains"). Light and heavy chain variable regions contain four "framework" regions interrupted by three hypervariable regions, also called "complementarity-determining regions" or "CDRs". The extent of the framework regions and CDRs have been defined. The sequences of the framework regions of different light or heavy chains are relatively conserved within a species. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three dimensional space.

[0072] The CDRs are primarily responsible for binding to an epitope of an antigen. The CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located. Thus, a V_H CU - is located m the variable domain of the heavy chain of the antibody in which it is found, whereas a V CDRl is the CDR1 from the variable domain of the light chain of the antibody in which it is found. [0073] References to "V_H" or a "VH" refer to the variable region of an immunoglobulin heavy chain of an antibody, including the heavy chain of an Fv, scFv , or Fab. References to "V_L" or a "VL" refer to the variable region of an immunoglobulin light chain, including the light chain of an Fv, scFv , dsFv or Fab.

[0074] The phrase "single chain Fv" or "scFv" refers to an antibody in which the variable domains of the heavy chain and of the light chain of a traditional two chain antibody have been joined to form one chain. Typically, a linker peptide is inserted between the two chains to allow for proper folding and creation of an active binding site.

[0075] A "chimeric antibody" is an immunoglobulin molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity. [0076] A "humanized antibody" is an immunoglobulin molecule which contains minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992)). Humanization can be essentially performed following the method of Winter and co-workers (Jones et al, Nature _>__ !::.-£/-:./:. (.lysb); Kiechmann et al, Nature 332:323-327 (1988); Verhoeyen et al, Science 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. [0077] "Epitope" or "antigenic determinant" refers to a site on an antigen to which an antibody binds. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).

[0078] "Biological sample" as used herein is a sample of biological tissue or fluid that contains nucleic acids or polypeptides, e.g., of a Wnt protein, polynucleotide or transcript. Such samples include, but are not limited to, tissue isolated from primates, e.g., humans, or rodents, e.g., mice, and rats. Biological samples may also include sections of tissues such as biopsy and autopsy samples, frozen sections taken for histologic purposes, blood, plasma, serum, sputum, stool, tears, mucus, hair, skin, etc. Biological samples also include explants and primary and/or transformed cell cultures derived from patient tissues. A biological sample is typically obtained from a eukaryotic organism, most preferably a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, mouse; rabbit; or a bird; reptile; or fish.

[0079] "Providing a biological sample" means to obtain a biological sample for use in methods described in this invention. Most often, this will be done by removing a sample of cells from an animal, but can also be accomplished by using previously isolated cells (e.g., isolated by another person, at another time, and/or for another purpose), or by performing the methods of the invention in vivo. Archival tissues, having treatment or outcome history, will be particularly useful.

[0080] The terms "identical" or percent "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, preferably 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site http://www.ncbi.nlm.nih.gov/BLAST/ or the like). Such sequences are then said to be "substantially identical." This definition also refers to, or may be applied to, the complement of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions, as well as naturally occurring, e.g., polymorphic or allelic variants, and man-made variants. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length. [0081] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Preferably, default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. [0082] A "comparison window", as used herein, includes reference to a segment of one of the number of contiguous positions selected from the group consisting typically of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)). [0083] Preferred examples of algorithms that are suitable for determining percent sequence identity and sequence similarity include the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al, J. Mol Biol. 215:403-410 (1990). BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive- valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, e.g., for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands. [0084] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001. Log values may be large negative numbers, e.g., 5, 10, 20, 30, 40, 40, 70, 90, 110, 150, 170, etc. [0085] An indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, wherein the antibodies are specific for the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, e.g., where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below. Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequences.

[0086] The phrase "stringent hybridization conditions" refers to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acids, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology— Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993). Generally, stringent conditions are selected to be about 5-10°C lower than the thermal melting point (T_m) for the specific sequence at a defined ionic strength pH. The T_m is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50%o of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at T_m, 50% of the probes are occupied at equilibrium). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal is at least two times background, preferably 10 times background hybridization. Exemplary stringent hybridization conditions can be as following: 50% formamide, 5x SSC, and 1% SDS, incubating at 42°C, or, 5x SSC, 1% SDS, incubating at 65°C, with wash in 0.2x SSC, and 0.1% SDS at 65°C.

[0087] The terms "isolated," "purified," or "biologically pure" refer to material that is substantially or essentially free from components that normally accompany it as found in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein or nucleic acid that is tne predominant species present m a preparation is substantially purified. In particular, an isolated nucleic acid is separated from some open reading frames that naturally flank the gene and encode proteins other than protein encoded by the gene. The term "purified" in some embodiments denotes that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. Preferably, it means that the nucleic acid or protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure. "Purify" or "purification" in other embodiments means removing at least one contaminant from the composition to be purified. In this sense, purification does not require that the purified compound be homogenous, e.g., 100% pure. [0088] The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers, those containing modified residues, and non-naturally occurring amino acid polymer. [0089] The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, γ- carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid. [0090] Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the lUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.

[0091] "Conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated, e.g., naturally contiguous, sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to another of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes silent variations of the nucleic acid. One of skill will recognize that in certain contexts each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, often silent variations of a nucleic acid which encodes a polypeptide is implicit in a described sequence with respect to the expression product, but not with respect to actual probe sequences. [0092] As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention. Typically conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).

[0093] Macromolecular structures such as polypeptide structures can be described in terms of various levels of organization. For a general discussion of this organization, see, e.g., Alberts et al, Molecular Biology of the Cell (3rd ed., 1994) and Cantor & Schimmel, Biophysical Chemistry Part I: The Conformation of Biological Macromolecules (1980). "Primary structure" refers to the amino acid sequence of a particular peptide. "Secondary structure" refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains. Domains are portions of a polypeptide that often form a compact unit of the polypeptide and are typically 25 to approximately 500 amino acids long. Typical domains are made up of sections of lesser organization such as stretches of (-sheet and (-helices. "Tertiary structure" refers to the complete three dimensional structure of a polypeptide monomer. "Quaternary structure" refers to the three dimensional structure formed, usually by the noncovalent association of independent tertiary units. Anisotropic terms are also known as energy terms. [0094] A "label" or a "detectable moiety" is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means. For example, useful labels include fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins or other entities which can be made detectable, e.g., by incorporating a radiolabel into the peptide or used to detect antibodies specifically reactive with the peptide. The radioisotope may be, for example, 3H, 14C, 32P, 35S, or 1251. In some cases, particularly using antibodies against the proteins of the invention, the radioisotopes are used as toxic moieties, as described below. The labels may be incorporated into the nucleic acids, proteins and antibodies at any position. Any method known in the art for conjugating the antibody to the label may be employed, including those methods described by Hunter et al, Nature, 144:945 (1962); David et al, Biochemistry, 13:1014 (1974); Pain et al, J. Immunol. Meth., 40:219 (1981); and Nygren, J. Histochem. and Cytochem., 30:407 (1982). The lifetime of radiolabeled peptides or radiolabeled antibody compositions may be extended by the addition of substances that stablize the radiolabeled peptide or antibody and protect it from degradation. Any substance or combination of substances that stablize the radiolabeled peptide or antibody may be used including those substances disclosed in US Patent No. 5,961,955. [0095] An "effector" or "effector moiety" or "effector component" is a molecule that is bound (or linked, or conjugated), either covalently, through a linker or a chemical bond, or noncovalently, through ionic, van der Waals, electrostatic, or hydrogen bonds, to an antibody. The "effector" can be a variety of molecules including, e.g., detection moieties including radioactive compounds, fluorescent compounds, an enzyme or substrate, tags such as epitope tags, a toxin; activatable moieties, a chemotherapeutic agent; a lipase; an antibiotic; or a radioisotope emitting "hard" e.g., beta radiation. [0096] The term "recombinant" when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, e.g., recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all. By the term "recombinant nucleic acid" herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases and endonucleases, in a form not normally found in nature, h this manner, operably linkage of different sequences is achieved. Thus an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined, are both considered recombinant for the purposes of this invention. It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention. Similarly, a "recombinant protein" is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as depicted above. [0097] The term "heterologous" when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not normally found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences, e.g., from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source. Similarly, a heterologous protein will often refer to two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).

[0098] The phrase "specifically (or selectively) binds" to an antibody or "specifically (or selectively) immunoreactive with," when referring to a protein or peptide, refers to a binding reaction that is determinative of the presence of the protein, in a heterogeneous population of proteins and other biologies. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein sequences at least two times the background and more typically more than 10 to 100 times background. The antibodies of the invention specifically bind to Wnt or Frizzled proteins or other proteins in a wnt/fzd signaling pathway. By "specifically bind" herein is meant that the antibodies bind to the protein with a K_D of at least about 0.1 mM, more usually at least about 1 μM, preferably at least about 0.1 μM or better, and most preferably, 0.01 μM or better.

[0099] Specific binding to an antibody under such conditions requires an antibody that is selected for its specificity for a particular protein. For example, polyclonal antibodies raised to a particular protein, polymorphic variants, alleles, orthologs, and conservatively modified variants, or splice variants, or portions thereof, can be selected to obtain only those polyclonal antibodies that are specifically immunoreactive with specific Wnt or specific Frizzled proteins, or other proteins in a wnt/fzd signaling pathway, and not with other proteins. This selection may be achieved by subtracting out antibodies that cross-react with other molecules. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity) .

[0100] "Tumor cell" refers to precancerous, cancerous, and normal cells in a tumor. [0101] "Cancer cells," "transformed" cells or "transformation" in tissue culture, refers to spontaneous or induced phenotypic changes that do not necessarily involve the uptake of new genetic material. Although transformation can arise from infection with a transforming virus and incorporation of new genomic DNA, or uptake of exogenous DNA, it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene. In the present invention transformation is typically associated with overexpression of Wnt and/or Frizzled proteins. Transformation is associated with other phenotypic changes, such as immortalization of cells, aberrant growth control, nonmorphological changes, and/or malignancy (see, Freshney, Culture of Animal Cells a Manual of Basic Technique (3rd ed. 1994)).

BRIEF DESCRIPTION OF THE DRAWINGS

[0102] Figure 1. Several developmental signaling pathways are depicted. [0103] Figure 2. RT-PCR analysis of a subset of HNSCC and B- cell lines for frizzled 2 mRNA.

[0104] Figure 3. A western blot analysis of tumor and normal cells for frizzled 2, wntl and 10b.

[0105] Figures 4A, 4B, and 4C. An inhibition of proliferation assay in a HNSCC line is depicted. Specifically, anti-frizzled 2, anti-wnt 1, and anti-wnt 10b are tested for their ability to inhibit proliferation.

[0106] Figure 5. Apoptotic effects of inhibition of the Wnt/Frizzled signaling pathway in a

HNSCC line is depicted. [0107] Figure 6. Sequence alignment of a portion of the first extracellular region of human

Frizzled receptors is depicted.

[0108] Figures 7A and 7B. Figure 7A depicts an immunoblot after treatment with Wnt 1 or Wnt 10b antibodies. SNU1076 cells were treated for 72 hrs with 2 μg/ml of anti-Wnt 1, Wnt 10b, or control antibodies. Figure 7B shows that treatment with Wntl antibodies reduces transcription of TCF/LEF gene.

[0109] Figures 8A and 8B. Figure 8 A depicts an RT-PCR amplification for Wnt/FZD families in cancer cell lines. Figure 8B depicts an RT-PCR amplification for Wnt/FZD families in normal cells. [0110] Figures 9A and 9B. Protein expression of FZD 2, Wnt 1, Wnt 10b, β-catenin and actin in normal and malignant cells.

[0111] Figure 10. Inhibition of proliferation of the SNU 1076 cell line Wnt 1 and Wnt

10b.

[0112] Figure 11. Growth inhibition with a soluble WNT antagonist, secreted frizzled related protein (SFRP).

[0113] Figure 12. Apoptotic effect of inhibition of the Wnt/Frizzled signaling pathway in a HNSCC line.

[0114] Figures 13A and 13B. Primer sequences for wnt, fzd, and wnt-related gene analysis.

[0115] Figure 14. Expression of wnt's in non-rumor and tumor tissues. [0116] Figure 15. Expression of wnt 14 in non-tumor and tumor tissues.

[0117] Figure 16. Expression of fzd's in non-tumor and tumor tissues.

[0118] Figure 17. Expression of fzd3 in non-tumor and tumor tissues.

[0119] Figure 18. Expression of fzd6 in non-tumor and tumor tissues.

[0120] Figure 19. Expression of fzdl 0 in non-tumor and tumor tissues. [0121] Figure 20. Expression of DKK's in non-tumor and tumor tissues.

[0122] Figure 21. Expression of FRP2/4 in non-tumor and tumor tissues.

[0123] Figure 22. Expression of WISP3 in non-tumor and tumor tissues.

[0124] Figure 23. Expression of cyclin Dl in non-tumor and tumor tissues.

[0125] Figure 24. Expression of c-myc in non-tumor and tumor tissues. [0126] Figure 25. Expression of IL-6 in non-tumor and tumor tissues.

[0127] Figure 26. Expression of MMP3 in non-tumor and tumor tissues.

[0128] Figure 27. Expression of wnt, fzd, and wnt-related genes in non-tumor cells and breast cancer cells.

Detailed description of Figures [0129] Figure 1. Schematic of developmental signaling pathways is depicted. The signalling pathways of the Wnt/wingless and Hedehog/Sonic hedgehog are shown. Both sets of ligands interact with a cell surface receptor. Proteins involved in the signaling pathway are shown, for example, LEF1 and GSK3. [0130] Figure 2. RT-PCR analysis of a subset of HNSCC and B- cell lines for frizzled 2 mRNA. Total RNA was extracted from HNSCC lines (PCI13, Detroit 562, RPMI 2650, SNU1076, KB, AMC4), a CLL line (Lesch), a Burkitt lymphoma line (Ramos), glioma lines (U87MG, and U373MG), normal human bronchial epithelial cell lines (Clonetics, San Diego, CA) and normal oral squamous epithelial (OSE) cells using RNAzol (Gibco BRL, Grand Island, NY). Reverse transcription was performed using 1 μg of RNA from each sample and the Superscript™ Preamplification kit (Gibco BRL). Frizzled 2 was amplified with 25 cycles of PCR. G3PDH mRNA was amplified in a separate reaction for each sample. [0131] Figure 3. A sample western blot analysis of tumor and normal cells for frizzled 2, wnt 5 A and 10b. Adherent cells in culture were harvested and lysed with a solution containing 25 mM Tris HCI, 150 mM KC1, 5 mM EDTA, 1% NP-40, 0.5% sodium deoxycholic acid, 0.1% sodium dodecyl sulfate, ImM NaVO , 1 mM NaF, 20 mM β- glycerophosphate and protease inhibitors. Twenty μg of protein from each cell line was separated by SDS-PAGE and transferred to a PVDF membrane. The membrane was immersed in 2% I-block, 0.05% Tween X in PBS and then incubated with a 1:500 dilution of polyclonal goat anti-human Wnt 1, Wnt 10b, or frizzled 2 IgG (Santa Cruz Bioteclmology, Santa Cruz, CA). These primary antibodies were then detected by horseradish peroxidase- conjugated donkey anti-goat IgG (Santa Cruz) and chemiluminescence (ECL detection reagents, Amersham Life Science, Aylesbury, UK). To verify relative amount of protein transferred in each lane, the presence of actin was measured with an actin monoclonal antibody (Chemi-Con International hie, Temecula, CA).

[0132] Figure 4A, 4B, and 4C. Inhibition of proliferation in a HNSCC line. Briefly, either 7.5 x 10³ or 10 x 10³ SNU1076 cells per well were seeded in 96 well plates. After 24 hours, graded amounts of polyclonal goat anti-human frizzled 2 , Wnt 1, or Wnt 10b IgG (sAB)(Santa Cruz'Biotechnology, Santa Cruz, CA), or control goat anti-human IgG (cAB)(Fisher Scientific, Pittsburgh, PA) were added. On days 1, 2, 3, or 4, 20 μl of MTT (3- [4,5-dimethylthiazol-2-yl]-2,5-diphenyl tetrazolium bromide)-based solution was added to wells for four hours prior to lysis with 15% SDS, 0.015 M HCI. Absorbencies of 570 and 650nm were measured. [0133] Figure 5. Apoptotic effect of inhibition ot the Wnt/Frizzled signaling pathway in a HNSCC line. The HNSCC line SNU1076, growing in RPMI-1640 supplemented with 10% FBS, was treated for 72 hrs with 300 ng/ml anti-Frizzled 2, Wnt-1, Wntl 0b, or control nonspecific polyclonal antibodies. The cytotoxic effects of these antibodies were assessed by vital dye retention and DNA content. Panel A: cells were detached from the flasks by trypsin treatment and incubated for 10 minutes in growing medium with 5 μg/ml Propidium iodide (PI) and 40 nM DiOC₆ and analyzed by flow cytometry. Viable cells (stripes) had high DiOC (FL-1) and low PI (FL-3) fluorescence, and apoptotic cells (stippled) had low DiOC₆ (FL-1) and low PI (FL-3) fluorescence. Panel B: cells were detached from the flasks by trypsin treatment and incubated overnight in a hypotonic buffer (0.1%) citrate, 0.1 % SDS) containing 50 μg/ml PI and 100 μg/ml RNase. The amount of DNA was then measured by flow cytometry, and apoptotic cells were defined as having a DNA content lower than the G₀Gι levels (sub-Go cells). [0134] Figure 6. Sequence alignment of a portion of the first extracellular region of human Frizzled receptors. Specifically, the amino acid sequences of HFZ1 through BTZ10 are aligned to show similarity.

[0135] Figures 7A and 7B. Figure 7A: immunoblot after treatment with Wnt 1 or Wnt 10b antibodies. SNU1076 cells were treated for 72 hrs with 2 μg/ml of anti-Wnt 1, Wnt 10b, or control antibodies. Twenty μg of protein from each cell line was separated by SDS-PAGE and transferred to a PVDF membrane. The membrane was immersed in 2%> I-block, 0.05% Tween X in PBS and then incubated with a monoclonal anti-human β-catenin, cyclin Dl, or fibronectin IgG. These primary antibodies were then detected by horseradish peroxidase- conjugated anti-IgG and chemiluminescence. To verify and compare relative amounts of protein in each lane, PVDF membrane was stripped with Re-Blot™ Western blot recycling kit and reprobed for other antibodies or actin monoclonal antibody. Figure 7B: treatment with Wntl antibodies reduces transcription of TCF/LEF gene. SNU 1076 cells were treated with 2 μg/ml of anti-Wnt- 1, or control antibodies for 36 hrs. SNU 1076 cells were cotransfected with 0.5 μg/ml of pTOPFLASH-Luc or pFOPFLASH-Luc-and 0.5 μg/ml of pCMV-βGal. Cells were harvested 24h after transfection, and lysed in lysis buffer. Luciferase and β-galactosidase activities determined using Dual-Light™ reporter gene assay system. Luciferase activities of each of pTOPFLASH-Luc or pFOPFLASH-Luc and β- galactosidase activities of pCMV-βGal were measured in the same sample by luminometer. Transfection efficiency of each sample was normalized by the activity of β-galactosidase activity. [0136] Figures 8A and 8B. Figure 8A: RT-PCR amplification for Wnt/FZD families in cancer cell lines. Lane 1: DNA standard, lane 2: H O, Lanes 3 and 4: glioblastoma, lanes 5- 14: head and neck cancers, lanes 15 and 16: B cell cancers. Figure 8B: RT-PCR amplification for Wnt/FZD families in normal cells. Lane 1: DNA standard, lane 2: H O, lanes 7 and 14: normal human bronchial epithelial cell, other lanes: normal oral squmous cells.

[0137] Figures 9A and 9B. Protein expression of FZD 2, Wnt 1, Wnt 10b, β-catenin and actin in normal and malignant cells. Normal oral squamous epithelium (OSE), normal human broncheotracheal epithelial cells (NHBE), HNSCC lines, and other solid and B cell tumor lines were lysed, separated by SDS-page, blotted onto PDVF membranes and successively probed with the indicated antibodies.

[0138] Figure 10. Inhibition of proliferation of the SNU 1076 cell line. 7.5 x 10³ SNU 1076 cells per well were seeded in 96 well plates. After 24 hours, graded amounts of polyclonal goat anti-human Wnt 1, Wnt 10b, or control goat anti-human IgG were added. On days 1, 2, 3, or 4, 20 μl of MTT solution was added to wells for four hours prior to lysis with 15% SDS, 0.015 M HCI. Absorbencies of 570 and 650nm were measured. Data are expressed as the mean of at least 4 independent experiments ± SD. [0139] Figure 11. Growth inhibition with a soluble WNT antagonist, secreted frizzled related protein (SFRP). Cell viability of two HNSCC lines was determined with MTT assay 72 hours after addition of 2 μg/ml of recombinant human SFRP 1. Data are expressed as the mean of 2 independent experiments ± SD.

[0140] Figure 12. Apoptotic effect of inhibition of the Wnt/Frizzled signaling pathway in a HNSCC line. SNU1076 was treated for 72 hrs with 2 μg/ml of anti-Wnt 1, Wnt 10b, or control antibodies. The cytotoxic effects of these antibodies were assessed by vital dye retention and DNA content. Cells were detached from the flasks by trypsin treatment and incubated for 10 minutes in growing medium with 5 μg/ml Propidium iodide (PI) and 40 nM DiOC₆ and analyzed by flow cytometry. Viable cells had high DiOC₆ (FL-1) and low PI (FL-3) fluorescence, and apoptotic cells had low DiOC₆ (FL-1) and low PI (FL-3) fluorescence. [0141] Figures 13A and 13B. Primer sequences for wnt, fzd, and wnt-related gene analysis. Figure 13 A shows primers and probes used for analysis of wnt and fzd nucleic acid expression. Figure 13B shows primers and probes used for analysis of expression of Frp, WISP, DKK, and other wnt/fzd inducible genes or controls. Levels of wnt fzd and wnt- related genes were determined with real time PCR using the depicted primers and probes. [0142] Figure 14. Expression of wnt's in non-tumor and tumor tissues. Levels of wntl 6, wntl, wnt3, wnt7b, wntδa, and wnt 10b were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of wntlό, wntl, wnt3, wnt7b, wnt8a, and wntlOb were also determined in primary CLL cells and in breast cancer tumors. The data in the figures are relative, with the lowest normal tissue level assigned a value of one. Thus, a relative value of 100 in breast cancer or CLL means that the cancer cells had 100 times the values of the lowest normal tissue, as reported by real time PCR. [0143] Figure 15. Expression of wntl4 in normal and non-tumor tissues. Levels of wnt 14 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of wntl4 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14. [0144] Figure 16. Expression of fzd's in non-tumor and tumor tissues. Levels of fzdl, fzd2, fzd3, fzd4, fzd5, fzd6, fzd7, fzd8, fzd9, and fzdlO were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of fzdl, fzd2, fzd3, fzd4, fzd5, fzd6, fzd7, fzd8, fzd9, and fzdlO were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14. [0145] Figure 17. Expression of fzd3 in non-tumor and tumor tissues. Levels of fzd3 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of fzd3 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14. [0146] Figure 18. Expression of fzd6 in non-tumor and tumor tissues. Levels of fzd6 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of fzd6 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14. [0147] Figure 19. Expression of fzdl 0 in non-tumor and tumor tissues. Levels of fzdl 0 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of fzd 10 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14. [0148] Figure 20. Expression of DKK's in non-tumor and tumor tissues. Levels of DKK-1, DKK-2, DKK-3, and DKK-4 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of DKK-1, DKK-2, DKK-3, and DKK-4, were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14.

[0149] Figure 21. Expression of FRP2/4 in non-tumor and tumor tissues. Levels of FRP-2 and FRP-4 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of FRP-2 and FRP-4 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14.

[0150] Figure 22. Expression of WISP3 in non-tumor and tumor tissues. Levels of WISP3 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of WISP3 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14.

[0151] Figure 23. Expression of cyclin Dl in non-tumor and tumor tissues. Levels of cyclin Dl were deteπnined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of cyclin D 1 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14.

[0152] Figure 24. Expression of c-myc in non-tumor and tumor tissues. Levels of c-myc were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of c-myc were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14.

[0153] Figure 25. Expression of IL-6 in non-tumor and tumor tissues. Levels of IL-6 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of IL-6 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14.

[0154] Figure 26. Expression of MMP3 in non-tumor and rumor tissues. Levels of MMP3 were determined in normal cells from lung, colon, kidney, brain, adrenal gland, thyroid, placenta, spleen, thymus, liver, heart, bone marrow, and peripheral blood lymphocytes. Levels of MMP3 were also determined in primary CLL cells and in breast cancer tumors. Data were analyzed as in Figure 14.

[0155] Figure 27. Expression of wnt, fzd, and wnt-related genes in non-tumor cells and breast cancer cells. Levels of wnt, fzd, and wnt-related genes wre determined in normal cells and breast cancer cells. Results are expressed as fold induction. Data were analyzed as in Figure 14.

DETAILED DESCRIPTION OF THE INVENTION [0156] This invention is based, at least in part, on the discovery that particular Wnt and Frizzled proteins are associated with different cancers. It is known that Wnt proteins often have high level expression in cancer. However, little is known regarding the expression of particular Wnt and Frizzled proteins. The present disclosure provides methods for evaluating the expression of Wnt and Frizzled proteins. Also disclosed are agents useful for treating cancers that overexpress Wnt proteins. The invention is useful for any cancer in which Wnt- Fzd signaling affects cancer cell growth or survival; or in which specific wnt gene products and/or specific fzd gene products are overexpressed. The invention is useful for treating cancers such as head and neck cancer, glioblastoma, chronic lymphocytic leukemia, breast cancer, mantle zone lymphomas, Burkitt's lymphoma, and other lymphocyte malignancies. [0157] Applicants provide novel primers that are useful to assess wnt and/or fzd expression levels in a system of choice. In some embodiments wnt and/or fzd levels are determined in cell lines derived from primary cancer cell, e.g., from a solid tumor or from a hematopoetic cancer, i other embodiments wnt and/or fzd levels are determined in primary tissues, e.g., solid tumors or hematopoetic cancer cells. Cells from normal tissue or from non-transformed cell lines are used as controls. Wnt and/or fzd overexpression can also be determined by using antibodies against the specific wnt or fzd protein to determine expression levels.

[0158] Overexpression of a specific wnt or fzd gene product in a cancer cell can be based, inter alia, on two different comparisons. First, a specific wnt and/or fzd gene product can be overexpressed in a cancer cell relative to levels of the specific wnt and/or fzd gene product in a noncancerous cell from the same tissue-type. Alternatively, a specific wnt and/or fzd gene product can be overexpressed in a cancer cell relative to levels of different specific wnt gene product in the same cancer cell. In some embodiments, a specific wnt and/or fzd protein is overexpressed in a cancer cell relative to levels of the specific wnt and/or fzd gene product in a noncancerous cell from the same tissue-type, and relative to levels of different specific wnt gene product in the same cancer cell. [0159] Wnt and/or fzd overexpression can result in at least two different outcomes for the cancer cell. In some embodiments, expression of specific wnt and/or fzd gene products is not required for cancer cell survival, but rather can serve as a marker of the cancer cells. In other embodiments, expression of a specific wnt and/or fzd will be required for proliferation or survival or for inhibition of apoptosis of the cancer cell. (E.g., Blocking wnt/fzd binding or wnt/ fzd signaling with, for example a specific antibody or wnt antagonist results in decreased cell proliferation or induction of apoptosis.) Without wishing to be bound by theory, expression of specific wnt and/or fzd gene products can lead to activation of a signal transduction pathway and regulation of downstream wnt and/or fzd inducible genes. In some embodiments, activation of the signal transduction pathway and induction of the downstream genes and gene products are required for proliferation or survival or for inhibition of apoptosis of the cancer cell. For example, in breast cancer cells expression of specific wnt and/or fzd proteins appears to induce required genes including cyclin Dl, c-myc, and WISP family genes. In some cells wnt expression appears to activate TCF/LEF transcription factors leading to induction of specific genes. In other embodiments, activation of the signal transduction pathway and induction of the downstream genes and gene products are not required for proliferation or survival or for inhibition of apoptosis of the cancer cell. [0160] At least two therapies can be based on detection of wnt and/or fzd overexpression. For wnt and or fzd gene products that are required for cell growth, survival or inhibition of apoptosis, specific antibodies that block the wnt/fzd signaling pathway, such as the wnt/fzd interaction, or specific antagonists can be used to kill the cells or to induce apoptosis. For wnt and or/fzd gene products that are overexpressed but not required for cell survival, wnt and or fzd specific antibodies can be radiolabeled or conjugated to toxins or can be used to induce the complement cascade. The overexpressed wnt and/or fzd gene products act as markers to guide the antibodies to the cancer cells. Specific radiolabeled or toxin-conjugated antibodies or induction of the complement cascade can also be used to assist killing of cancer cells that overexpress specific wnts and/or fzds that are required for cell growth. [01 1] Wnt and/or fzd expression can be correlated with the expression of wnt/fzd induced genes (e.g., a downstream wnt/fzd regulated gene product). For example, in breast cancer cells expression of specific wnt and fzd proteins appears to induce required genes including cyclin Dl, c-myc, and WISP family genes. In lymphocyte cells wnt expression appears to activate TCF/LEF transcription factors leading to induction of specific genes. Thus, different cancers can overexpress different wnt and fzd gene products, as well as different downstream wnt/fzd regulated gene products. Correlation of expression of a specifc wnt and/or fzd gene with a specific downstream gene is an indication that the overexpressed wnt and/or fzd gene product is active. Thus, an assay that detects Wnt overexpression coupled with induced expression of wnt/fzd downstream gene products provides evidence that treatment with an agent that blocks wnt/fzd signaling is appropriate.

ANTIBODIES TO WNT AND FRIZZLED PROTEINS

[0162] As noted above, the invention provides methods of inhibiting the wnt/fzd pathway, including Wnt signaling in cancer cells, some embodiments of the invention, antibodies are used to block the binding between Wnt ligand and the Frizzled receptor, or otherwise block a step in a wnt/fzd signaling pathway. The antibodies can also be used to induce the complement cascade against a target cell expressing the target antigen or can be radiolabeled or toxin-conjugated. This is particularly useful if the antigen is a Frizzled receptor overexpressed on a target cancer cell. The antibodies can be raised against either Wnt or Frizzled proteins, or other proteins in the wnt/fzd pathway in some embodiments. Alternatively, the antibodies could be raised against the Wnt/Frizzled complex on the surface of the cell. Such antibodies will provide more specificity by binding only cells in which the target Wnt and Frizzled proteins are associated and can be used without modification or can be radiolabeled or toxin-conjugated. [0163] Methods of preparing polyclonal antibodies are known to the skilled artisan (e.g., Coligan, supra; and Harlow & Lane, supra). Polyclonal antibodies can be raised in a mammal, e.g., by one or more injections of an inimunizing agent and, if desired, an adjuvant. Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections. The immunizing agent may include a protein encoded by a nucleic acid of the figures, or fragment thereof, or a fusion protein thereof. It may be useful to conjugate the inimunizing agent to a protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyro globulin, and soybean trypsin inhibitor. Examples of adjuvants which may be employed include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate). The immunization protocol may be selected by one skilled in the art without undue experimentation.

[0164] The antibodies may, alternatively, be monoclonal antibodies. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler & Milstein, Nature 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro. Generally, either peripheral blood lymphocytes ("PBLs") are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (1986)). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium"), which substances prevent the growth of HGPRT-deficient cells. [0165] In some embodiments, a monoclonal antibody is used. The ability of a particular antibody to recognize the same epitope as another antibody is typically determined by the ability of one antibody to competitively inhibit binding of the second antibody to the antigen. Any of a number of competitive binding assays can be used to measure competition between two antibodies to the same antigen. For example, a sandwich ELISA assay can be used for this purpose. This is carried out by using a capture antibody to coat the surface of a well. A subsaturating concentration of tagged-antigen is then added to the capture surface. This protein will be bound to the antibody through a specific antibody: epitope interaction. After washing a second antibody, which has been covalently linked to a detectable moeity (e.g., HRP, with the labeled antibody being defined as the detection antibody) is added to the

ELISA. If this antibody recognizes the same epitope as the capture antibody it will be unable to bind to the target protein as that particular epitope will no longer be available for binding. If however this second antibody recognizes a different epitope on the target protein it will be able to bind and this binding can be detected by quantifying the level of activity (and hence antibody bound) using a relevant substrate. The background is defined by using a single antibody as both capture and detection antibody, whereas the maximal signal can be established by capturing with an antigen specific antibody and detecting with an antibody to the tag on the antigen. By using the background and maximal signals as references, antibodies can be assessed in a pair-wise manner to determine epitope specificity. [0166] A first antibody is considered to competitively inhibit binding ot a second antibody, if binding of the second antibody to the antigen is reduced by at least 30%, usually at least about 40%), 50%, 60% or 75%, and often by at least about 90%, in the presence of the first antibody using any of the assays described above. [0167] In some embodiments the antibodies to the Wnt or Frizzled proteins are chimeric or humanized antibodies. As noted above, humanized forms of antibodies are chimeric immunoglobulins in which residues from a complementary determining region (CDR) of human antibody are replaced by residues from a CDR of a non-human species such as mouse, rat or rabbit having the desired specificity, affinity and capacity. [0168] Human antibodies can be produced using various techniques known in the art, including phage display libraries (Hoogenboom & Winter, J. Mol. Biol. 227:381 (1991); Marks et al, J. Mol. Biol. 222:581 (1991)). The techniques of Cole et al. and Boeπier et al. are also available for the preparation of human monoclonal antibodies (Cole et al, Monoclonal Antibodies and Cancer Therapy, p. 77 (1985) and Boemer et al., J. Immunol. 147(l):86-95 (1991)). Similarly, human antibodies can be made by introduction of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, e.g., in U.S. Patent Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al, Bio/Technology 10:779- 783 (1992); Lonberg et al, Nature 368:856-859 (1994); Morrison, Nature 368:812-13 (1994); Fishwild et al., Nature Biotechnology 14:845-51 (1996); Neuberger, Nature Biotechnology 14:826 (1996); Lonberg & Huszar, Intern. Rev. Immunol. 13:65-93 (1995). [0169] In some embodiments, the antibody is a single chain Fv (scFv). The V_H and the V_L regions of a scFv antibody comprise a single chain which is folded to create an antigen binding site similar to that found in two chain antibodies. Once folded, noncovalent interactions stabilize the single chain antibody. While the V_H and V_L regions of some antibody embodiments can be directly joined together, one of skill will appreciate that the regions may be separated by a peptide linker consisting of one or more amino acids. Peptide linkers and their use are well-known in the art. See, e.g., Huston et al, Proc. Nat'l Acad. Sci. USA 8:5879 (1988); Bird et al, Science 242:4236 (1988); Glockshuber et al, Biochemistry 29:1362 (1990); U.S. Patent No. 4,946,778, U.S. Patent No. 5,132,405 and Stemmer et al, Biotechniques 14:256-265 (1993). Generally the peptide linker will have no specific biological activity other than to join the regions or to preserve some minimum distance or other spatial relationship between the N_H and N_L. However, the constituent amino acids of the peptide linker may be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity. Single chain Fv (scFv) antibodies optionally include a peptide linker of no more than 50 amino acids, generally no more than 40 amino acids, preferably no more than 30 amino acids, and more preferably no more than 20 amino acids in length. In some embodiments, the peptide linker is a concatamer of the sequence Gly-Gly- Gly-Gly-Ser, preferably 2, 3, 4, 5, or 6 such sequences. However, it is to be appreciated that some amino acid substitutions within the linker can be made. For example, a valine can be substituted for a glycine.

[0170] Methods of making scFv antibodies have been described. See, Huse et al, supra; Ward et al. supra; and Naughan et al, supra. In brief, mRΝA from B-cells from an immunized animal is isolated and cDΝA is prepared. The cDΝA is amplified using primers specific for the variable regions of heavy and light chains of immuno globulins. The PCR products are purified and the nucleic acid sequences are joined. If a linker peptide is desired, nucleic acid sequences that encode the peptide are inserted between the heavy and light chain nucleic acid sequences. The nucleic acid which encodes the scFv is inserted into a vector and expressed in the appropriate host cell. The scFv that specifically bind to the desired antigen are typically found by panning of a phage display library. Panning can be performed by any of several methods. Panning can conveniently be perfoπned using cells expressing the desired antigen on their surface or using a solid surface coated with the desired antigen. Conveniently, the surface can be a magnetic bead. The unbound phage are washed off the solid surface and the bound phage are eluted. [0171] Regardless of the method of panning chosen, the physical link between genotype and phenotype provided by phage display makes it possible to test every member of a cDΝA library for binding to antigen, even with large libraries of clones. [0172] In some embodiments, the antibodies are bispecific antibodies. Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens or that have binding specificities for two epitopes on the same antigen, hi one embodiment, one of the binding specificities is for the Wnt or Frizzled protein, the other one is for another cancer antigen. Alternatively, tetramer- type technology may create multivalent reagents.

[0173] As noted above, in some embodiments, the antibody is able to fix complement. Alternatively, the antibody is conjugated to an effector moiety. The effector moiety can be any number of molecules, including labeling moieties such as radioactive labels or fluorescent labels, or can be a therapeutic moiety. If the effector moiety is a therapeutic moiety, it will typically be a cytotoxic agent. In this method, targeting the cytotoxic agent to cancer cells, results in direct killing of the target cell. This embodiment is preferably carried out using antibodies against the Frizzled receptor. Cytotoxic agents are numerous and varied and include, but are not limited to, cytotoxic drugs or toxins or active fragments of such toxins. Suitable toxins and their corresponding fragments include diphtheria A chain, exotoxin A chain, ricin A chain, abrin A chain, curcin, crotin, phenomycin, enomycin, auristatin and the like. Cytotoxic agents also include radiochemicals made by conjugating radioisotopes to antibodies raised against Wnt or Frizzled proteins, or binding of a radionuclide to a chelating agent that has been covalently attached to the antibody. IDENTIFICATION OF PARTICULAR WNT/FZD PROTEINS

[0174] As noted above, the invention provides means for determining which Wnt and/or frizzled proteins are overexpressed by a particular cancer cell. In a prefeπed embodiment, the expression of each Wnt or Frizzled protein expressed in a particular cancer cell is compared to the corresponding expression in non-cancer cells of the same cell type. Wnt or Frizzled proteins that are overexpressed in cancer cells compared to that in non-cancer cells of the same type are selected as targets. In addition, to identify the proteins most likely responsible for cellular proliferation or survival, the Wnt or Frizzled proteins expressed by the cancer cell are also compared. Those proteins that are overexpressed compared to normal cells and those that are overexpressed compared to other Wnt or Frizzled proteins in the cancer cell are selected as targets.

[0175] Means for detecting and measuring gene expression or protein activity are well known in the art. Such methods include detecting the gene transcript (e.g. mRNA), measuring the quantity of translated protein, or measuring the gene product activity, hi another preferred embodiment, a transcript (e.g., mRNA) can be measured using amplification (e.g. PCR) based methods as described above for directly assessing copy number of DNA. In a preferred embodiment, transcript level is assessed by using reverse transcription PCR (RT-PCR). PCR primers particularly useful for amplification of desired Wnt or Frizzled proteins are provided below.

[0176] In another prefeπed embodiment, transcript level is assessed by using real time PCR. RNA is isolated from a sample of interest. PCR primers are designed to amplify the specific gene of interest. PCR product accumulation is measured using a dual-labeled flourogenic oligonucleotide probe. The probe is labeled with two different flourescent dyes, the 5' terminus reporter dye and the 3' terminus quenching dye. The oligonucleotide probe is selected to be homologous to an internal target sequence present in the PCR amplicon. When the probe is intact, energy transfer occurs between the two flourophors, and the fluorescent emission is quenched. During the extension phase of PCR, the probe is cleaved by 5' nuclease activity of Taq polymerase. Therefore, the reporter is no longer in proximity to the quencher, and the increase in emission intensity is measured. Exemplary PCR primers and hybridization probes for amplification of desired Wnt or Frizzled proteins or downstream wnt/fzd regulated gene products are provided in Figure 13 A and 13B. The primers can also be used in other methods to amplify DNA, for example RT-PCR. This assay provides a quantitative measure of nucleic acid.

[0177] In other embodiments, once the desired amplification products are produced, nucleic acid hybridization techniques can be used to detect and/or quantify the gene transcript, usually after the products are separated on a gel. The probes used in such assays can be full length or less than the full length of the nucleic acid sequence encoding the protein. Shorter probes are empirically tested for specificity. Preferably nucleic acid probes are 20 bases or longer in length, although shorter probes can also be used. Visualization of the hybridized portions allows the qualitative determination of the presence or absence of mRNA. [0178] The "activity" of a Wnt or Frizzled gene can also be detected and/or quantified by detecting or quantifying the expressed polypeptide. The polypeptide can be detected and quantified by any of a number of means well known to those of skill in the art. These may include analytic biochemical methods such as electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), hyperdiffusion chromatography, and the like. The isolated proteins can also be sequenced according to standard techniques to identify polymorphisms.

[0179] The antibodies of the invention can also be used to detect Wnt or Frizzled proteins, or cells expressing them, using any of a number of well recognized immunological binding assays (see, e.g., U.S. Patents 4,366,241; 4,376,110; 4,517,288; and 4,837,168). For a review of the general immunoassays, see also Methods in Cell Biology, Vol. 37, Asai, ed. Academic Press, Inc. New York (1993); Basic and Clinical Immunology 7th Edition, Stites & Terr, eds. (1991).

[0180] The methods of the invention can also be used for diagnosis. Thus, the present invention provides methods of detecting cells that over-express Wnt or Frizzled proteins in a patient suspected of having a particular cancer. In one method, a biopsy is performed on the subject and the collected tissue is tested in vitro. The tissue or cells from the tissue is then contacted with PCR primers disclosed here to determine the level of expression. Alternatively, an anti-Wnt or anti-Frizzled antibody of the invention can be used. Any immune complexes which result indicate the presence of the target protein in the biopsied sample. To facilitate such detection, the antibody can be radiolabeled or coupled to an effector molecule which is a detectable label, such as a radiolabel. In another method, the cells can be detected in vivo using typical imaging systems. Then, the localization of the label is determined by any of the known methods for detecting the label. A conventional method for visualizing diagnostic imaging can be used. For example, paramagnetic isotopes can be used for MRI. Internalization of the antibody may be important to extend the life within the organism beyond that provided by extracellular binding, which will be susceptible to clearance by the extracellular enzymatic environment coupled with circulatory clearance. IDENTIFICATION OF INHIBITORS OF WNT SIGNALING [0181] Wnt or Frizzled proteins (or cells expressing them) can also be used in drug screening assays to identify agents that inhibit a Wnt/Fzd signaling pathway. The present invention thus provides novel methods for screening for compositions wliich inhibit cancer. [0182] Assays for Wnt/Fzd signaling can be designed to detect and/or quantify any part of the Wnt signaling pathway. For example the ability of an agent to affect intracellular β- catenin levels, or to induce apoptosis, or to decrease or block cellular proliferation in target cells can be measured. Assays suitable for these purposes are described below.

[0183] Assays may include those designed to test binding activity to either the Wnt ligand or to the Frizzled receptor. These assays are particularly useful in identifying agents that modulate Wnt activity. Virtually any agent can be tested in such an assay. Such agents include, but are not limited to natural or synthetic polypeptides, antibodies, natural or synthetic small organic molecules, and the like.

[0184] As noted above, a family of secreted Frizzled-related proteins (sFRPs) function as soluble endogenous modulators of Wnt signaling by competing with Frizzled receptors for the binding of secreted Wnt ligands. Thus, in some format, test agents are based on natural ligands (e.g., Wnts ligands or sFRPs) of the Frizzled receptor. [0185] Any of the assays for detecting Wnt signaling are amenable to high throughput screening. High throughput assays binding assays and reporter gene assays are similarly well known. Thus, for example, U.S. Patent 5,559,410 discloses high throughput screening methods for proteins, U.S. Patent 5,585,639 discloses high throughput screening methods for nucleic acid binding (i.e., in arrays), while U.S. Patents _>,-> /o,zzu and -., 1,U01 disclose high throughput methods of screening for ligand/antibody binding. [0186] In addition, high throughput screening systems are commercially available (see, e.g., Zymark Corp., Hopkinton, MA; Air Technical Industries, Mentor, OH; Beckman histruments, Inc. Fullerton, CA; Precision Systems, Inc., Natick, MA, etc.). These systems typically automate entire procedures including all sample and reagent pipetting, liquid dispensing, timed incubations, and final readings of the microplate in detector(s) appropriate for the assay. These configurable systems provide high throughput and rapid start up as well as a high degree of flexibility and customization. The manufacturers of such systems provide detailed protocols for various high throughput systems. Thus, for example, Zymark Corp. provides technical bulletins describing screening systems for detecting the modulation of gene transcription, ligand binding, and the like.

[0187] Other assays useful in the present mvention are those designed to test neoplastic phenotypes of cancer cells. These assays include cell growth on soft agar; anchorage dependence; contact inhibition and density limitation of growth; cellular proliferation; cell death (apoptosis); cellular transformation; growth factor or serum dependence; tumor specific marker levels; invasiveness into Matrigel; tumor growth and metastasis in vivo; mRNA and protein expression in cells undergoing metastasis, and other characteristics of cancer cells. [0188] The ability of test agents to inhibit cell growth can also be assessed by introducing the test into an animal model of disease, and assessing the growth of cancer cells in vivo. For example, human tumor cells can be introduced into an immunocompromised animal such as a "nude mouse". The test agent (e.g., a small molecule or an antibody) is administered to the animal and the ability of the tumor cell to form tumors—as assessed by the number and/or size of tumors formed in the animal—is compared to tumor growth in a control animal without the agent.

KITS USED IN DIAGNOSTIC. RESEARCH. AND THERAPEUTIC APPLICATIONS [0189] As noted above, the invention provides evidence of the overexpression of particular Wnt or Frizzled proteins in certain cancers. Thus, kits can be used for the detection of the particular nucleic acids or proteins disclosed here, h diagnostic and research applications such kits may include any or all of the following: assay reagents, buffers, Wnt-specific or Frizzled-specific nucleic acids or antibodies, hybridization probes and/or primers, and the like. A therapeutic product may include sterile saline or another pharmaceutically acceptable emulsion and suspension base. [0190] In addition, the kits may include instructional materials containing directions (i.e., protocols) for the practice of the methods of this invention. While the instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instmctions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials. [0191] The present invention also provides for kits for screening for inhibitors of Wnt signaling. Such kits can be prepared from readily available materials and reagents. For example, such kits can comprise one or more of the following materials: a Wnt or Frizzled polypeptide or polynucleotide, reaction tubes, and instructions for testing the desired Wnt signaling function (e.g., β catenin levels). THERAPEUTIC METHODS Administration of inhibitors ' [0192] The agents that inhibit Wnt signaling (e.g., antibodies) can be administered by a variety of methods including, but not limited to parenteral (e.g., intravenous, intramuscular, intradermal, intraperitoneal, and subcutaneous routes), topical, oral, local, or transdermal administration. These methods can be used for prophylactic and/or therapeutic treatment. [0193] As noted above, inhibitors of the invention can be used to treat cancers associated with Wnt signaling. The compositions for administration will commonly comprise a inhibitor dissolved in a pharmaceutically acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of active agent in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs.

[0194] Thus, a typical pharmaceutical composition for intravenous administration would be about 0. lmg to 100 g per patient per day. Dosages from 0. lmg to 100 g per patient per day may be used, particularly when the drug is administered to a secluded site and not into the blood stream, such as into a body cavity or into a lumen of an organ. Actual methods for preparing parenterally administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pennsylvania (1980). [0195] The pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration. For example, unit dosage fonns suitable for oral administration include, but are not limited to, powder, tablets, pills, capsules and lozenges. It is recognized that antibodies when administered orally, should be protected from digestion. This is typically accomplished either by complexing the molecules with a composition to render them resistant to acidic and enzymatic hydrolysis, or by packaging the molecules in an appropriately resistant carrier, such as a liposome or a protection barrier. Means of protecting agents from digestion are well known in the art. [0196] The compositions containing inhibitors of the invention (e.g., antibodies) can be administered for therapeutic or prophylactic treatments. In therapeutic applications, compositions are administered to a patient suffering from a disease (e.g., breast cancer) in an amount sufficient to cure or at least partially aπest the disease and its complications. An amount adequate to accomplish this is defined as a "therapeutically effective dose." Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient, hi any event, the composition should provide a sufficient quantity of the agents of this invention to effectively treat the patient. An amount of an inhibitor that is capable of preventing or slowing the development of cancer in a patient is refeπed to as a "prophylactically effective dose." The particular dose required for a prophylactic treatment will depend upon the medical condition and history of the patient, the particular cancer being prevented, as well as other factors such as age, weight, gender, administration route, efficiency, etc. Such prophylactic treatments may be used, e.g., in a patient who has previously had cancer to prevent a recuπence of the cancer, or in a patient who is suspected of having a significant likelihood of developing cancer. [0197] A "patient" for the purposes of the present invention includes both humans and other animals, particularly mammals. Thus the methods are applicable to both human therapy and veterinary applications. In the prefeπed embodiment the patient is a mammal, preferably a primate, and in the most prefeπed embodiment the patient is human. [0198] Other known cancer therapies can be used in combination with the methods of the invention. For example, inhibitors of Wnt signaling may also be used to target or sensitize the cell to other cancer therapeutic agents such as ->Jf u, vmbiastme, actmomycm J , cisplatin, methotrexate, and the like, hi other embodiments, the methods of the mvention can be used with radiation therapy and the like.

[0199] In some instances the antibody belongs to a sub-type that activates serum complement when complexed with the transmembrane protein thereby mediating cytotoxicity or antigen-dependent cytotoxicity (ADCC). Thus, cancer can be treated by administering to a patient antibodies directed against Wnt or Frizzled proteins on the surface of cancer cells. Antibody-labeling may activate a co-toxin, localize a toxin payload, or otherwise provide means to locally ablate cells, ha these embodiments, the antibody is conjugated to an effector moiety. The effector moiety can be any number of molecules, including labeling moieties such as radioactive labels or fluorescent labels, or can be a therapeutic moiety, such as a cytotoxic agent.

Use of Wnt or Frizzled polypeptides as vaccines [0200] In addition to administration of inhibitors of wn signalling, the Wnt or Frizzled proteins or immunogenic fragments of them can be administered as vaccine compositions to stimulate HTL, CTL, and antibody responses against the endogenous proteins. Such vaccine compositions can include, e.g., lipidated peptides (see, e.g., Vitiello, et al. (1995) J. Clin. Invest. 95:341-349), peptide compositions encapsulated in poly(D,L-lactide-co-glycolide, "PLG") microspheres (see, e.g., Eldridge, et al. (1991) Molec. Immunol. 28:287-294; Alonso, et al. (1994) Vaccine 12:299-306; Jones, et al. (1995) Vaccine 13:675-681), peptide compositions contained in immune stimulating complexes (ISCOMS; see, e.g., Takahashi, et al. (1990) N-.t_.re 344:873-875; Hu, et al. (1998) Clin. Exp. Immunol. 113:235-243), multiple antigen peptide systems (MAPs; see, e.g., Tarn (1988) Proc. Nat'l Acad. Sci. USA 85:5409- 5413; Tam (1996) J. Immunol. Methods 196:17-32); viral delivery vectors (Perkus, et al., p. 379, in Kaufmann (ed. 1996) Concepts in Vaccine Development de Gruyter; Chakrabarti, et al. (1986) Nature 320:535-537; Hu, et al. (1986) Nature 320:537-540; Kieny, et al. (1986) AIDS Bio/Technology 4:790-795; Top, et al. (1971) J. Infect. Dis. 124:148-154; Chanda, et al. (1990) Virology 175:535-547), particles of viral or synthetic origin (see, e.g., Kofler, et al. (1996) J. Immunol. Methods 192:25-35; Eldridge, et al. (1993) Sem. Hematol 30:16-24; Falo, et al. (1995) Nature Med. 7:649-653).

[0201] Vaccine compositions often include adjuvants. Many adjuvants contain a substance designed to protect the antigen from rapid catabohsm, such as aluminum hydroxide or mineral oil, and a stimulator of immune responses, such as lipid A, Bortadella pertussis, or Mycobacterium tuberculosis derived proteins. Certain adjuvants are commercially available as, e.g., Freund's Incomplete Adjuvant and Complete Adjuvant (Difco Laboratories, Detroit, MI); Merck Adjuvant 65 (Merck and Company, Inc., Rahway, NJ); AS-2 (SmithKline Beecham, Philadelphia, PA); aluminum salts such as aluminum hydroxide gel (alum) or aluminum phosphate; salts of calcium, iron or zinc; an insoluble suspension of acylated tyrosine; acylated sugars; cationically or anionically derivatized polysaccharides; polyphosphazenes; biodegradable microspheres; monophosphoryl lipid A and quil A. Cytokines, such as GM-CSF, interleukin-2, -7, -12, and other like growth factors, may also be used as adjuvants. [0202] Vaccines can be administered as nucleic acid compositions wherein DNA or RNA encoding the Wnt or Frizzled polypeptides, or a fragment thereof, is administered to a patient. See, e.g., Wolff et. al. (1990) Science 247:1465-1468; U.S. Patent Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118; 5,736,524; 5,679,647; and WO 98/04720. Examples ofDNA-based delivery technologies include "naked DNA", facilitated (bupivicaine, polymers, peptide- mediated) delivery, cationic lipid complexes, and particle-mediated ("gene gun") or pressure- mediated delivery (see, e.g., U.S. Patent No. 5,922,687).

[0203] Methods for the use of genes as DNA vaccines are well known, and include placing the desired gene or portion thereof under the control of a regulatable promoter or a tissue- specific promoter for expression in the patient. The gene used for DNA vaccines can encode full-length Wnt or Frizzled protein, or may encode portions of the proteins. [0204] In a some embodiments, the DNA vaccines include a gene encoding an adjuvant molecule with the DNA vaccine. Such adjuvant molecules include cytokines that increase the immunogenic response to the polypeptide encoded by the DNA vaccine. [0205] For therapeutic or prophylactic immunization purposes, the peptides of the invention can be expressed by viral or bacterial vectors. Examples of expression vectors include attenuated viral hosts, such as vaccinia or fowlpox. This approach involves the use of vaccinia virus, e.g., as a vector to express nucleotide sequences that encode Wnt or Frizzled polypeptides or polypeptide fragments. Upon introduction into a host, the recombinant vaccinia virus expresses the immunogenic peptide, and thereby elicits an immune response. Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Patent No. 4,722,848. Another vector is BCG (Bacille Cahnette Guerin). BCG vectors are described in Stover, et al. (1991) Nature 351:456-460. A wide variety of other vectors useful for therapeutic administration or immunization e.g., adeno and adeno-associated virus vectors, retroviral vectors, Salmonella typhi vectors, detoxified anthrax toxin vectors, and the like, will be apparent. See, e.g., Shata, et al. (2000J Mot. Med. Today 6:66-71; Shedlock, et al. (2000) J Leukoc. Biol. 68:793-806; and Hipp, et al. (2000) In Vivo 14:571-85.

EXAMPLES

[0206] Different clonal populations of HNSCC overexpress various receptors of the Wnt and Fzd family because of their immature cell of origin and because of a growth and survival advantage provided by autocrine or paracrine Wnt/Fzd signaling. We examined HNSCC and noπnal human epithelial cell lines for the expression of 5 Wnt and 2 Fzd genes. The results showed that most HNSCCs did overexpress one or more Wnt and Fzd mRNAs. Moreover, the Wnt/Fzd pathway was functional in some of the HNSCC cells, as indicated by the constitutive expression of a LEF/TCF reporter gene. In the SNU 1076 cell line, anti-Wnt- 1 or anti-Wnt- 10b antibodies decreased the expression of β-catenin and cyclin Dl, inhibited cell growth, and induced apoptosis. Thus, the Wnt and Fzd genes are frequently overexpressed in HNSCC, and are attractive targets for both immunotherapy and drug therapy. [0207] We have examined tumor and normal cell lines for proteins that are involved in embryonic development. These studies suggest that at least one G-coupled protein receptor, frizzled 2, is overexpressed by many tumor cell lines. A broader panel of normal and malignant cells can be studied and immunization strategies can be developed directed towards passive and active immunotherapies against this antigen. [0208] Based on the successful experience of trastuzumab as an adjunctive passive immunotherapy as described above, an evaluation of blocking the Wnt-frizzled signaling pathway on the growth of a HNSCC line with commercially available polyclonal antibodies was performed (Figures 4 and 5). Soluble inhibitors of frizzled have been described to induce apoptosis secondary to their inhibition of frizzled signaling (Zhou, Z. J. et al, "Up- regulation of human secreted frizzled homolog in apoptosis and its down-regulation in breast tumors," it J Cancer 78:95-99 (1998)). The antibodies tested appear to have slowed the growth of the tumor line and resulted in apoptosis (Figures 4 and 5). [0209] To evaluate Wnt and Fzd receptors as potential tumor associated antigens in head and neck squamous cell cancers (HNSCC), we screened various tumor and normal cell lines by both RT-PCR, and immunoblotting. Initial screening revealed that both frizzled 2 and frizzled 5 are expressed in head and neck squamous cell cancers (HNSCC), glioma, and chronic lymphocytic leukemia (CLL) (Figure 2). Further, the results revealed that Fzd-2 was overexpressed in many HNSCC cells, compared to normal human broncho epithelial (NHBE) cells (Table 1). The amino acid sequence of Fzd-2 is very homologous to Fzd-1 and 7 (Sagara, N. etal. "Molecular cloning, differential expression, and chromosomal localization of human frizzled-1, frizzled-2, and frizzled-7," Biochem Biophys Res Comm 252, 117-122 (1998)). To confirm that frizzled 2 was specifically amplified in the tumor

Normal HNSCC CLUBurkitt Normal

Frizzled 2 GAPDH <img file="WO2004042028A2_D0001.tif" /><img file="WO2004042028A2_D0002.tif" />

lines to RT-PCR products from selected reactions were cloned into the TA vector (Invifrogen, Carlsbad, CA) and sequenced. There was 100% identity of the inserts with the human frizzled 2 sequence by BLAST search. In addition, immunoblotting showed a lack of detectable Fzd-2 protein in the lysates of NHBE in which there were weakly detectable or undetectable products by RT-PCR. The human Fzd-2 gene originally was isolated by Sagara and colleagues (Sagara 1998, infra). These investigators also found that the mRNA for Fzd-2 was not detectable in any of 15 different noπnal human adult tissues, with the possible exception of heart, hi contrast, embryonic tissues, as well as six of eight malignant cell lines, expressed abundant Fzd-2 mRNA. However, these investigators did not test for the expression of frizzled Fzd-2 protein, and mRNA levels do not necessarily coπelate with protein expression. Our studies show that Fzd-2 protein expression is prominent in HNSCC cell lines, when compared to normal NHBE cells. Hence, antibodies against specific determinants of the extracellular domain of Fzd-2 could be used to bind to and target such malignant cells.

[0210] Compared to NHBE cells, the HNSCC cell lines expressed much higher message levels of Wnt-1, Wnt-5a, Wnt-lOb and Wnt-13. Of these Wnt proteins Wnt-1, 5A, and 10b were exclusively expressed by the malignant cell lines and were not detected in the normal tissues tested. Immunoblotting experiments confirmed the overexpression of Wnt-1 and Wnt- lOb protein in several HNSCC cell lines (Figure 3). Since the tumors had high levels of both the ligands and their Fzd-2 receptors, it was important to determine if Wnt/Fzd signaling was constitutively active in the HNSCC cells. The canonical Wnt/Fzd signaling cascade leads to the accumulation of cytoplasmic β-catenin and its translocation to the nucleus^, hi the nucleus beta-catenin binds a specific sequence motif at the N terminus of lymphoid-enhancing factor /T cell factor (LEF/TCF) to generate a transcriptionally active complex (Behrens J et al. "Functional interaction of beta-catenin with the transcπption factor LEF-1," Nature 382, 638- 642 (1996)). Experiments using LEF/TCF reporter gene, TOPFLASH, demonstrated that LEF/TCF dependent transcription was active in the SNU 1076 cells.

[0211] The Wnt/frizzled pathway has been previously implicated in tumorigenesis. Soluble Wnt glycoproteins have been demonstrated to transmit signal by binding to the seven transmembrane domain G-protein coupled-receptor frizzled (Figure 1) (Bhanot, P. et al. "A new member of the frizzled family from Drosophila functions as a Wingless receptor," Nature 382:225-230 (1996); Yang-Snyder, J. et al. "A frizzled homolog functions in a vertebrate Wnt signaling pathway," Curr Biol 6:1302-1306 (1996); Leethanakul, C. et al. "Distinct pattern of expression of differentiation and growth-related genes in squamous cell carcinomas of the head and neck revealed by the use of laser capture microdissection and cDNA aπays," Oncogene 19:3220-3224 (2000)). Upon Wnt signaling, a cascade is initiated that results in the accumulation of cytoplasmic beta-catenin and its translocation to the nucleus. In the nucleus beta-catenin binds a specific sequence motif at the N terminus of lymphoid-enhancing factor /T cell factor (LEF/TCF) to generate a transcriptionally active complex (Behrens, J. et al. "Functional interaction of beta-catenin with the transcription factor LEF-1," Nature 382:638-642 (1996)). Beta-catenin interacts with multiple other proteins such as cadherin, which it links to the cytoskeleton (Hoschuetzky, H. et al. "Beta- catenin mediates the interaction of the cadherin-catenin complex with epidermal growth factor receptor," J Cell Biol 127:1375-1380 (1994); Aberle, H. et al, "Assembly of the cadherin-catenin complex in vitro with recombinant proteins," J Cell Sci 107:3655-3663 (1994)). It also associates with the adenomatous polyposis coli (APC) tumor suppressor protein and glycogen synthetase 3 beta (GSK3β) (Rubinfeld, B. et al, "Binding of GSK3beta to the APC-beta-catenin complex and regulation of complex assembly," Science 272:1023- 1026 (1996)). These proteins function to negatively regulate beta catenin by facilitating phosphorylation near the aminoterminus and thus accelerating its proteolytic degradation (Yost, C. et al, "The axis-inducing activity, stability, and subcellular distribution of beta- catenin is regulated in Xenopus embryos by glycogen synthase kinase 3," Genes Dev 10:1443-1454 (1996)). [0212] A panel of tumor cells that can be screened are derived from the panel of 60 lines which are being characterized in the National Institutes of Health Developmental Therapeutics Program. The cell lines that are currently available include: (Non-Small Cell Lung Cancer) A549/ATCC, NCI-11226, NCI-11460, HOP-62, HOP-92, (colon cancer) HT29, HCT-116, (breast cancer) MCF7, NCI ADR-RES, MDA-MB-23 1/ATCC, T-47D, (ovarian cancer) OVCAR-3, OVCAR-4, SK-OV-3, (leukemia) CKJ. - ϋM, J5_.--.oz, M&lt; J-.1- 4, HL-60 (TB), RPMI-8226, (renal cell) 786-0, TK-10, (prostate cancer) PC-3. DU-145. Normal control cell lines can be purchased from Clonetics.

[0213] Although Wnt and Fzd were expressed in HNSCC cells, they may be dispensable for cell growth and survival. Therefore, the effects of antibodies to the extracellular domains of Wnt-1 and Wnt-lOb were studied in three HNSCC lines known to express the receptors. When compared to control antibodies, both anti-Wnt antibodies slowed the growth of one of the HNSCC cell lines (SNU 1076) and resulted in apoptosis. Treatment with high levels of SFRP1, a Wnt antagonist, exerted a similar effect. Moreover, interference with Wnt/frizzled signaling in SNU 1076 cells decreased the activity of the LEF/TCF reporter gene, and reduced levels of β-catenin cyclin Dl and fibronectin. These results suggest that continued autocrine or paracrine Wnt/Fzd signaling may be required for the growth and survival of a subset of HNSCC cells. [0214] These results suggest that antibodies against Wnt and frizzled receptors may exert two different effects in HNSCC cancers in vivo. In malignant cells that depend on Wnt/Fzd signaling for survival, the antibodies might directly slow tumor growth and/or induce apoptosis. h HNSCC cells that incidentally overexpress the receptors, but do not require them for proliferation, the antibodies still could potentially target the tumor cells for killing by complement, or antibody dependent cellular toxicity. Based on these data, we believe that passive immunotherapy could be a useful adjunctive therapy in HNSCC that overexpress one or more Wnt and Fzd receptors. EXPERIMENTAL METHODS

[0215] Cell lines and culture: Ten HNSCC, 2 B lymphoma, and 2 glioblastoma cell lines were studied. Detroit-562 (pharyngeal cancer), KB (carcinoma in the floor of the mouth), RPMI-2650 (nasal septal) cancer), SCC-25 (tongue cancer), U87MG and U373MG

(glioblastoma), Ramos (lymphoma), Detroit-551 (human skin fibrob last-like cells) and WI-38 (human lung fibroblasts) were purchased from the American Type Culture Collection (Manassas, VA). The PCI-1, 13, and 50 cell lines were kindly provided by Dr. T. Wbiteside (Univ. of Pittsburgh, PA) (Whiteside, T. L. et al, "Human tumor antigen-specific T lymphocytes and interleukin-2-activated natural killer cells: comparisons of antitumor effects in vitro and in vivo," Clin Cancer Res. 4, 1135-1145 (1998); Yasumura, S. et al, "Human cytotoxic T-cell lines with restricted specificity for squamous cell carcinoma of the head and neck," Cancer Res. 53, 1461-1468 (1993)). The HNSCC cell lines SNU 1066, SNU 1076 and AMC 4 cell lines were provided by Dr. J. G. Park (Seoul National University, Korea) and Dr. S. Y. Kim (University of Ulsan, Korea), respectively (_5_.ii, j. _. et at., ".establishment and characterization of human laryngeal squamous cell carcinoma cell lines," Laryngoscope 109, 976-82 (1999); Kim, S. Y. et al. "Establishment and characterization of nine new head and neck cancer cell lines," Acta Otolaiyngol. Ill, 775-784 (1997)). Two different normal human tracheobronchial epithelial (NHBE) cells derived from different persons were purchased from Clonetics (San Diego, CA). All cancer cell lines were cultured at 37°C in a humidified atmosphere of 5% CO₂, in either RPMI 1640, DMEM (Dulbecco's modified Eagle's medium), or Ham's 12-DMEM medium, as recommended by the suppliers, supplemented with 10% fetal bovine serum. NHBE cells were cultured in the bronchial epithelial cell growth media provided by the company. Nonnal epithelial cells were obtained from scrapings of the oral mucosa of 10 normal healthy volunteers. All cell lines were found to be free of mycoplasma contamination.

[0216] RT-PCR Analyses : Total RNA was extracted by using Trizol® (Gibco BRL, Grand Island, NY), according to the manufacturer's directions. Different pairs of gene- specific primers based on GenBank sequences of cloned human Wnt and Fzd genes were used for reverse transcriptase-PCR (RT-PCR) analysis. Reverse transcription was performed with a Superscript™ Preamplification kit (Gibco BRL). One microgram of RNA was used from each sample, and 25-35 cycles of PCR were carried out. The PCR products were separated by electrophoresis, visualized under ultra violet light, and scanned with a laser densitometer. The intensities of the Wnt and Fzd bands were compared with the amplicon of the housekeeping gene G3PDH. Preliminary experiments confirmed that the PCR amplifications had not reached a plateau for all data reported in the results. The following list summarizes the primer pairs used: [0217] Fzd-2: 5'-cagcgtcttgcccgaccagatcca-3'(reverse); 5'-ctagcgccgctcttcgtgtacctg-3' (forward). Fzd-5: 5'-ttcatgtgcctggtggtgggc-3' (forward); 5'-tacacgtgcgacagggacacc-3' (reverse). Wnt-1 :-5'-cacgacctcgtctacttcgac-3' (forward); 5'-acagacactcgtgcagtacgc-3' (reverse). Wnt-5a: 5'-acacctctttccaaacaggcc-3' (forward); 5'-ggattgttaaactcaactctc-3' (reverse) Wnt- 7a: 5'-cgcaacaagcggcccaccttc-3' (forward), 5'-tccgtgcgctcgctgcacgtg-3' (reverse) Wnt-lOb: 5'-gaatgcgaatccacaacaacag; 3' (forward); 5'-ttgcggttgtgggtatcaatgaa-3'(reverse). Wnt-13: 5'-aagatggtgccaacttcaccg-3' (forward); 5'-ctgccttcttgggggctttgc-T(reverse) G3PDH: 5'-accacagtccatgccatcac -3' (forward); 5'-tacagcaacagggtggtgga -3'(reverse). [0218] The specificities of the Wnt and Fzd PCR products were confirmed by cloning and sequencing the products, using a TOPO TA Cloning kit and Ml 3 primers (Invitrogen, Carlsbad, CA). [0219] Immunoblotting: After removal of medium, ceils m logarithmic growth were disrupted in lysis buffer [25 mM Tris HCI, 150 mM KC1, 5 mM EDTA, 1% NP-40, 0.5% sodium deoxycholic acid, 0.1% sodium dodecyl sulfate] including phosphatase and protease inhibitor cocktails. Each lane of an SDS-PAGE gel was loaded with 20 μg-of protein. After electrophoresis, the proteins were transfeπed to a polyvinylidene difluoride (PVDF) membrane, blocked with 2% I-block™ (Tropix Inc, Bedford, MA) containing 0.05% Tween- X in PBS, and then incubated with primary antibody. Horseradish peroxidase-conjugated anti-IgG (Santa Cruz Laboratories, Santa Cruz, CA) was used as the secondary antibody. The membranes were developed using a chemiluminescence system (ECL detection reagent: Amersham Life Science, Aylesbury, UK), and scanned with a laser densitometer. The membranes were stripped with Re-Blot™ Western blot recycling kit (Chemi-Con International Inc, Temecula, CA) and reprobed using other antibodies and actin monoclonal antibody (Chemi-Con International Inc) as a control. Prestained molecular weight markers (New England Biolabs, Beverly, MA) were used as reference. [0220] Antibodies: Polyclonal antibodies specific for the amino terminal extracellular domains of Wnt-1 and Wnt-lOb, and for the carboxy terminal region of Fzd-2, were purchased from Santa Cruz Laboratories, and monoclonal antibodies specific for β-catenin and fibronectin were purchased from Transduction Laboratories (Lexington, KY). Antibodies to cyclin Dl and actin were purchased from PharMingen (San Diego, CA) and Chemi-Con International Inc., respectively. Purified recombinant human soluble frizzled- related protein- 1 was prepared in Dr. J. Rubin's laboratory as described previously (Uren, A. et al, "Secreted frizzled-related protein-1 binds directly to Wingless and is a biphasic modulator of Wnt signaling," J Biol Chem. 275, 4374-4382 (2000)). [0221] MTT (3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyl tetrazolium bromide)-based cell assay: Cell proliferation was detennined by a colorimetric MTT assay. Briefly, either 7.5 - 10 x 10 cells were dispersed in each well of a 96 well plate. Twenty-hours after culture, 4 different concentrations of anti-Wnt-1 or ant- Wnt-lOb antibody (2 μg/ml, 0.2 μg/ml, 20 ng/ml, and 2 ng/ml) were added to the cultures. The same concentrations of goat antihuman IgG (Fisher Scientific) were used as an isotype control. The antibodies were dialyzed against tissue culture medium prior to use, to remove preservatives. On 1, 2, 3, or 4 days after incubation, 20 μl of MTT solution was added to each well. Four hours later the cells were lysed, and absorbances at 570 nM and 650 nM were measured and growth, as a percentage of control, was determined from the formula: [0222] % of control growth = (B-A)/(C-A) x 100 [0223] where A= absorbance at start of incubation, J-J = absorbance after incubation with antibodies tested, C = absorbance after incubation with control antibody. The assays were performed in triplicate, and the results represent the mean value ± standard deviation from four independent experiments. [0224] Flow Cytometry: Cell apoptosis was assayed by propidium iodide (PI) and DIOC₆ staining, followed by flow cytometry. The HNSCC line, SNU1076, was treated with 2 μg/ml anti-Wnt- 1, anti-Wnt- 10, or control IgG for 72 hrs. Cells were detached from the flasks by trypsin treatment and incubated for 10 minutes in medium with 5 μg/ml PI and 40 nM DiOC₆, and then were analyzed by flow cytometry in a FACS caliber (Becton-Dickinson, San Jose, CA). Viable cells had high DiOC₆ (FL-1) and low PI (FL-3) fluorescence, whereas apoptotic cells had low DiOC₆ (FL-1) and low PI (FL-3) fluorescence.

[0225] Tumor and normal cell lines can be identified that express frizzled 2. Ten cell lines that express frizzled 2 and at least two cell lines that do not can be tested as described above for figure 4. The mouse sera that tests for highest titer and specificity will be used in the cell cultures. The cells will be exposed to graded amounts of polyclonal anti-frizzled 2 mouse sera and normal control serum. On days 1, 2, 3, and 4 subsets of the replicate wells will be assayed for proliferative capacity. On successive days 20 μl of MTT (3-[4,5-dimethylthiazol- 2-yl]-2,5-diphenyl tetrazolium bromide)-based solution will be added to wells for four hours prior to lysis with 15% SDS, 0.015 M HCI . Absorbencies of 570 and 650nm will measured. These measurements will be performed in triplicate and statistical relevance will be assessed by Students t test for P&lt;.05.

[0226] The selected cell lines will also undergo analysis for DNA content by Propidium iodide (PI) staining. Cell lines treated for 72 hours in the presence of graded concentrations of normal or immunized mouse serum will be trypsinized, incubated for 10 minutes with 5 μg/ml PI and 40 nM DiOC₆, and analyzed by flow cytometry. Viable cells will be DiOC₆ (FL-1) high and PI (FL-3) low, and apoptotic cells will be DiOC₆ (FL-1) low and PI (FL-3) low. Additionally, cells will detached from the flasks with trypsin and incubated overnight in a hypotonic buffer (0.1 % citrate, 0.1 % SDS) containing 50 μg/ml PI and 100 μg/ml RNase. The amount of DNA will be measured by flow cytometry. Apoptotic cells are defined as having a DNA content lower than the G₀Gι levels (sub-G₀ cells).

[0227] Transient Luciferase Assays: The pTOPFLASH-Luc reporter gene vector and the pFOPFLASH-Luc control were kindly provided by Dr. Hans Clevers (University Medical Center Utrecht, The Netherlands). For TOPFLASH/FOPFLASH reporter gene assays, SNU 1076 cells were cotransfected with 0.5 μg of pTOPFLASH-Luc or pFOPFLASH-Luc and 0.5 μg of pCMV-βGal, as described previously (Korinek, V. et al, "Constitutive transcriptional activation by a beta-catenin-Tcf complex in APC -/- colon carcinoma," Science 275, 1784- 1787 (1997)). Cells were harvested 24h after transfection, disrupted in lysis buffer, and luciferase and β-galactosidase activities were determined using the Dual-Light reporter gene assay system (Applied Biosystems, Foster City, CA). Luciferase activities of each pTOPFLASH-Luc or pFOPFLASH-Luc transfected culture, and the β-galactosidase activities of pCMV-βGal transfected cells, were measured in the same samples using a luminometer. The transfection efficiencies of the samples were normalized by the activity of β- galactosidase.

Example 1: Immuno genicity of isolated non-homologous regions of frizzled 2. [0228] The first extracellular domain of frizzled 2 contains a region which based on protein structure is least homologous to the other frizzled protein family members (Figure 6) (Sagara, N. et al. "Molecular cloning, differential expression, and chromosomal localization of human frizzled-1, frizzled-2, and frizzled-7," Biochem Biophys Res Commun 252:117-122 (1998)). This polypeptide sequence may have sufficient ternary structure to generate an antibody response to the native protein. In order to enhance B cell stimulation this epitope will be coupled to T cell epitopes that have been described to generate T cell help. [0229] The overall strategy will be to use the least conserved region of the frizzled protein, attempting to preserve the most native structure possible and to generate the most potent immune response. The most versatile method for designing vaccines of defined regions is naked plasmid DNA. The advantages are that the vectors can be rapidly redesigned to change the length of sequence that is expressed, discontinuous regions of the protein can be co-expressed, and the DNA sequence of the protein can be fused to other epitopes to enhance antigenicity (O'Hem, P. A. et al. "Colinear synthesis of an antigen-specific B-cell epitope with a 'promiscuous' tetanus toxin T-cell epitope: a synthetic peptide immunocontraceptive," Vaccine 15:1761-1766 (1997); Paterson, M. et al, "Design and evaluation of a ZP3 peptide vaccine in a homologous primate model," Mol Hum Reprod 5:342-352 (1999); Dakappagari, N. K. et al, "Prevention of mammary tumors with a chimeric HER-2 B-cell epitope peptide vaccine," Cancer Res 60:3782-3789 (2000)). It affords the versatility of expressing soluble, membrane bound proteins, or small peptide fragments. Also gene transfer by this technique is a powerful tool to introduce multiple protein elements into the same or separate locations. In this system single or multiple proteins can be locally expressed. Injecting a combination of plasmids expressing antigens and costimulators like B7.1 and B7.2 results in enhanced immune responses (Con, M. et al, "Costimulation provided by DNA immunization enhances antitumor immunity," J Immunol 159:4999-5004 (1997); Chan, K. et al, "The roles of mhc class ii, cd40, and b7 costimulation in ctl induction by plasmid dna (DNA?)," J Immunol 166:3061-3066 (2001)). [0230] Several plasmids have been constructed which are under the control of the cytomegalovirus (CMV) promoter which has been found to enable high levels of antigen expression in injected muscle. The pCMVint vector includes the cytomegalovirus (CMV) El promoter, the simian virus (S V40) t-intron, and the SV-40 polyadenylation site (Con, M. et al. "Gene vaccination with naked plasmid DNA: mechanism of CTL priming," JExp Med 184:1555-1560 (1996)). The ACB vector has the same elements except the polyadenylation sequence is from the bovine growth hormone gene (Sato, Y. et al. "Immunostimulatory DNA sequences necessary for effective intradermal gene immunization," Science 273:352-354 (1996)). The first set of plasmid constructs planned will encode the least homologous region of the frizzled 2 between the ninth and tenth cysteines. These cysteines will be preserved in this series of constructs as they may stabilize a configuration that enables antibody binding to the native protein. This polypeptide fragment will be fused at the aminoterminus or the carboxylterminus via a short linker to a tetanus toxin or measles virus fusion (MVF) protein T helper epitopes (see below) (O'Hem, P.A. et al. "Colinear synthesis of an antigen-specific B-cell epitope with a 'promiscuous' tetanus toxin T-cell epitope: a synthetic peptide immunocontraceptive," Vaccine 15:1761-1766 (1997); Paterson, M. et al "Design and evaluation of a ZP3 peptide vaccine in a homologous primate model," Mol Hum Reprod 5:342-352 (1999); Dakappagari, N. K. et al, "Prevention of mammary tumors with a chimeric HER-2 B-cell epitope peptide vaccine," Cancer Res 60:3782-3789 (2000)). These minigenes will be constructed with overlapping oligonucleotides. The oligonucleotides are 5' prime phosphorylated with T4 kinase at room temperature for 30 minutes, annealed by boiling an equimolar admixture of two complementary oligomers and slow cooling. The double stranded oligonucleotides are then ligated 3' to the tissue plasminogen leader (TPA) leader into the EcoR47111 site in frame and into the BamHl site of the pBluescript SKII vector. The minigene is then subcloned into the pCMV and pACB vectors between the Pstl and Xbal sites as previously described (Con, M. et al, "Costimulation provided by DNA immunization enhances antitumor immunity," J Immunol 159:4999-5004 (1997)). [0231] The inserts for the vectors are designed as described above. The frizzled putative B cell epitope is from the published sequence. The tetanus toxin and measles MVF T helper epitopes have been optimized for human codon usage by the most frequently used codon per amino acid. The DNA constructs have an initiating methiomne and stop codons added to the 5' and 3' ends respectively. The aminoacid and DNA sequences are summarized below with the short GPSL linker sequence in bold and the T cell helper epitope underlined.

Tetanus toxin epitope fused to a frizzled domain

pFZD2-TT MCVGQNHSEDGAPALLTTAPPPGI-QPGAGGTPGGPGGGGAPPRYAT EHPFHC -GPSL-

VDDALINSTKIYSYFPSV-STOP

ATG TGC GTC GGC CAG AAC CAC TCC GAG GAC GGA GCT CCC GCG CTA CTC ACC ACC GCG CCG CCG CCG GGA CTG CAG CCG GGT GCC GGG GGC ACC CCG GGT GGC CCG GGC GGC GGC GGC GCT CCC CCG CGC TAG GCC ACG CTG GAG CAC CCC TTC CAC TGC-GGC CCC AGC CTG- GTG GAC GAC GCC CTG ATC AAC AGC ACC AAG ATC TAC AGC TAG TTT CCC AGC GTG TAG pTT-FZD2

MVDDALINSTKIYSYFPSV-GPSL-

CVGQNHSEDGAPAL TTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHC-STOP ATG GTG GAC GAC GCC CTG ATC AAC AGC ACC AAG ATC TAC AGC TAC TTT CCC AGC GTG-GGC CCC AGC CTG-TGC GTC GGC CAG AAC CAC TCC GAG GAC GGA GCT CCC GCG CTA CTC ACC ACC GCG CCG CCG CCG GGA CTG CAG CCG GGT GCC GGG GGC ACC CCG GGT GGC CCG GGC GGC GGC GGC GCT CCC CCG CGC TAC GCC ACG CTG GAG CAC CCC TTC CAC TGC TAG Measles MVF epitope fused to a frizzled domain

PFZD2 -MMVF

MCVGQ HSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHC-GPS -

KL SLIKGVIVHRLEGVE-STOP

ATG TGC GTC GGC CAG AAC CAC TCC GAG GAC GGA GCT CCC GCG CTA CTC ACC ACC GCG CCG CCG CCG GGA CTG CAG CCG GGT GCC GGG GGC ACC CCG GGT GGC CCG GGC GGC GGC GGC GCT CCC CCG CGC TAC GCC ACG CTG GAG CAC CCC TTC CAC TGC-GGC CCC AGC CTG- AAG CTG CTG AGC CTG ATC AAG GGC GTG ATC GTG CAC CGC CTG GAG GGC GTG GAG TAG

PMMVF-FZD2 MKLLSLIKGVIVHRLEGVE-GPSL-

CVGQNHSEDGAPA LTTAPPPG QPGAGGTPGGPGGGGAPPRYATLEHPFHC-STOP

ATG AAG CTG CTG AGC CTG ATC AAG GGC GTG ATC GTG CAC CGC CTG GAG GGC GTG GAG-GGC CCC AGC CTG-TGC GTC GGC CAG AAC CAC TCC GAG GAC GGA GCT CCC GCG CTA CTC ACC ACC GCG CCG CCG CCG GGA CTG CAG CCG GGT GCC GGG GGC ACC CCG GGT GGC CCG GGC GGC GGC GGC GCT CCC CCG CGC TAC GCC ACG. CTG GAG CAC CCC TTC CAC TGC TAG

[0232] Plasmid DNA is prepared using Qiagen Maxiprep (Chatsworth, CA) kits with the modification of adding one tenth volume 10% Triton X-114 (Sigma, St. Louis, MO) to the clarified bacterial lysate prior to applying it to a column. Prior to injection the residual endotoxin level is quantified using a limulus extract clot assay (Associates of Cape Cod,

Woods Hole, MA). A level of less than or equal to 5 ng endotoxin/μg DNA need be obtained prior to use in an animal (Con, M. et al. "In vivo priming by DNA injection occurs predominantly by antigen transfer," J Immunol 163:4721-4727 (1999)). The DNA is resuspended in a sterile pyrogen free saline solution for injection.

[0233] Twenty-eight female mice will be divided into groups of 4 mice each. They will be injected in the dermis of the tail with a combination of 50 pg plasmid encoding a costimulator (B7-1 or B7-2) and 50 μg linker plasmid diluted in normal saline at weeks zero, one and two. A group with empty vector is included as a negative control. The groups are as follows:

Group Plasmid 1 Plasmid 2

A pTT-FZD2 nCMV

B pTT-FZD2 nCMVB7-l

C pTT-FZD2 nCMVB7-2

D pFZD2-TT nCMV

E pFZD2-TT nCMVB7-l

F pFZD2-TT nCMVB7-2

G nCMV

[0234] Another group of mice in similar groups will be immunized using the pMMVF- FZD2 and pFZD2-MMVF set of linked epitope plasmids. The nCMVB7-l and nCMVB7-2 constructs encode the cDNAs for murine CD80 and CD86, wliich were kindly provided by G. Freeman (Dana-Farber Cancer Institute, Boston, MA) (Con, M. et al, "Costimulation provided by DNA immunization enhances antitumor immunity," J Immunol 159:4999-5004 (1997)). [0235] Mice will be bled prior to the start of the experiment and then every two weeks thereafter. Serum will be separated and stored at -20°C prior to testing. On week ten (seven weeks after the last injection) mice will be sacrificed. The titers of antibody will be tested by anti-peptide ELISA. Ninety-six well plates (Costar) are coated with 50 μl/ well 20 μg/ml peptide in phosphate buffered saline (PBS) overnight at 4°C. The plates are then washed and blocked with 200 μl/ well 2% bovine serum albumin (BSA) in PBS. Sera are diluted in 2% BSA in PBS. After overnight incubation at 4°C the plates are washed. Bound murine IgG is detected by alkaline phosphatase conjugated-goat anti-murine IgG (Jackson hnmunoresearch Laboratories) followed by p-nitrophenylphosphate substrate. The titration curves for each sera are compared using DeltaSOFT II v. 3.66 (Biometallics, Princeton, NJ). [0236] Mice that develop sufficiently high titers of antibody that bind to the peptide will be tested for specificity to frizzled 2 by fluorescent cytometry with cells that express the protein by transfection and known tumor cells that have the mRNA. We will also test the binding by Western blot analysis of cells that express this isofoim and to cells that have been found to express other frizzled family members. Briefly, immunoblotting will be performed as described above. Cells are lysed in with a solution contaimng 25 mM Tris HCI, 150 mM KC1, 5 mM EDTA, 1% NP-40, 0.5 % sodium deoxycholic acid, 0.1 % sodium dodecyl sulfate, ImM NaVO₃, 1 mM NaF, 20 mM β-glycerophosphate and protease inhibitors. Twenty μg of protein from each cell line is separated by SDS-PAGE and transfeπed to a PVDF membrane. The membrane is soaked in 2% I-block, 0.05% Tween X in PBS and then incubated with a 1:500 dilution of polyclonal pre or post immunization mouse serum at 1:500 dilution. Murine antibody binding is then detected by horseradish peroxidase-conjugated rat aήti-mouse IgG and chemiluminescence (ECL detection reagents). To verify relative amount of protein transfeπed in each lane, the blots are then stripped and the presence of actin is measured with an actin monoclonal antibody.

[0237] Different immunization strategies are being evaluated for their efficacy in eliciting a humoral immune response. If the antibody response is weak then the vectors can be redesigned with other known potent T helper epitopes. Other vectors can be designed where the polypeptide from frizzled 2 is shorter and does not contain the cysteines, which may be inhibiting the most desirable conformation. Another immunization strategy will be to use a prime boost method. The animals are originally injected with plasmid DNA and then are boosted with peptide or recombinant protein in incomplete Freund's adjuvant. The B-cell epitope in each construct may need to be redesigned until there is no cross-reactivity in the humoral response to other frizzled isoforms.

Example 2: Expression of Wnt and Fzd mRNAs in HNSCC

[0238] Ten different HNSCC cell lines, two normal human broncho-epithelial (NHBE) cell lines, and normal oral squamous epithelial cells were tested by RT-PCR for the expression of five Wnts (Wnt-1, Wnt-5a, Wnt-7a, Wnt-lOb, Wnt-13), and two Fzds (Fzd-2 and 5). Representative results are illustrated in Figure 8 and are summarized in Table 1. When compared to the housekeeping gene G3PDH, all the Wnts, as well as Fzd-2, were expressed more frequently in HNSCC than in normal cells, while there was no difference in Fzd-5 gene expression. Of the Wnt genes, Wnt-1, 5a, and 10b were most strongly expressed by the malignant cells, but were barely detectable in the normal tissues tested. We then investigated further Wnt-1 and Wnt-lOb, since these Wnts signal through the canonical β-catenin and LEF/TCF, and because antibodies to the extracellular domains were available. Example 3: Expression of Wnt/Fzd proteins in HNSCC

[0239] Cell lines were lysed and analyzed for Wnt-1, Wnt-lOb, Fzd-2, and β-catenin protein expression by immunoblotting (Figure 9). The normal cells expressed much less of these Wnt or Fzd proteins, when compared to the tested HNSCC, with the exception of RPMI 2650. Of note is the lack of detectable Fzd protein in the lysate of the NHBE cell line that had a weakly detectable product by RT-PCR. Beta-catenin was detected in all the samples, including both HNSCC and NHBE lines. Example 4: Effects of Anti-Wnt antibodies and SFRP1.

^■ [0240] Treatment with antibody against the extracellular domains of Wnt-1 or Wnt -10b decreased the proliferation of the SNUl 076 HNSCC cell line (Figure 10), while little effect was observed in PCI 13 cells (data not shown). The inhibition of cell growth by the antibodies was dependent on the concentration and incubation time. The treatment of the SNUl 076 HNSCC cell line with anti-Wnt antibodies, but not control antibody, also induced apoptosis (Figure 12). Similar to anti-Wnt antibodies, treatment with recombinant SFRPI protein (2 μg/ml), a natural antagonist of Wnt signaling, inhibited growth of SNU 1076 cells (Figure 11).

[0241] To determine if the effects of anti-Wnt antibody on SNUl 076 cells were related to inhibition of Wnt signaling, we compared levels of the Wnt regulated genes cyclin Dl and fibronectin (Figure 7A). The anti-Wnt- 1 antibody, but not the control IgG, reduced cyclin Dl, fibronectin, and β-catenin levels in the cytosol of SNU 1076 cells. To confirm these results, TOPFLASH-Luc, a reporter plasmid containing TCF/LEF binding sites, or FOPFLASH-Luc, a negative control plasmid having mutant binding sites was introduced into SNU 1076 cells together with the pCMV-β-gal plasmid (to assess transfection efficiency). Luciferase activity was higher in the TOPFLASH than the FOPFLASH transfected cells, indicating that LEF/TCF dependent transcription was constitutively active. Cells transfected with FOPFLASH showed no changes in the low baseline luciferase activity after treatment with anti- Wntl antibodies, whereas cells transfected with TOPFLASH displayed decreased luciferase activity (Figure 7B). Example 5: Effects of Anti-Frizzled antibodies.

[0242] Wnt signaling through frizzled receptors has been described to inhibit apoptosis (Chen, S. et al. "Wnt-1 signaling inhibits apoptosis by activating beta-catenin/T cell factor- mediated transcription, "J Cell Biol 152:87-96 (2001)). Also some of the genes that are regulated by TCF/beta-catenin are known to be associated with the cell cycle and cellular proliferation. By blocking the binding of Wnt proteins to their receptors via antibodies directed to the extracellular portion of frizzled this pathway can be interrupted. Decreasing the downstream translocation of beta-catenin to the nucleus could result in slower tumor growth or death of the cell.

[0243] The immunization strategy that may be useful in teπns of raising specific antibodies that delay growth in cell culture will then be tested for potential in vivo efficacy in mice. Previously we have used the H-2 thymoma line EL4 as a syngeneic tumor in C57B1/6 mice (Con, M. et al, "Costimulation provided by DNA immunization enhances antitumor immunity, "J Immunol 159:4999-5004 (1997); (Cho, H.J. et al, "hnmunostimulatory DNA- based vaccines induce cytotoxic lymphocyte activity by a T-helper cell-independent mechanism," Nat Biotechnol 18:509-514 (2000)). This line will be transfected with a human frizzled 2 expression vector and selected in neomycin. The expression vector will be made by excising the frizzled 2 containing insert from one expression vector with Ndel and BamHl and ligating the insert into pcDNA3 (Invitrogen) which has a CMV promoter and a neomycin selection cassette. Thirty-two female C57B1/6 mice will be divided into groups of 8 mice each. They will be injected in the dermis of the tail with a combination of 50 μg plasmid encoding a costimulator and 50 μg linker plasmid diluted in normal saline at weeks zero, one and two. A group with empty vector is included as a negative control. On day 28 the mice will be injected subcutaneously in the flank with 20x10⁶ frizzled 2 transfected EL4 cells or untransfected cells (Cho, H. J. et al, "hnmunostimulatory DNA-based vaccines induce cytotoxic lymphocyte activity by a T-helper cell-independent mechanism," Nat Biotechnol 18:509-514 (2000)). The mice will be monitored three times a week for weight, and tumor growth measured with a caliper. Tumor volume is calculated by lengthxwidth² x 7τ/6 as previously described (Radulovic, S. et al, "Inhibition of growth of HT-29 human colon cancer xenografls in nude mice by treatment with bombesin/gastrin releasing peptide antagonist (RC-3095)," Cancer Res 51:6006-6009 (1991)). Mice will be sacrificed four weeks post tumor challenge or if the tumor burden reaches approximately 2000mm . Inhibition of tumor growth will be determined by ANOVA. [0244] The polyclonal antibodies that are generated by the immunization strategies may exhibit binding, but may not be sufficiently concentrated in the polyclonal serum to have a biologic effect. The serum from several immunization strategies may need to be tested in vitro for their potential therapeutic utility before proceeding with the in vivo active immunization strategy for tumor prevention. The inhibition of tumor growth in the murine model may be due to cellular responses as well as humoral, wliich will lead to further investigations. These assays may be useful in determining if the frizzled expressing cell lines are susceptible to anti-proliferative activity of polyclonal anti-frizzled IgG.

Example 6: Overexpression of Wnt 14 and 16

[0245] Based upon sequences in the public human DNA gene database, we prepared gene- specific primers for all the known human Wnt and frizzled genes. We obtained mRNA from primary human chronic lymphocytic leukemia cells or normal human lymphocytes. Using real time PCR, we then compared the relative expression of the Wnt and frizzled genes in the normal and malignant lymphocytes, compared to the control genes GAPDH and 18S mRNA. We discovered that Wnt 16 was 70-100 fold overexpressed in the malignant lymphocytes. Wnt 14 was 400 fold overexpressed in the malignant lymphocytes. We sequenced the amplicons to determine their identities. Northern blots of normal human tissues confirmed the lack of significant expression of Wnt 16 mRNA in non-lymphoid cells and in peripheral blood lymphocytes. Following the procedures described above, we have confirmed the overexpression of Wnt 16 in the malignant cells using non-crossreactive antibodies and will confirm overexpression of Wnt 14 in a similar fashion. We have tested the effects of the anti- Wnt 16 antibodies on cell survival in vitro, using normal lymphocytes as a control and will test anti-Wnt 14 antibodies in a similar fashion. In addition, upon review of our results, we can develop these antibodies and antigens as therapeutic agents.

Example 7: Regulation of lymphocyte survival by integrins.

[0246] The survival of lymphocytes requires that they interact with the extracellular matrix proteins produced by stromal cells in their sunounding micro environment. These interactions may render the cells resistant to spontaneous and drug-induced apoptosis. NLA4 integrin-mediated cell adhesion is known to be involved in regulating cell survival in some leukemic cell lines. We are studying integrin effects on the survival of primary blood lymphocytes. Our data show that the α4-CS 1 fragment of fibronectin significantly improves the survival of blood lymphocytes. To develop a potential therapeutic strategy that combines integrin antagonists with cytotoxic drugs, we are investigating the mechanism of several integrin α4-specific antagonists. These compounds specifically inhibit the adhesion of B chronic lymphocytic leukemia cells to fibronectin. we are cunentiy studying me signaling events affected by these integrin antagonists in primary human lymphocytes.

Example 8: Wnt gene expression in normal and malignant lymphocytes. [0247] The secreted proteins of the diverse Wnt gene family are known to play an important role in cell growth and differentiation. Evidence suggests that Wnt signaling may regulate apoptosis. Experiments described below were designed to identify the Wnt genes that are most highly expressed in resting lymphocytes, and then to deteπnine their potential role in cell survival. [0248] Total RNA was prepared and treated with RNase- free DNase. The cDNA was synthesized from 5 μg total RNA using Superscript reverse transcriptase and oligo dT. To assure that there was no genomic DNA contamination, controls in which no reverse transcriptase was added were also carried out. TaqMan real-time PCR was performed using an ABI PRISM 7700 sequence Detector. Primers and probes for 46 Wnt family members and their related genes were designed using Primer Express version 1.0 (Applied Biosystems).

The primers are shown in Figs. 13A and 13B. The reaction conditions were as follows: 2 min at 50°C (one cycle), 10 min at 95°C (one cycle), and 15s at 95°C and 1 min at 60° C (45 cycles). Two replicates for each gene were performed. [0249] Having developed and validated a TaqMan real-time PCR assay to quantify the gene expression profiles of the wnt family and its related genes, we measured the gene expression profile in three B-CLL, two normal peripheral blood lymphocyte populations, and one purified B cell sample. We found that wnt6, wntl4 and wntl 6 were overexpressed in B-CLL, compared to normal PBL or purified B cells. Wntl4 mRNA levels in B-CLL were 16-178 times those of PBL and B cell samples. The concentration of wnt6 mRNA in B-CLL samples was 8-32 fold higher than that in normal PBL and B-CLL samples. Wntl6 mRNA was expressed at 32-178 higher levels in B-CLL than in PBL. For other Wnt-related families, such as Fzd, Frp, Wisp and DKK, we did not observe any significant differences. Thus, the Wnt gene overexpression appears to be unique. [0250] We have established a model system to study the integrin-dependent interaction of primary human lymphocytes with extracellular matrix proteins, and have shown that the binding promotes cell survival. We can now test the effects of integrin antagonists on cell signaling and apoptosis in both normal and malignant cells. [0251] Other experiments revealed three wnt genes that are overexpressed in lymphocytes of patients with B-CLL, compared to normal peripheral blood lymphocytes. Since wnt proteins are secreted, they may function as survival factors for the malignant cells. [0252] The specificities of the feeder cell-lymphocyte interactions that delay senescence and apoptosis are identified by using purified lymphocyte subpopulations (CD4, T cells, CD8, T cells, B cells), co-culturing with different feeder cells (monocytes, dendritic cells, endothelial cells, fibroblasts), and then measuring both spontaneous and drug-induced apoptosis. [0253] The specific surface molecules and/or secreted factors responsible for the extended survival of the lymphocytes are identified by testing the effects of blocking antibodies against surface antigens on the feeder cells and the lymphocytes, determining the effect of neutralizing antibodies against cytokines and growth factors, and generating sense and anti- sense transfectomas of feeder cells to confirm the roles of the specific interaction revealed in the first two methods described. [0254] The intracellular signaling pathways in quiescent lymphocytes that are altered by contact with feeder cells, and that increase their survival are identified by determining levels and phosphorylation status of proteins in key activation pathways (mitogen activated protein kinase, STATs, NF-Kb, b-catenin), assessing levels and phosphorylation status of proteins that regulate apoptosis (bcl2 family members, caspases, IAPs, SMAC/DIABLO), and testing the effects of pharmacologic inhibitors of signal transduction on the survival of quiescent lymphocytes cultivated with feeder cells, alone or in combination with cytotoxic agents.

Example 9: Expression of Wnt and Fzd genes in primary breast cancer tumors and CLL cells. [0255] Wnt and Fzd levels were compared in primary cancer cells from breast cancer tumors and CLL cells. Results are shown in Figures 14-27. Primers and hybridization probes are shown in Figure 13A and 13B. Gene expression levels were determined using real time PCR. Briefly, total RNA was isolated from microdissected tissues using RNA STAT-60, and reverse transcribed using random hexamer primers and a Superscript Preamplification System. Then real time PCR was performed using 18S RNA as a control gene. PCR was performed in a Taqman Universal PCR MasterMix with initial activation at 95 °C for 15 sec and 60 °C for 10 min, and 40 cycles of 95 °C for 15 sec and 60 °C for 1 min. The fluorescent signal was plotted versus cycle number, and the threshold cycle was determined. Dilutions of cDNA from a pool of 12 normal tissues served as a positive control. The relative message levels were calculated relative to standard calibration curves, which were used in common by the different components of the SCOR, and coordinated by the Research Resources Core. The pairwise comparisons between different sites in the tested tissues were used for statistical analyses. Figure 13 A and 13B show the primer sets and the Taqman hybridization probes for the analyzed genes. These primers were previously validated in analyses of normal human tissues and unfractionated RA synovial specimens

[0256] The data in the figures are relative, with the lowest normal tissue level assigned a value of one. Thus, a relative value of 100 in breast cancer tumor or CLL cells means that the cancer cells had 100 times the values of the lowest normal tissue, as reported by real time PCR. [0257] CLL cells have high wntl 6 levels, and also over-express wnt3. (Figure 14.) CLL cells also express Fzd 3. (Figure 16-17.)

[0258] Breast cancer cells expressed very high wnt7b levels. (Figures 14 and 27.) Other specific Wnts that are expressed at levels greater than 5 times normal cell levels in breast tumors include wnt 5a, wnt 10b, and wnt 14. (Id.) Breast cancer tumors also expressed specific Fzd at high levels, including fzd 3, fzd 4, fzd 6, fzd 7, and fzd 10. (Figure 16-19) [0259] Expression levels of Wnt downstream signaling genes and Wnt antagonists were also determined in normal cells, CLL cells, and primary breast tumors. The levels of these genes coπelate with activity of the expressed wnt genes and proteins. DKKs and FRP 2/4 are antagonists of wnt/fzd signaling pathway that bind either the wnts or the frizzled co-receptor LRP5. DKK levels were increased in some breast cancer tumors. (Figure 20.) FRP 2/4 were overexpressed in some breast cancer tumors. (Figure 21.)

[0260] Wnt inducible genes include cyclin Dl, c-myc, and the WISP's. WISP refers to wnt- inducible serum protein and WISP2 refers to wnt-inducible serum protein 2. WISP2 expression was increased in breast tumor cells. (Figure 27.) Cyclin Dl and c-myc levels were also high relative to expression levels in normal cells. (Figures 23-24 and 27.) Cyclin Dl levels were also elevated in CLL cells relative to normal lymphocytes. (Figures 23-24.) This indicates that the specific wnt and fzd expression seen in breast tumors leads to induction of genes and proteins downstream from the wnt/fzd signal. That is, the specific wnt and fzd proteins are active and their expression results in signal transduction. Levels of control gene products IL-6 and MMP3, a breast cancer marker were also determined. (Figures 25-27.)

[0261] Because some genes induced by a specific wnt/fzd signal are required for proliferation in specific cell types, including cancer cells, blocking a specific wnt/fzd signal by blocking binding of the two molecules can be used to inhibit cellular proliferation. For example, cyclin Dl is required for passage through the Gl/S transition m some cells types, lhus, antibodies against a specific wnt or fzd, alone or in combination, can be used to block a specific wnt/fzd interaction resulting in inhibition of cell proliferation or in some case induction of apoptosis. [0262] Levels of wnt 5a, wnt 7b, wnt 10b, and wnt 14 expression are determined in samples from breast cancer tumors. If a wnt gene or protein is highly expressed, antibodies against the overexpressed gene product (e.g., wnt5a, wnt7b, wnt 10b, or wnt 14) are administered to the patient. Administration of the wnt-specific antibody blocks wnt signaling and can result in diminished or no expression of required downstream wnt regulated genes and protein, (e.g., cyclin Dl, c-myc, and members of the WISP family), leading to the death of the breast cancer cells, hi some instances the wnt-specific antibody is radiolabeled or conjugated to a toxin to facilitate killing of the cancer cells. Induction of the complement cascade or radiolabeled or toxin-conjugated antibodies are used to kill breast cancer cells that overexpress a specific wnt, but do not require on that specific wnt for proliferation or survival or prliferation.

[0263] Levels of fzd 3, fzd 4, fzd 6, fzd 7, and fzd 10 expression are determined in samples from breast cancer tumors. If a fzd gene or protein is highly expressed, antibodies against the overexpressed gene product (e.g., fzd 3, fzd 4, fzd 6, fzd 7, and fzd 10) are administered to the patient. Administration of the fzd-specific antibody blocks fzd signaling and can result in diminished or no expression of required downstream fzd regulated genes and protein, (e.g., cyclin Dl, c-myc, and members of the WISP family), leading to the death of the breast cancer cells. In some instances the fzd-specific antibody is radiolabeled or conjugated to a toxin to facilitate killing of the cancer cells. Induction of the complement cascade or radiolabeled or toxin-conjugated antibodies are used to kill breast cancer cells that overexpress a specific fzd, but do not rely on that specific fzd for survival.

[0264] Levels of wntlδ and wnt3 expression are determined in samples from CLL cells. If a wntl 6 or a wnt3 gene or protein is highly expressed, antibodies against the overexpressed gene product (e.g., wntl 6 or wnt3) are administered to the patient. Administration of the wnt-specific antibody blocks wnt signaling and can result in diminished or no expression of required downstream wnt regulated genes and protein, leading to the death of the CLL cells. In some instances the wnt-specific antibody is radiolabeled or conjugated to a toxin to facilitate killing of the cancer cells. Induction of the complement cascade or radiolabeled or toxin-conjugated antibodies are used to kill CLL cells that overexpress a specific wnt, but do not rely on that specific wnt for survival. [0265] Levels of Fzd 3 expression are determined in samples from CLL cells. If a Fzd 3 gene or protein is highly expressed, antibodies against the overexpressed gene product (e.g., Fzd 3) are administered to the patient. Administration of the Fzd 3-specific antibody blocks Fzd 3 signaling can result in diminished or no expression of required downstream fzd regulated genes and protein, leading to the death of the CLL cells. In some instances the Fzd 3-specific antibody is radiolabeled or conjugated to a toxin to facilitate killing of the cancer cells. Induction of the complement cascade or radiolabeled or toxin-conjugated antibodies are used to kill CLL cells that overexpress a specific fzd, but do not rely on that specific fzd for survival.

Example 10: Expression of Wnt and Fzd genes in human tonsils and mantle zone lymphomas [0266] Noπnal human tonsil were stained using the anti- wntl 6 antibodies. The antibodies stained mainly the B cells in the mantle zone and the germinal centers, that are thought to be immature or activated B cells. (Data not shown.) [0267] Mantle zone lymphomas are an incurable, aggressive B cell neoplasm, and represent a target for the specific wntl6 antibody. Mantle zone lymphoma cells are assayed for wntl6 expression using real time PCR as described above and using wntl 6 specific antibodies. Mantle zone lymphomas that overexpress wnt 16 relative to normal B cells or relative to expression of other specific wnts in the mantle zone lymphoma cells. Mantle zone lymphomas that overexpress a specific wntl 6 are treated with wntl 6 specific antibodies to inhibit proliferation of lymphoma cells that rely on expression of a downstream wnt/fzd induced gene. In some cases the mantle zone lymphoma cells are treated with radiolabeled or toxin-conjugated wntl 6 specific antibodies to inhibit cellular proliferation or induce apoptosis of the mantle zone lymphoma cells.

[0268] Numerous modifications may be made to the foregoing systems without departing from the basic teachings thereof. Although the present invention has been described in substantial detail with reference to one or more specific embodiments, those of skill in the art will recognize that changes may be made to the embodiments specifically disclosed in this application, yet these modifications and improvements are within the scope and spirit of the invention, as set forth in the claims which follow. All publications or patent documents cited in this specification are incorporated herein by reference as if each such publication or document was specifically and individually indicated to be incorporated herein by reference. [0269] Citation of the above publications or documents is not intended as an admission that any of the foregoing is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.