CA2164698C - SYNTHETIC PEPTIDE INHIBITORS OF HIV TRANSMISSION

35 claims: 13 independent, 22 dependent

1
CA 02164698 2011-09-14 The embodiments of the present invention for which an exclusive property or privilege is claimed are defined as follows :1. An isolated peptide having a formula selected from YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF SEQ ID NO: 1 (DP-178);YTNTIYTLLEESQNQQEKNEQELLELDKWASLWNWF SEQ ID NO: 3 (DP-185);YTGIIYNLLEESQNQQEKNEQELLELDKWANLWNWF SEQ ID NO: 4;or YTSLIYSLLEKSQTQQEKNEQELLELDKWASLWNWF SEQ ID NO: 5;wherein the peptide comprises an amino terminal X and a carboxy terminal Z in which: X comprises an amino group, an acetyl group, a 9fluorenylmethoxy-carbonyl group, a hydrophobic group, or a non-peptide macromolecular carrier group;and Z comprises a carboxyl group, an amido group, a hydrophobic group, or a non-peptide macromolecular carrier group.
2
The acid sequence
3
The acid sequence
4
The acid sequence
6
The peptide according to any one of claims 1-5, wherein X is an amino group and Z is a carboxyl group. 131 CA 02164698 2011-09-14
7
The peptide of any one of claims 1-5, wherein X is a carbobenzoxyl, dansyl or t-butyloxycarbonyl hydrophobic group;and Z is a t-butyloxycarbonyl hydrophobic group or an amido group.
8
The peptide of any one of claims 1- 5, wherein X is an acetyl group or a 9-fluorenylmethoxy-carbonyl group;and Z is a t-butyloxycarbonyl hydrophobic group or an amido group.
10
The peptide of any one of claims 1-5, wherein the macromolecular carrier group is a lipid-fatty acid conjugate, a polyethylene glycol, or a carbohydrate moiety.
11
The peptide according to any one of claims 1-10, wherein one bond linking adjacent amino acids is a non-peptide bond and the non-peptide bond is an imino, ester, hydrazine, semicarbazide, or azo bond.
12
The peptide according to any one wherein at least one amino acid residue is configuration. 13. use as an The peptide according to any one antiviral agent in the treatment
13
14. Use of the peptide of any one of the manufacture of a medicament for use as in the treatment of HIV infection. of claims 1-11, in a D-isomer of claims 1-12, for of HIV infection. claims 1-12, for an antiviral agent 15. treatment The use according to claim 13 or comprises inhibiting the virus, 14, wherein the in the presence of a 132 CA 02164698 2011-09-14 cell, with an effective concentration of the peptide for a sufficient period so that HIV transmission to the cell is inhibited.
14
16. A pharmaceutical composition, comprising the peptide of any one of claims 1-12, and a pharmaceutically acceptable carrier.
33
35. A process for preparing a peptide having the following formula:X-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z (SEQ ID NO:1), wherein the peptide amino acid residues are presented by the single-letter code, further wherein: X is an acetyl group;and Z is an amido group comprising: i) synthesizing the peptide;and ii) isolating the peptide.
34
36. The process of any one of claims 23-35, further comprising formulating said peptide into a pharmaceutical composition comprising a pharmaceutically acceptable carrier.

Independent claims14

1,221 paragraphs in 302 sections, as filed

WO 94/28920

PCT/US94/05739

SYNTHETIC PEPTIDE INHIBITORS OF HIV TRANSMISSION

1. INTRODUCTION

The present invention relates to DP-178 (SEQ ID:1), a peptide corresponding to amino acids 638 to 673 of the HIV-Ijaj transmembrane protein (TM) gp41, and portions, analogs, and homologs of DP-178 (SEQ ID:1), all of which exhibit anti-viral activity. Such anti-viral activity includes, but is not limited to, the inhibition of HIV transmission to uninfected CD-4+ cells. Further, the invention relates to the use of DP-178 (SEQ ID:1) and DP-178 fragments and/or analogs or homologs as inhibitors of human and non-human retroviral, especially HIV, transmission to uninfected cells. Still further, the invention relates to the use of DP-178 as a HIV subtype-specific diagnostic.

The present invention also relates to antiviral peptides analogous to DP-107, a peptide corresponding to amino acids 558 to 595 of the HIV-1^, transmembrane protein (TM) gp41, that are present in other enveloped viruses. The present invention further relates to methods for identifying antiviral compounds that disrupt the interaction between DP-178 and DP-107, and/or between DP-107-like and DP-178-like peptides. The invention is demonstrated by way of a working example wherein DP-178 (SEQ ID:1), and a peptide whose sequence is homologous to DP-178 are each shown to be potent, non-cytotoxic inhibitors of HIV-l transfer to uninfected CD-4+ cells. The invention is further demonstrated by working examples wherein peptides having antiviral and/or structural similarity to DP107 and DP-178 are identified.

WO 94/28920

PCT/US94/05739

2. BACKGROUND OF THE INVENTION

2.1. THE HUMAN IMMUNODEFICIENCY VIRUS

The human immunodeficiency virus (HIV) has been implicated as the primary cause of the slowly degenerative immune system disease termed acquired immune deficiency syndrome (AIDS) (Barre-Sinoussi, F. et al.. 1983, Science 220:868-870: Gallo, R. et al.. 1984, Science 224:500-503). there are at least two distinct types of HIV: HIV-1 (Barre-Sinoussi, F. et al.. 1983, Science 220:868-870: Gallo R. et al.. 1984, Science 224:500-503) and HIV-2 (Clavel, F. et al.. 1986, Science 233:343-346: Guyader, M. et al.. 1987, Nature 326:662-669). Further, a large amount of genetic heterogeneity exists within populations of each of these types. Infection of human CD-4+ Tlymphocytes with an HIV virus leads to depletion of the cell type and eventually to opportunistic infections, neurological dysfunctions, neoplastic growth, and ultimately death.

HIV is a member of the lentivirus family of retroviruses (Teich, N. et al.. 1984, RNA Tumor Viruses, Weiss, R. et al.. eds., CSH-Press, pp. 949956). Retroviruses are small enveloped viruses that contain a diploid, single-stranded RNA genome, and replicate via a DNA intermediate produced by a virally-encoded reverse transcriptase, an RNAdependent DNA polymerase (Varmus, H., 1988, Science 240:1427-1439). Other retroviruses include, for example, oncogenic viruses such as human T-cell leukemia viruses (HTLV-I,-II,-III), and feline leukemia virus.

The HIV viral particle consists of a viral core, composed of capsid proteins, that contains the viral RNA genome and those enzymes required for early replicative events. Myristylated Gag protein forms an

WO 94/28920

PCT/US94/05739 outer viral shell around the viral core, which is, in turn, surrounded by a lipid membrane envelope derived from the infected cell membrane. The HIV envelope surface glycoproteins are synthesized as a single 160 Kd precursor protein which is cleaved by a cellular protease during viral budding into two glycoproteins, gp41 and gpl20. gp41 is a transmembrane protein and gpl20 is an extracellular protein which remains noncovalently associated with gp41, possibly in a trimeric or multimeric form (Hammarskjold, M. and Rekosh, D., 1989, Biochem. Biophys. Acta 989:269-280)♦

HIV is targeted to CD-4+ cells because the CD-4 cell surface protein acts as the cellular receptor for the HIV-1 virus (Dalgleish, A. et al.. 1984, Nature 312:763-767: Klatzmann et al. . 1984, Nature 312:767768; Maddon et al.. 1986, Cell 47:333-348). Viral entry into cells is dependent upon gpl20 binding the cellular CD-4+ receptor molecules (McDougal, J.S. et al.. 1986, Science 231:382-385; Maddon, P.J. et al.. 1986, Cell 47:333-348) and thus explains HIV’s tropism for CD-4+ cells, while gp41 anchors the envelope glycoprotein complex in the viral membrane.

2.2. HIV TREATMENT

HIV infection is pandemic and HIV associated diseases represent a major world health problem. Although considerable effort is being put into the successful design of effective therapeutics, currently no curative anti-retroviral drugs against AIDS exist. In attempts to develop such drugs, several stages of the HIV life cycle have been considered as targets for therapeutic intervention (Mitsuya, H. et al.. 1991, FASEB J. 5:2369-2381). For example, virally encoded reverse transcriptase has been one focus of drug development. A number of reverse-transcriptase3

WO 94/28920

PCT/US94/05739 targeted drugs, including 2',3'-dideoxynucleoside analogs such as AZT, ddl, ddC, and d4T have been developed which have been shown to been active against HIV (Mitsuya, H. et al.. 1991, Science 249:1533-1544). While beneficial, these nucleoside analogs are not 5 curative, probably due to the rapid appearance of drug resistant HIV mutants (Lander, B. et al.. 1989,

Science 243:1731-1734). In addition, the drugs often exhibit toxic side effects such as bone marrow suppression, vomiting, and liver function 10 abnormalities.

Attempts are also being made to develop drugs which can inhibit viral entry into the cell, the earliest stage of HIV infection. Here, the focus has thus far been on CD4, the cell surface receptor for 15 HIV. Recombinant soluble CD4, for example, has been shown to inhibit infection of CD-4+ T-cells by some HIV-1 strains (Smith, D.H. et al.. 1987, Science 238:1704-1707)♦ Certain primary HIV-l isolates, however, are relatively less sensitive to inhibition by recombinant CD-4 (Daar, E. et al.. 1990, Proc.

Natl. Acad. Sci. USA 87:6574-6579). In addition, recombinant soluble CD-4 clinical trials have produced inconclusive results (Schooley, R. et al.. 1990, Ann. Int. Med. 112:247-253 : Kahn, J.O. et al.. 1990, Ann.

25 Int. Med. 112:254-261; Yarchoan, R. et al.. 1989,

Proc. Vth Int. Conf, on AIDS, p. 564, MCP 137).

The late stages of HIV replication, which involve crucial virus-specific secondary processing of certain viral proteins, have also been suggested as possible 30 anti-HIV drug targets. Late stage processing is dependent on the activity of a viral protease, and drugs are being developed which inhibit this protease (Erickson, J., 1990, Science 249:527-533). The

WO 94/28920

216463S

PCT/US94/05739 clinical outcome of these candidate drugs is still in question.

Attention is also being given to the development of vaccines for the treatment of HIV infection. The HIV-1 envelope proteins (gpl60, gpl20, gp41) have been * shown to be the major antigens for anti-HIV antibodies present in AIDS patients (Barin, et al.. 1985, Science 228:1094—1096). Thus far, therefore, these proteins seem to be the most promising candidates to act as antigens for anti-HIV vaccine development. To this 0 end, several groups have begun to use various portions of gpl60, gpl20, and/or gp41 as immunogenic targets for the host immune system. See for example, Ivanoff, L. et al.. U.S. Pat. No. 5,141,867; Saith, G. et al.. WO 92/22,654; Shafferman, A., WO 91/09,872; Formoso, 5 C. et al.. WO 90/07,119. Clinical results concerning these candidate vaccines, however, still remain far in the future.

Thus, although a great deal of effort is being directed to the design and testing of anti-retroviral »o drugs, a truly effective, non-toxic treatment is still needed.

3. SUMMARY OF THE INVENTION The present invention relates to DP-178 (SEQ ID:1), a 36-amino acid synthetic peptide corresponding to amino acids 638 to 673 of the transmembrane protein (TM) gp41 from the HIV-1 isolate LAI, which exhibits potent anti-HIV-1 activity. As evidenced by the example presented below, in Section 6, the DP-178 (SEQ ID:1) anti-viral activity is so high that, on a weight basis, no other known anti-HIV agent is effective at concentrations as low as those at which DP-178 (SEQ ID:1) exhibits its inhibitory effects. The invention further relates to those portions, analogs, and

WO 94/28920

PCT/US94/05739 homologs of DP-178 which also show such antiviral activity. The antiviral activity of such DP-178 portions, analogs, and homologs, includes, but is not limited to the inhibition of HIV transmission to uninfected CD-4+ cells. The invention relates to the use of DP-178 (SEQ ID:1) and DP-178 fragments and/or analogs or homologs. Such uses may include, but are not limited to, the use of the peptides as inhibitors of human and non-human retroviral, especially HIV, transmission to uninfected cells, and as type and/or subtype-specific diagnostic tools.

An embodiment of the invention is demonstrated below wherein an extremely low concentration of DP-178 (SEQ ID:1), and very low concentrations of a DP-178 homolog (SEQ ID:3) are shown to be potent inhibitors of HIV-l mediated CD-4+ cell-cell fusion (i.e.. syncytial formation) and infection of CD-4+ cells by cell-free virus. Further, it is shown that DP-178 (SEQ ID:1) is not toxic to cells, even at concentrations 3 logs higher than the inhibitory DP-178 (SEQ ID:1) concentration.

The invention also relates to analogous DP178 peptides in other enveloped viruses that demonstrate similar antiviral properties.

The invention further relates to peptides analogous to DP-107, a peptide corresponding to amino acids 558-595 of the HIV-l^ transmembrane protein (TM) of gp41, that are present in other enveloped viruses, and demonstrate antiviral properties. The present invention is based, in part, on the surprising discovery that the DP-107 and DP-108 domains of the gp41 protein non-covalently complex with each other, and that their interaction is necessary for the normal activity of the virus. The invention, therefore, further relates to methods for identifying antiviral

WO 94/28920

PCT/US94/05739 compounds that disrupt the interaction between DP-107 and DP-178, and/or between DP-107-like and DP-178-like peptides.

Embodiments of the invention are demonstrated, below, wherein peptides having structural and/or 5 similarity to DP-107 and DP-178 are identified.

3.1. DEFINITIONS

Peptides are defined herein as organic compounds comprising two or more amino acids covalently joined 10 by peptide bonds. Peptides may be referred to with respect to the number of constituent amino acids, i.e.. a dipeptide contains two amino acid residues, a tripeptide contains three, etc. Peptides containing ten or fewer amino acids may be referred to as 15 oligopeptides, while those with more than ten amino acid residues are polypeptides.

Peptide sequences defined herein are represented by one-letter symbols for amino acid residues as follows:

A (alanine)

R (arginine)

N (asparagine)

D (aspartic acid)

C (cysteine)

Q (glutamine)

E (glutamic acid)

G (glycine)

H (histidine)

I (isoleucine)

L (leucine)

K (lysine)

M (methionine)

F (phenylalanine)

P (proline)

WO 94/28920

PCT/US94/05739

S (serine)

T (threonine) W (tryptophan)

Y (tyrosine)

V (valine)

4. BRIEF DESCRIPTION OF THE FIGURES

FIG. 1. Amino acid seguence of DP-178 (SEQ ID:1) derived from HIV^; DP-178 homologs derived from HIV-1SF2 (DP-185; SEQ ID:3), HIV-Irj, (SEQ ID:4), and HIV-Imn (SEQ ID:5); DP-178 homologs derived from amino acid seguences of two prototypic HIV-2 isolates, namely, HIV-2rod (SEQ ID:6) and HIV-2nihz (SEQ ID:7); control peptides: DP-180 (SEQ ID:2), a peptide incorporating the amino acid residues of DP-178 in a scrambled seguence; DP-118 (SEQ ID:10) unrelated to DP-178, which inhibits HIV-1 cell free virus infection; DP-125 (SEQ ID:8), unrelated to DP-178, was also previously shown to inhibit HIV-1 cell free virus infection (Wild et al.. 1992, Proc. Natl. Acad. Sci USA 89:10,537-10,541); DP-116 (SEQ ID:9), unrelated to DP-178 had previously been shown to be negative for inhibition of HIV-1 infection using the cell-free virus infection assay (Wild, et al.. 1992, Proc. Natl. Acad. Sci USA 89:10,537-10,541). Throughout the figures, the one letter amino acid code is used.

FIG. 2. Inhibition of HIV-1 cell-free virus infection by synthetic peptides. IC50 refers to the concentration of peptide that inhibits RT production from infected cells by 50% compared to the untreated control. Control: the level of RT produced by untreated cell cultures infected with the same level of virus as treated cultures.

FIG. 3. Inhibition Of HIV-1 and HIV-2 cell-free virus infection by the synthetic peptide DP-178 (SEQ

WO 94/28920

PCT/US94/05739

ID:1). IC50: concentration of peptide that inhibits

RT production by 50% compared to the untreated control. Control: Level of RT produced by untreated cell cultures infected with the same level of virus as treated cultures.

FIG. 4A. Fusion Inhibition Assay. DP-178 (SEQ ID:1) inhibition of HIV-1 prototypic isolate-mediated syncytia formation. Data represents the number of virus-induced syncytia per cell.

FIG. 4B. Fusion Inhibition Assay. DP-180 (SEQ ID:2): scrambled control peptide. DP-185 (SEQ ID:3):

DP-178 homolog derived from HIV-1SF2 isolate. Control: number of syncytia produced in the absence of peptide.

FIG. 5. Fusion inhibition assay: HIV-1 vs. HIV-2. Data represents the number of virus-induced syncytia per well. ND: not done.

FIG. 6. Cytotoxicity study of DP-178 (SEQ ID:1) and DP-116 (SEQ ID:9) on CEM cells. Cell proliferation data is shown.

FIG. 7. Schematic representation of HIV-gp41 and maltose binding protein (MBP)-gp41 fusion proteins. DP107 and DP178 are synthetic peptides based on the two putative helices of gp41. The letter P in the DP107 boxes denotes an lie to Pro mutation at amino acid number 578. Amino acid residues are numbered according to Meyers et al., Human Retroviruses and AIDS, 1991, Theoret. Biol, and Biophys. Group, Los Alamos Natl. Lab., Los Alamos, NM.

FIG. 8. A point mutation alters the conformation and anti-HIV activity of M41.

FIG. 9. Abrogation of DP178 anti-HIV activity. Cell fusion assays were carried out in the presence of 10 nM DP178 and various concentrations of Μ41Δ178 or Μ41ΡΔ178.

WO 94/28920

PCT/US94/05739

FIG. 10. Binding of DP178 to leucine zipper of gp41 analyzed by ELISA.

FIG. 11A-B. Models for a structural transition in the HIV-1 TM protein. Two models are proposed which indicate a structural transition from a native oligomer to a fusogenic state following a trigger event (possibly gpl20 binding to CD4). Common features of both models include (1) the native state is held together by noncovalent protein-protein interactions to form the heterodimer of gpl20/41 and other interactions, principally though gp41 interactive sites, to form homo-oligomers on the virus surface of the gpl20/41 complexes; (2) shielding of the hydrophobic fusogenic peptide at the N-terminus (F) in the native state; and (3) the leucine zipper domain (DP107) exists as a homo-oligomer coiled coil only in the fusogenic state. The major differences in the two models include the structural state (native or fusogenic) in which the DP107 and DP178 domains are complexed to each other. In the first model (A; FIG. 11A) this interaction occurs in the native state and in B during the fusogenic state. When triggered, the fusion complex in the model depicted in (A) is generated through formation of coiled-coil interactions in homologous DP107 domains resulting in an extended a-helix. This conformational change positions the fusion peptide for interaction with the cell membrane. In the second model (B; FIG. 11B), the fusogenic complex is stabilized by the association of the DP178 domain with the DP107 coiled-coil.

FIG. 12. Motif design using heptad repeat positioning of amino acids of known coiled-coils.

FIG. 13. Motif design using proposed heptad repeat positioning of amino acids of DP-107 and DP178.

WO 94/28920

PCT/US94/05739

FIG. 14. Hybrid motif design crossing GCN4 and DP-107.

FIG. 15. Hybrid motif design crossing GCN4 and DP-178.

FIG. 16. Hybrid motif design 107x178x4, crossing DP-107 and DP-178. This motif was found to be the most consistent at identifying relevant DP-107like and DP-178-like peptide regions.

FIG. 17. Hybrid motif design ALLMOTI5, crossing GCN4, DP-107, and DP-178.

FIG. 18. Hybrid motif design crossing GCN4, DP-107, DP-178, c-Fos c-Jun, c-Myc, and Flu Loop 36.

FIG. 19. Motifs designed to identify Nterminal proline-leucine zipper motifs.

FIG. 20. Search results for HIV-1 (BRU isolate) envelope protein gp41. Sequence search motif designations: Spades (4): 107x178x4; Hearts (V) ALLMOTI5; Clubs (*): PLZIP; Diamonds (♦):

transmembrane region (the putative transmembrane domains were identified using a PC/Gene program designed to search for such peptide regions).

Asterisk (*) : Lupas method. The amino acid sequences identified by each motif are bracketed by the respective characters. Representative sequences chosen based on all searches are underlined and in bold. DP-107 and DP-178 sequences are marked, and additionally double-underlined and italicized.

FIG. 21. Search results for human respiratory syncytial virus (RSV) strain A2 fusion glycoprotein Fl. Sequence search motif designations are as in FIG. 20.

FIG. 22. Search results for simian immunodeficiency virus (SIV) envelope protein gp41 (AGM3 isolate). Sequence search motif designations are as in FIG. 20.

WO 94/28920

PCT/US94/05739

FIG. 23. Search results for canine distemper virus (strain Onderstepoort) fusion glycoprotein 1. Sequence search motif designations are as in FIG. 20.

FIG. 24. Search results for newcastle 5 disease virus (strain Australia-Victoria/32) fusion glycoprotein Fl. Sequence search motif designations are as in FIG. 20.

FIG. 25. Search results for human parainfluenza 3 virus (strain NIH 47885) fusion 10 glycoprotein Fl. Sequence search motif designations are as in FIG. 20.

FIG. 26. Search results for influenza A virus (strain A/AICHI/2/68) hemagglutinin precursor HA2. Sequence search designations are as in FIG. 20.

15 FIG. 27. Coiled-coil structural similarity and anti-RSV antiviral activity of 35-mer peptides synthesized utilizing the sequence of a 48-amino acid RSV F2 peptide which spans sequences identified utilizing the computer-assisted searches described . ...

herein. For the exact location and motifs utilized, see FIG. 21. +” symbols are relative indicators of either structural similarity or antiviral activity, with a greater number of + symbols indicating a higher relative similarity or antiviral activity.

FIG. 28. Coiled-coil structural similarity and anti-RSV antiviral activity of 35-mer peptides synthesized utilizing the sequence of a 53-amino acid RSV Fl peptide which spans sequences identified utilizing the computer-assisted searches described herein. See FIG. 21 for the exact location and motifs used. + symbols are as described for FIG. 27.

FIG. 29. Coiled-coil structural similarity and anti-human parainfluenza 3 virus (HPF3) antiviral activity of 35-mer peptides synthesized utilizing the

WO 94/28920

PCT/US94/05739

2164598 sequence of a 56-amino acid HPF3 peptide which spans sequences identified utilizing computer-assisted searches described herein. For the exact location and motifs utilized, see FIG. 25. ·'+ symbols are as described in FIG. 27.

FIG. 30. Coiled-coil structural similarity and anti-HPF3 antiviral activity of 35-mer peptides synthesized utilizing the sequence of a 70-amino acid HPF3 peptide which spans sequences identified utilizing the computer-assisted searches described herein. For the exact location and motifs utilized, see FIG. 25. ·'+ symbols are as described in FIG. 27.

5. DETAILED DESCRIPTION OF THE INVENTION Described herein are peptides that exhibit potent antiviral activity. These peptides include DP-178 (SEQ ID:1), a gp41-derived 36 amino acid peptide, fragments and/or analogs of DP-178, and peptides which are homologous to DP-178. In addition, these peptides may include peptides exhibiting anti-viral activity which are analogous to DP-107, a 38 amino acid peptide corresponding to residues 558 to 595 of the HIV-1^, transmembrane (TM) gp41 protein, and which are present in other enveloped viral proteins. Also described here are assays for testing the antiviral activities of such peptides. The present invention is based, in part, of the surprising discovery that the DP-107 and DP-178 domains of the gp41 protein complex with each other via non-covalent protein-protein interactions which are necessary for normal activity of the virus. As such, methods are described for the identification of antiviral compounds that disrupt the interaction between DP-107 and DP-178 peptides, and between DP107-like and DP-178-like peptides. Finally, the use of the peptides of the invention as inhibitors of non13

WO 94/28920

PCT/US94/05739 human and human viral and retroviral, especially HIV, transmission are detailed, as is the use of the peptides as diagnostic indicators of the presence of specific, viruses, especially retroviruses.

While not limited to any theory of operation, the 5 following model is proposed to explain the potent anti-HIV activity of DP178, based, in part, on the experiments described in the working examples, infra. In the viral protein, gp41, DP178 corresponds to a putative α-helix region located in the C-terminal end 10 of the gp41 ectodomain, and appears to associate with a distal site on gp41 whose interactive structure is influenced by the leucine zipper motif, a coiled-coil structure, referred to as DP107. The association of these two domains may reflect a molecular linkage or molecular clasp intimately involved in the fusion process. It is of interest that mutations in the C-terminal a-helix motif of gp41 (i.e.. the D178 domain) tend to enhance the fusion ability of gp41, whereas mutations in the leucine zipper region (i.e..

the DP107 domain) decrease or abolish the fusion ability of the viral protein. It may be that the leucine zipper motif is involved in membrane fusion while the C-terminal α-helix motif serves as a molecular safety to regulate the availability of the leucine zipper during virus-induced membrane fusion.

On the basis of the foregoing, two models are proposed of gp41-mediated membrane fusion which are schematically shown in FIG. 11A-B. The reason for proposing two models is that the temporal nature of the interaction between the regions defined by DP107 and DP178 cannot, as yet, be pinpointed. Each model envisions two conformations for gp41 - one in a native state as it might be found on a resting virion. The other in a fusogenic state to reflect

CA 02164698 2004-07-30 conformational changes triggered following binding of gpl20 to CD4 and just prior to fusion with the target cell membrane. The strong binding affinity between gpl20 and CD4 may actually represent the trigger for the fusion process obviating the need for a pH change such as occurs for viruses that fuse within intracellular vesicles. The two major features of both models are: (1) the leucine zipper sequences (DP107) in each chain of oligomeric envelope are held apart in the native state and are only allowed access to one another in the fusogenic state so as to form the extremely stable coild-coils, and (2) association of the DP178 and DP107 sites as they exist in gp41 occur either in the native or fusogenic state. FIG. 11A depicts DP178/DP107 interaction in the native state as a molecular class. On the other hand, if one assumes that the most stable form of the envelope occurs in the fusogenic state, the model in FIG. 11B can be considered.

When synthesized as peptides, both DP107 and DP178 are potent inhibitors of HIV infection and fusion, probably by virtue of their ability to form complexes with viral gp41 and interfere with its fusogenic process; e.g.. during the structural transition of the viral protein from the native structure to the fusogenic state, the DP178 and DP107 peptides may gain access to their respective binding sites on the viral gp41, and exert a disruptive influence. DP107 peptides which demonstrate anti-HIV activity are described in Applicants' U.S. Patent No. 5,656,480 issued August 12, 1997.

As shown in the working examples, infra. a truncated recombinant gp41 protein corresponding the

WO 94/28920

PCT/US94/05739

2164608 ectodomain of gp41 containing both DP107 and DP178 domains (excluding the fusion peptide, transmembrane region and cytoplasmic domain of gp41) did not inhibit HIV-1 induced fusion. However, when a single mutation was introduced to disrupt the coiled-coil structure of 5 the DP107 domain — a mutation which results in a total loss of biological activity of DP107 peptides — the inactive recombinant protein was transformed to an active inhibitor of HIV-1 induced fusion. This transformation may result from liberation of the potent DP178 domain from a molecular clasp with the leucine zipper, DP107 domain.

For clarity of discussion, the invention will be described for DP178 peptide inhibitors of HIV.

However, the principles may be analogously applied to 5 other fusogenic enveloped viruses, including but not limited to those viruses containing the peptides listed in Tables V through X, below.

5.1. DP-178 AND DP-178-LIKE PEPTIDES

The peptide DP-178 (SEQ ID:1) of the invention corresponds to amino acid residues 638 to 673 of the transmembrane protein gp4l from the HIV-1^, isolate, and has the 36 amino acid sequence (reading from amino to carboxy terminus):

NH2-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-COOH (SEQ ID:1)

In addition to the full-length DP-178 (SEQ ID:1) 36-mer, the peptides of the invention may include truncations of the DP-178 (SEQ ID:1) peptide which exhibit antiviral activity. Such truncated DP-178 (SEQ ID:1) peptides may comprise peptides of between 3 and 36 amino acid residues (i.e.. peptides ranging in size from a tripeptide to a 36-mer polypeptide), and

WO 94/28920

PCT/US94/05739 may include but are not limited to those listed in Tables I and II, below. Peptide sequences in these tables are listed from amino (left) to carboxy (right) terminus. MX may represent an amino group (-NH2) and *'Z may represent a carboxyl (-COOH) group. Alternatively, as described below, X and/or Z may represent a hydrophobic group, an acetyl group, a FMOC group, an amido group, or a covalently attached macromolecule.

WO 94/28920

PCT/US94/05739

TABLE I

DP-178 (SEP IDil) CARBOXY TRUNCATIONS

X-YTS-Z

X-YTSL-Z

X-YTSLI-Z

X-YTSLIH-Z

X-YTSLIHS-Z X-YTSLIHSL-Z X-YTSLIHSLI-Z X-YTSLIHSLIE-Z X-YTSLIHSLIEE-Z X-YTSLIHSLIEES-Z X-YTSLIHSLIEESQ-Z .0 X-YTSLIHSLIEESQN-Z X-YTSLIHSLIEESQNQ-Z X-YTSLIHSLIEESQNQQ-Z X-YTSLIHSLIEESQNQQE-Z X-YTSLIHSLIEESQNQQEK-Z X-YTSLIHSLIEESQNQQEKN-Z X-YTSLIHSLIEESQNQQEKNE-Z X-YTSLIHSLIEESQNQQEKNEQ-Z

X-YTSLIHSLIEESQNQQEKNEQE-Z X-YTSLIHSLIEESQNQQEKNEQEL-Z X-YTSLIHSLIEESQNQQEKNEQELL-Z X-YTSLIHSLIEESQNQQEKNEQELLE-Z X-YTSLIHSLIEESQNQQEKNEQELLEL-Z X-YTSLIHSLIEESQNQQEKNEQELLELD-Z X-YTSLIHSLIEESQNQQEKNEQELLELDK-Z 0 X-YTSLIHSLIEESQNQQEKNEQELLELDKW-Z X-YTSLIHSLIEESQNQQEKNEQELLELDKWA-Z X-YTSLIHSLIEESQNQQEKNEQELLELDKWAS-Z X-YTSLIHSLIEESQNQQEKNEQELLELDKWASL-Z X-YTSLIHSLIEESQNQQEKNEQELLELDKWASLW-Z X-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWN-Z X-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNW-Z X-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z _

The one letter amino acid code is used.

Additionally,

X” may represent an amino group, a hydrophobic group, including but not limited to carbobenzoxyl, dansyl, or 3_ T-butyloxycarbonyl; an acetyl group; a 9fluorenylmethoxy-carbonyl (FMOC) group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

•’Z may represent a carboxyl group; an amido group; a T-butyloxycarbonyl group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

WO 94/28920

PCT/US94/05739

2164S58,

TABLE II

DP-178 (SEP ID:l) AMINO TRUNCATIONS tSJ N tXJ N N

X-NWFX-WNWFX-LWNWF—

X-SLWNWF5 X-ASLWNWFX-WASLWNWF-Z X-KWASLWNWF-Z X-DKWASLWNWF-Z X-LDKWASLWNWF-Z X-ELDKWASLWNWF-Z X-LELDKWASLWNWF-Z lft X-LLELDKWASLWNWF-Z

X-ELLELDKWASLWNWF-Z

X-QELLELDKWASLWNWF-Z X-EQELLELDKWASLWNWF-Z

X-NEQELLELDKWASLWNWF-Z X-KNEQELLELDKWASLWNWF-Z

X-EKNEQELLELDKWASLWNWF-Z X-QEKNEQELLELDKWASLWNWF-Z

X-QQEKNEQELLELDKWASLWNWF-Z

X-NQQEKNEQELLELDKWASLWNWF-Z

X-QNQQEKNEQELLELDKWASLWNWF-Z X-SQNQQEKNEQELLELDKWASLWNWF-Z

X-ESQNQQEKNEQELLELDKWASLWNWF-Z X-EESQNQQEKNEQELLELDKWASLWNWF-Z

X-IEESQNQQEKNEQELLELDKWASLWNWF-Z _0 X-LIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-SLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-HSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-IHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-LIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-SLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-TSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z _

The one letter amino acid code is used.

Additionally,

X may represent an amino group, a hydrophobic group, including but not limited to carbobenzoxyl, dansyl, or 3Q T-butyloxycarbonyl; an acetyl group; a 9fluorenylmethoxy-carbonyl group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

Z may represent a carboxyl group; an amido group; a T-butyloxycarbonyl group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

WO 94/28920

PCT/US94/05739

The antiviral peptides of the invention also include analogs of DP-178 and/or DP-178 truncations which may include, but are not limited to, peptides comprising the DP-178 (SEQ ID:1) sequence, or DP-178 truncated sequence, containing one or more amino acid substitutions, insertions and/or deletions. Analogs of DP-178 homologs, described below, are also within the scope of the invention. The DP-178 analogs of the invention exhibit antiviral activity, and may, further, possess additional advantageous features, such as, for example, increased bioavailability, and/or stability, or reduced host immune recognition.

HIV-1 and HIV-2 envelope proteins are structurally distinct, but there exists a striking amino acid conservation within the DP-178corresponding regions of HIV-1 and HIV-2. The amino acid conservation is of a periodic nature, suggesting some conservation of structure and/or function. Therefore, one possible class of amino acid substitutions would include those amino acid changes which are predicted to stabilize the structure of the DP-178 peptides of the invention.

Amino acid substitutions may be of a conserved or non-conserved nature. Conserved amino acid substitutions consist of replacing one or more amino acids of the DP-178 (SEQ ID:1) peptide sequence with amino acids of similar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to aspartic acid (D) amino acid substitution. When only conserved substitutions are made, the resulting peptide is functionally equivalent to DP-178 (SEQ ID:1) or the DP-178 peptide from which it is derived. Non-conserved substitutions consist of replacing one or more amino acids of the DP-178 (SEQ ID:1) peptide sequence with amino acids possessing dissimilar charge, size, and/or hydrophobicity

WO 94/28920

PCT/US94/05739 characteristics, such as, for example, a glutamic acid (E) to valine (V) substitution.

Amino acid insertions may consist of single amino acid residues or stretches of residues ranging from 2 to 15 amino acids in length. One or more insertions 5 may be introduced into DP-178 (SEQ ID:1), DP-178 fragments, analogs and/or DP-178 homologs (described below).

Deletions of DP-178 (SEQ ID:1), DP-178 fragments, analogs, and/or DP-178 homologs (described below) are 10 also within the scope of the invention. Such deletions consist of the removal of one or more amino acids from the DP-178 or DP-178-like peptide sequence, with the lower limit length of the resulting peptide sequence being 4 to 6 amino acids. Such deletions may 15 involve a single contiguous or greater than one discrete portion of the peptide sequences.

The peptides of the invention may further include homologs of DP-178 (SEQ ID:1) and/or DP-178 truncations which exhibit antiviral activity. Such

DP-178 homologs are peptides whose amino acid sequences are comprised of the amino acid sequences of peptide regions of other (i.e.. other than HIV-1^,) viruses that correspond to the gp41 peptide region from which DP-178 (SEQ ID:1) was derived. Such viruses may include, but are not limited to, other HIV-1 isolates and HIV-2 isolates. DP-178 homologs derived from the corresponding gp41 peptide region of other (i.e., non HIV-l^,) HIV-1 isolates may include, for example, peptide sequences as shown below.

NHj-YTNTIYTLLEESONOQEKNEOELLELDKWASLWNWF-COOH (DP-185; SEQ ID:3);

NH2-YTGIIYNLLEESQNQQEKNEQELLELDKWANLWNWF-COOH (SEQ ID:4);

WO 94/28920

PCT/US94/05739

NH2-YTSLIYSLLEKSQIQQEKNEQELLELDKWASLWNWF-COOH (SEQ ID:5).

SEQ ID:3 (DP-185), SEQ ID:4, and SEQ ID:5 are derived from HIV-1SF2, HIV-Irf, and HIV-Imn isolates, respectively. Underlined amino acid residues refer to those residues that differ from the corresponding position in the DP-178 (SEQ ID:1) peptide. One such DP-178 homolog, DP-185 (SEQ ID:3), is described in the Working Example presented in Section 6, below, where it is demonstrated that DP-185 (SEQ ID:3) exhibits antiviral activity. The DP-178 homologs of the invention may also include truncations, amino acid substitutions, insertions, and/or deletions, as described above.

In addition, striking similarities, as shown in FIG. 1, exist within the regions of HIV-1 and HIV-2 isolates which correspond to the DP-178 sequence. A DP-178 homolog derived from the HIV-isolate has the 36 amino acid sequence (reading from amino to carboxy terminus):

NH2-LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-COOH (SEQ ID:7)

Table III and Table IV show some possible truncations of the HIV-2nihz DP-178 homolog, which may comprise peptides of between 3 and 36 amino acid residues (i.e.. peptides ranging in size from a tripeptide to a 36-mer polypeptide). Peptide sequences in these tables are listed from amino (left) to carboxy (right) terminus. ”X may represent an amino group (-NH2) and Z may represent a carboxyl (-COOH) group. Alternatively, as described below, X and/or ”Z may represent a hydrophobic group, an acetyl group, a FMOC group, an amido group, or a covalently attached macromolecule, as described below.

WO 94/28920

2164638

PCT/US94/05739

TABLE III

Ηΐν-Σ,,υβ DP-178 homolog carboxy truncations.

X-LEA-Z

X-LEAN-Z

X-LEANI-Z

X-LEANIS-Z

X-LEANISQ-Z X-LEANISQS-Z X-LEANISQSL-Z X-LEANISQSLE-Z X-LEANISQSLEQ-Z X-LEANISQSLEQA-Z X-LEANISQSLEQAQ-Z ,0 X-LEANISQSLEQAQI-Z X-LEANISQSLEQAQIQ-Z X-LEANISQSLEQAQIQQ-Z X-LEANISQSLEQAQIQQE-Z X-LEANISQSLEQAQIQQEK-Z X-LEANISQSLEQAQIQQEKN-Z X-LEANISQSLEQAQIQQEKNM-Z X-LEANISQSLEQAQIQQEKNMY-Z

X-LEANISQSLEQAQIQQEKNMYE-Z X-LEANISQSLEQAQIQQEKNMYEL-Z X-LEANISQSLEQAQIQQEKNMYELQ-Z X-LEANISQSLEQAQIQQEKNMYELQK-Z X-LEANISQSLEQAQIQQEKNMYELQKL-Z X-LEANISQSLEQAQIQQEKNMYELQKLN-Z X-LEANISQSLEQAQIQQEKNMYELQKLNS-Z 2Q X-LEANISQSLEQAQIQQEKNMYELQKLNSW-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWD-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWDV-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWDVF-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWDVFT-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTN-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTNW-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z _

The one letter amino acid code is used.

Additionally, ”X may represent an amino group, a hydrophobic group, including but not limited to carbobenzoxyl, dansyl, or 30 T-butyloxycarbonyl; an acetyl group; a 9fluorenylmethoxy-carbonyl (FMOC) group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

Z may represent a carboxyl group; an amido group; a T-butyloxycarbonyl group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

WO 94/28920

2ΐδ4β93

PCT/US94/05739 (SI N N tSl

TABLE IV

HIV-2NJHZ DP-178 homolog amino truncations.

X-NWLX-TNWLX-FTNWLX-VFTNWL5 X-DVFTNWL-Z

X-WDVFTNWL-Z

X-SWDVFTNWL-Z

X-NSWDVFTNWL-Z

X-LNSWDVFTNWL-Z X-KLNSWDVFTNWL-Z

X-QKLNSWDVFTNWL-Z 10 X-LQKLNSWDVFTNWL-Z

X-ELQKLNSWDVFTNWL-Z

X-YELQKLNSWDVFTNWL-Z X-MYELQKLNSWDVFTNWL-Z

X-NMYELQKLNSWDVFTNWL-Z X-KNMYELQKLNSWDVFTNWL-Z

X-EKNMYELQKLNSWDVFTNWL-Z

X-QEKNMYELQKLNSWDVFTNWL-Z

X-QQEKNMYELQKLNSWDVFTNWL-Z

X-IQQEKNMYELQKLNSWDVFTNWL-Z

X-QIQQEKNMYELQKLNSWDVFTNWL-Z X-AQIQQEKNMYELQKLNSWDVFTNWL-Z

X-QAQIQQEKNMYELQKLNSWDVFTNWL-Z X-EQAQIQQEKNMYELQKLNSWDVFTNWL-Z

X-LEQAQIQQEKNMYELQKLN SWDVFTNWL-Z 2 Q X-SLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z

X-QSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z

X-SQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z X-ISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z

X-NISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z

X-ANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z

X-EANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z X-LEANISQSLEQAQIQQEKNMYELQKLNSWDVFTNWL-Z _

The one letter amino acid code is used.

Additionally,

X may represent an amino group, a hydrophobic group, including but not limited to carbobenzoxyl, dansyl, or 30 T-butyloxycarbonyl; an acetyl group; a 9fluorenylmethoxy-carbonyl (FMOC) group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

*'Z may represent a carboxyl group; an amido group; a T-butyloxycarbonyl group; a macromolecular carrier group including but not limited to lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

CA 02164698 2004-07-30

5.2. DP-107 and DP-178 ANALOGOUS

ANTIVIRAL £EPTIDES

Peptide sequences functionally corresponding, and thus analogous to, the DP-178 sequences of the invention, described, above, in Section 5.1 may be found in other, non-HIV-1 envelope viruses. Further, peptide sequences functionally corresponding, and thus analogous to, DP-107, an HIV-l-derived antiviral peptide, may also be found in other, non-HIV-l envelope viruses. DP-107 is a 38 amino acid peptide corresponding to residues 558 to 595 of HIV-1^ transmembrane (TM) gp41 protein, which exhibits potent anti-viral activity. DP-107 is more fully described in Applicant's U.S. Patent No. 5,656,480 issued

August 12, 1997. These DP-107-like and DP-178-like analogous peptides and present in TM proteins of envelope viruses and preferably exhibit antiviral activity, most preferably antiviral activity which is specific to the virus in which their native sequences are found.

DP-107-like and DP-178-like peptides may be identified, for example, by utilizing a computerassisted search strategy such as that described and demonstrated, below, in the Examples presented in Sections 9 through 16. The search strategy identifies regions in other viruses that are similar in predicted secondary structure to DP-107 and DP-178.

This search strategy is described fully, below, in the Example presented in Section 9. While this search strategy is based, in part, on a primary amino acid motif deduced from DP-107 and DP-178, it is not based solely on searching for primary amino acid sequence homologies, as such protein sequence homologies exist within, but not between major groups of viruses. For example, primary amino acid sequence homology is high within the TM protein of different

WO 94/28920

PCT/US94/05739 strains of HIV-1 or within the TM protein of different isolates of simian immunodeficiency virus (SIV). Primary amino acid sequence homology between HIV-1 and SIV, however, is low enough so as not to be useful.

It is not possible, therefore, to find DP-107 or DP178-like peptides within other viruses, whether structurally, or otherwise, based on primary sequence homology, alone.

Further, while it would be potentially useful to identify primary sequence arrangements of amino acids based on the physical chemical characteristics of different classes of amino acids rather than based on the specific amino acids themselves, for instance, a by concentrating on the coiled-coil nature of the peptide sequence, a computer algorithm designed by Lupas et al. to identify such coiled-coil propensities of regions within proteins (Lupas, A., et al., 1991 Science 252:1162-1164) is inadequate for identifying protein regions analogous to DP-107 or DP-178.

Specifically, analysis of HIV-1 gpl60 (containing both gpl20 and gp41) using the Lupas algorithm does not identify the coiled-coil region within DP-107. It does, however, identify a region within DP-178 beginning eight amino acids N-terminal to the start of DP-178 and ending eight amino acids from the Cterminus. The DP-107 peptide has been shown experimentally to form a stable coiled coil. A search based on the Lupas search algorithm, therefore, would not have identified the DP-107 coiled-coil region. Conversely, the Lupas algorithm identified the DP-178 region as a potential coiled-coil motif. However, the peptide DP-178 derived from this region failed to form a coiled coil in solution. A possible explanation for the inability of the Lupas search algorithm to accurately identify coiled-coil sequences within the HIV-1 TM, is that the Lupas algorithm is based on the

CA 02164698 2004-07-30 structure of coiled coils from proteins that are not structurally or functionally similar to the TM proteins of viruses, antiviral peptides (e.g. DP-107 and DP-178) of which are an object of this invention.

The computer search strategy of the invention, as demonstrated in the Examples presented below, in Sections 9 through 16, successfully identifies regions of viral TM proteins similar to DP-107 or DP-178.

This search strategy was designed to be used with a commercially-available sequence database packages, preferably PC/Gene™. A series of motifs were designed and engineered to range in stringency from very strict to very broad, as discussed in Section 9.

Among the protein sequence seach motifs which may be utilized in such a computer-assisted DP-107-like and DP-178-like antiviral peptide search are the 107x178x4 motif, the ALLMOTI5 motif, and the PLZIP series of motifs, each of which is described in the Example presented in Section 9, below, with 107x178x4 being preferred.

Coiled-coiled sequences are thought to consist of heptad amino acid repeats. For ease of description, the amino acid positions within the heptad repeats are sometimes referred to as A through G, with the first position being A, the second B, etc. The motifs used to identify DP-107-like and DP-178-like sequences herein are desined to specifically search for and identify such heptad repeats. In the descriptions of each of the motifs described, below, amino acids enclosed by brackets , i.e., [], designate the only amino acid residues that are acceptable at the given position, while amino acids enclosed by braces, i.e., {}, designate the only amino acids which are unacceptable at the given heptad position. When a set of bracketed or braced amino acids is followed by a number in parentheses i.e., (), it refers to the

WO 94/28920

PCT/US94/05739 number of subsequent amino acid positions for which the designated set of amino acids hold, e.g, a (2) means for the next two heptad amino acid positions.

The ALLMOTI5 is written as follows:

{CDGHP]-{CFP}(2)-{CDGHP}-{CFP}(3)5 {CDGHP]-{CFP}(2)-{CDGHP}-{CFP}(3){CDGHP]-{CFP}(2)-{CDGHP}-{CFP}(3){CDGHP]-{CFP}(2)-{CDGHP}-{CFP}(3){CDGHP]-{CFP}(2)-{CDGHP}-{CFP}(3)Translating this mofif, it would read: at the first (A) position of the heptad, any amino acid residue except C, D, G, H, or P is acceptable, at the next two (B,C) amino acid positions, any amino acid residue except C, F, or P is accepatble, at the fourth heptad position (D), any amino acid residue except C, D, G, H, or P is acceptable, at the next three (E, F,

G) amino acid positions, any amino acid residue except C, F, or P is acceptable. This motif is designed to search for five consecutive heptad repeats (thus the repeat of the first line five times), meaning that it searches for 35-mer sized peptides. It may also be designed to search for 28-mers, by only repeating the initial motif four times. With respect to the ALLMOTI5 motif, a 35-mer search is preferred. Those viral sequences identified via such an ALLMOTI5 motif are listed in Table V, below, at the end of this

Section. The viral sequences listed in Table V potentially exhibit antiviral activity, may be useful in the the identification of antiviral compounds, and are intended to be within the scope of the invention.

The 107x178x4 motif is written as follows:

[EFIKLNQSTVWY]-{CFMP}(2)-[EFIKLNQSTVWY]-{CFMP}(3)[EFIKLNQSTVWY]-{CFMP}(2)-[EFIKLNQSTVWY]-{CFMP}(3)[EFIKLNQSTVWY]-{CFMP}(2) -[EFIKLNQSTVWY]-{CFMP}(3) [EFIKLNQSTVWY]-{CFMP}(2) -[EFIKLNQSTVWY]-{CFMP}(3) Translating this mofif, it would read: at the first (A) position of the heptad, any amino acid residue except E, F, I, K, L, N, Q, s, T, V, W, or Y

WO 94/28920

2164693 PCT/ÜS^3’ is acceptable, at the next two (B,C) amino acid positions, any amino acid residue except C, F, M or P is accepatble, at the fourth position (D), any amino acid residue except E, F, I, K, L, N, Q, S, T, V, W, or Y is acceptable, at the next three (E, F, G) amino 5 acid positions, any amino acid residue except C, F, M or P is acceptable. This motif is designed to search for four consecutive heptad repeats (thus the repeat of the first line four times), meaning that it searches for 28-mer sized peptides. It may also be 10 designed to search for 35-mers, by repeating the initial motif five times. With respect to the 107x178x4 motif, a 28-mer search is preferred. Those viral sequences identified via such a 107x178x4 motif are listed in Table V, below, at the end of this 15 Section. The viral sequences listed in Table V potentially exhibit antiviral activity, may be useful in the the identification of antiviral compounds, and are intended to be within the scope of the invention.

The PLZIP series of motifs are as listed in FIG.

19. These motifs are designed to identify leucine zipper coiled-coil like heptads wherein at least one proline residue is present at some predefined distance N-terminal to the repeat. These PLZIP motifs find regions of proteins with similarities to HIV-1 DP-178 generally located just N-termmal to the transmembrane anchor. These motifs may be translated according to the same convention described above. Each line depicted in FIG. 19 represents a single, complete search motif. X in these motifs refers to any amino acid residue. In instances wherein a motif contains two numbers within parentheses, this refers to a variable number of amino acid residues. For example,

X (1,12)is translated to the next one to twelve amino acid residues, inclusive, may be any amino acid.

Tables VI through X, below, at the end of this

WO 94/28920

PCT/US94/05739

Section, list hits from such PLZIP motifs. The viral sequences listed in Table VI through X potentially exhibit antiviral activity, may be useful in the the identification of antiviral compounds, and are intended to be within the scope of the invention.

The Examples presented in Sections 17 and 18, below, demonstrate that respiratory syncytial virus and parainfluenza virus sequences identified via such a computer search exhibit antiviral and/or structural characteristics similar to those of DP-107 or DP-178.

The DP-107-like and DP-178-like analogous peptides may, further, contain any of the additional groups described for DP-178, above, in Section 5.1.

For example, these peptides may include any of the additional amino-terminal groups which X of Tables I through IV may represent, and may also include any of the carboxy-terminal groups which Z of Tables I through IV may represent.

Additionally, such DP-107-like and DP-178-like peptides may furthr include DP-107-like or DP-178-like peptides, such as those listed in Tables V through X, above, containing one or more amino acid substitutions, insertions, and/or deletions. Also, analogs of such DP-107-like and DP-178-like peptides are intended to be within the scope of the invention. Such analogs of the invention may exhibit increased antiviral activity, and may, further, posses increased bioavailability, and/or stability, or reduced immune recognition.

The DP-107-like and DP-178-like amino acid substitutions, insertions and deletions, are as described for DP-178, above, in Section 5.1. Analog modifications are as described, below, in Section 5.3.

PCT/US94/05739

WO 94/28920

TABLE V

Search Results Summary for 107x178x4 and ALLMOTI5 Motifs

WO 94/28920

PCT/US94/05739

<td> u> Ι- Ο Σ —t <</td><td> S ff > i □</td><td> δ © oc ff > z ω ff</td><td> δ © ce ff CM > Z</td><td> 0 CC > < > z 0 ff</td><td> Z © > « > Z © ff</td><td> Σ > 0 < © > z © o.</td><td> © § m > z ω o.</td><td> rs CM > 0 > Z 0 ff</td><td> ff < > -1 © > Z 0 ff</td><td> 3 < > _j a > z © ff</td><td> > < > «J 0 > Z 0 ff</td><td> CM O > -1 © > Z 0 ff</td><td> © 0 3 0 > Z 0 ff</td><td> > _1 0 > Z 0 ff</td><td> O δ s > Z 0 ff</td><td> o > 0 < O > z 0 ff</td><td> > « 0 > Z 0 ff</td><td> © > < 0 > z 0 ff</td><td> « > < 0 > Z 0 ff</td><td> © > < 0 > z 0 ff</td><td> a > « ui > z 0 ff</td><td> o δ 0 > z 0 ff</td><td> ! © > z 0 ff</td><td> ξ 0 > z 0 ff</td><td> > z 0 ff > z 0 ff</td><td> 0 IL > Z 0 ff</td><td> O tt â ff > z 0 ff</td><td> g ff > z 0 ff</td><td> δ 3 ff > z 0 ff</td><td> Ό > IL > Z 0 ff</td><td> m u 3 ff >' s ff</td><td> < © > «j IL > Z 0 ff</td><td> > 2 < O il > Z 0 ff</td><td> © u. © oc ff >' z 0 ff</td><td> « O > CÛ ff > Z 0 ff</td><td> © Ό > m IL > Z 0 ff</td><td> PENV FSVSM |</td><td> H © > © ff > Z 0 A</td><td> 2 < to > Z 0 a</td><td> < Fi Z > z 0 A</td><td> O *- J 1- z > Z 0 Q</td><td> 2 3 H Z > Z 0 A</td><td> CM 2 H Z > z 0 n</td><td> CM < Z > Z 0 n</td><td> s > z > Z 0 a</td><td> © 00 > z > z S1</td>

WO 94/28920

PCT/US94/05739

<td> Ipenv hvibn</td><td> c n > z > z UJ 0</td><td> s > z > z © 0</td><td> u w > X > z © 0</td><td> F Z > z > z © 0</td><td> w X > X > z UJ 0</td><td> © > X > Z © 0</td><td> C n > Z > z Ul 0</td><td> tt tt > X > z © 0</td><td> < £ > x > Z Ul 0</td><td> 0 £ > x > z © 0</td><td> z £ > X > z © 0</td><td> o z > z > z Ul 0</td><td> fc > z > z © 0</td><td> fc > z > z © 0</td><td> z tt > X > z © 0</td><td> © > z > z © 0</td><td> n © > x > z © 0</td><td> o © > z > z © 0</td><td> > x > z © 0</td><td> F 5 > z > z © 0</td><td> F N > X > Z © 0</td><td> © N *» > Z > Z © 0</td><td> o N > Z > Z © 0</td><td> Z N > Z > Z © 0</td><td> w © F > X > Z © 0</td><td> < O F > Z > Z © 0</td><td> o F > Z > z Ul 0</td><td> S F > Z > Z UJ 0</td><td> N Z F > Z > Z UJ 0</td><td> o 0 F > Z > Z lu 0</td><td> F © F > Z > z © 0</td><td> <D © 3 Z > g</td><td> H © F > Z > Z © 0</td><td> lu ί 0 > Z £</td><td> > oc © “J > Z tu 0</td><td> δ £ > z tu 0</td><td> n 0 0 u £ > z IU 0</td><td> > -J £ > z © Q</td><td> n u > s, > z IU 0</td><td> © > -j £ > z © Q</td><td> 0 0 > -J £ > z © 0</td><td> fc > -J £ > z © Q.</td><td> o X > £ > Z © Û</td><td> 3 s > z S*</td><td> o s 3 £ > z ©</td><td> o cc > S > Z R*</td>

33WO 94/28920

PCT/US94/05739

<td> A > -J > z ω a.</td><td> a £ s > z tu a.</td><td> σ I > z ω A</td><td> > 2 A Σ >' z ω A</td><td> © A > © 2 > z © A</td><td> © o >' z A A</td><td> £ o 2 A >' Z © A</td><td> £ A © A > z Ul A</td><td> £ © >' z A A</td><td> j 0 £ © >' z © A</td><td> 9» § © > z © A</td><td> σ $ © > z © A</td><td> < > © > z © A</td><td> 1- « > © > z UJ A</td><td> G > © > z A A</td><td> a σ > © > z A A</td><td> 2 > © > z A A</td><td> 0 2 > © > z A A</td><td> 2 > © >' z A A</td><td> -4 2 > © > z A A</td><td> *4 © > © > z A A</td><td> A © > © > Z A A</td><td> X > cc 2 © > z A A</td><td> έ © >' z A A</td><td> > -J > > z A A</td><td> > J > > Z A A</td><td> 0 > _l > > Z A A</td><td> PHEMA CVBLY |</td><td> 2 © δ < 2 A X A</td><td> o m δ < s tu £</td><td> PHEMA CVH0C |</td><td> U 5 s tu i</td><td> Z S < <' 2 A X A</td><td> Û D tt < « 2 A X A</td><td> < tt Q < §</td><td> o tt u « 2 A X A</td><td> A tt Q < < 2 A X A</td><td> a tt u < « 2 A X A</td><td> © tt O < < 2 A X A</td><td> > tt U « < 2 A X A</td><td> < Q < < 2 A X A</td><td> 0 « Û « < 2 A X A</td><td> 0 < Q < <’ 2 A X Q.</td><td> 44 « Q < A X a</td><td> G 0 < < 2 A X ft</td><td> A Û < <' 2 w x</td><td> 1 0 < < 2 A X</td>

WO 94/28920

PCT/US94/05739

<td> IPHEMA IADH2</td><td> « X o < « S au I IL</td><td> M X O < < S UJ 5</td><td> © X Q S £</td><td> © X O < < S au X o.</td><td> μ X Û < « S Ul X il</td><td> ε ο < Σ © X cl</td><td> Σ Ο < « Σ ω X α.</td><td> μ Σ Ο < < Σ © χ α.</td><td> > ζ ο « < Σ © X α.</td><td> Ν Ζ Ο < < Σ © X α.</td><td> e· 3 Û « I ω X 0.</td><td> TO Ο Û < < S © X α.</td><td> μ Ζ © < < Σ © χ α.</td><td> CC CL © < < Σ © χ α.</td><td> © CC TO « « Σ © χ α.</td><td> μ D Ο < © X ο.</td><td> □ TO « < Σ ω X 0.</td><td> -i < X < < S © X ο.</td><td> © U 5 Σ ω X IL</td><td> μ ϋ X < < Σ ω X ο.</td><td> Û U X « < s © X IL</td><td> © O < S © x Q.</td><td> Ο © X < « Σ © X ©</td><td> © X X < < Σ © X ο.</td><td> μ id X < < Σ © χ IL</td><td> © -Λ X < <' Σ © X α.</td><td> Ο u X < < Σ © χ IL</td><td> Σ X < <! Σ © χ ο.</td><td> Σ Ζ X « 1 © X α.</td><td> ζ ζ X < < Σ © X α.</td><td> C IL X < < Σ ω X IL</td><td> Ο Œ X < < Σ © χ CL</td><td> < © X < « Σ © χ β.</td><td> Α. © <' S © χ IL</td><td> ? © X < < Σ © Î</td><td> £ X < < Σ © X CL</td><td> 2 I 1 © £</td><td> ce ο X < < Σ © X IL</td><td> η. 3 « ω X (L</td><td> ω id < Σ © χ IL</td><td> Ζ a < « Σ © χ</td><td> 1 s <' Σ © χ</td><td> © « Σ < Σ © χ</td><td> ο < Σ < <' Σ m Ζ</td><td> ΰ £ < £ IM ?</td><td> μ © Σ < Σ © X</td>

<td> TO D O < « S © î</td><td> μ Ζ Ul « < S Ul X 0.</td><td> ff CL IL < <' Σ au x CL</td><td> UJ (C O s au £</td><td> μ O Ό < < S £</td><td> < j σ « < Σ Ul X 0.</td><td> —t < X < <' Σ © χ α.</td><td> © υ X < Σ © X α.</td><td> μ Ο X < <' Σ © X α.</td><td> Ο ο X « « Σ © X α.</td><td> © Ο X < < S © χ Û.</td><td> 2 X < 1 © X CL</td><td> © V X < < Σ © χ CL</td><td> μ X « « Σ ω X α.</td><td> © _Ι X < < £ £</td><td> Ο -i X < Σ © χ 0.</td><td> Σ X < « Σ © χ 0.</td><td> Σ Ζ X < « Σ © χ cl</td><td> Ζ ζ X < < Σ © X (L</td><td> C IL X 5 « Σ © £</td><td> Ο ce χ < < Σ © χ α.</td><td> « © X < « Σ © x CL</td><td> <L © x < < Σ © x CL</td><td> IPHEMA IAHSW 1</td><td> < < Σ © χ ο.</td><td> Ο >- X < < Σ © X α.</td><td> ce Ο χ < < Σ © χ CL</td><td> ω 2 < « Σ © χ CL</td><td> Ζ © -J < Σ © χ cl</td><td> « S « < S £</td><td> α < Σ < < Σ © χ CL</td><td> IPHEMA ΙΑΜΑ0 I</td><td> © Σ < < Σ © χ ο.</td><td> μ ω Σ Σ © χ α.</td><td> © © Σ 5 < Σ χ CL</td><td> Ζ Σ < Σ © χ IL</td><td> © Η Ζ < < Σ © χ CL</td><td> _ι ε « « Σ ω X CL</td><td> © 3 CL < < Σ © £</td><td> Û 3 C < « Σ ω X α.</td><td> μ © © < < Σ ω X CL</td><td> μ χ © « « Σ © χ IL</td><td> g © < Σ ω X CL</td><td> Β < < Σ © χ α.</td><td> Σ < < Σ © χ CL</td><td> ο ξ Σ © χ Α.</td><td> Û. £ < < Σ © χ CL</td>

PCT/US94/05739

WO 94/28920 s?

-36WO 94/28920

PCT/US94/05739

<td> IPHEMA INCP2</td><td> rt 0 u z « S Ul z 0</td><td> o z < © z 0</td><td> S S w z 0</td><td> © © < © 2 < 2 © £</td><td> z © « © 2 s £</td><td> © s s i © z 0</td><td> δ 2 2 « 2 © £</td><td> 1 2 3 2 5 © z 0</td><td> K 0 2 3 2 « 2 © £</td><td> © 0 2 3 2 < 2 © z 0</td><td> $ o z « 2 © z 0</td><td> © > û z < 2 © z 0</td><td> o > Q z I © £</td><td> 2 > o z < 2 © z 0</td><td> o > o z « 2 u X 0</td><td> o £ O z < 2 © z 0</td><td> 5 o z < 2 © z 0</td><td> > O O Z 0 < 2 © z 0</td><td> 5 z 0 « 2 u X 0</td><td> z rt 0 5 © z 0</td><td> H X rt 0 < 2 u x 0</td><td> © rt 0 < 2 © z 0</td><td> φ z rt 0 « 2 © z 0</td><td> < z « 0 < 2 © z 0</td><td> rt Z rt 0 < 2 w z 0</td><td> 3 Z rt 0 < 2 © z 0</td><td> > z « 0 < 2 u Z 0</td><td> * x « 0 < 2 © z 0</td><td> X z rt 0 « 2 w X 0</td><td> < z φ 0 < S £</td><td> δ è < 2 w z 0</td><td> x o z flC <' 2 © z 0</td><td> j o z S < 2 w X 0</td><td> © o z © © <' 2 © z 0</td><td> 0 o z © © « 2 © X 0</td><td> z o z © « 2 © £</td><td> S s rt © Z 0</td><td> N O z w rt < 2 © X</td><td> ? © <' 2 © f</td><td> © > rt <' 2 © z</td><td> Z J § rt, « 2 ω z</td><td> > © © > z © ></td><td> > X o > z UJ ></td><td> > o S >' z £</td><td> CM δ s > z ω ></td><td> > o o f > z</td>

WO 94/28920

PCT/US94/05739

<td> o 8 < > > z IU > Ol</td><td> c υ § > z u > n.</td><td> fi. o o $ > 5 Z</td><td> Ipvenv VACCV</td><td> o 8 $ 2 £</td><td> g § 2 £</td><td> 8 O « 2 £</td><td> δ o « > w s £</td><td> 8 O $ © 2 £</td><td> Û_ U u « > © 2 £</td><td> δ o < > IO 2 £</td><td> U U u « > R > Q.</td><td> δ Ο § R > Û.</td><td> u o u « > © R > a.</td><td> û. O o < > © R > fi.</td><td> U U u « > © R > o.</td><td> δ O < > © R > o.</td><td> S δ o IL « 0. IL > a.</td><td> è δ O IL fi. IL > Û.</td><td> £ δ o IL rx o. IL £</td><td> 1 o IL —I & £</td><td> U o o $ © g £</td><td> δ u < > m £ £</td><td> © © fi. fi. a »- S £</td><td> > © x § £</td><td> u υ u 5 § £</td><td> PVQ01 VACCV |</td><td> £ ·“ § £</td><td> © © > © X δ © > CL</td><td> IU > © X « 8 £</td><td> £ $ © o © £</td><td> U U u « > © o © £</td><td> > 5 >. © o © > a.</td><td> > © X © o © > a.</td><td> > © X rx o © > o.</td><td> U u o < > rx o © > fi.</td><td> £ Z r* o © > a.</td><td> u u u « > 9 o © > a.</td><td> > o o $ 9 O © > a.</td><td> > «c < > 9 O © £</td><td> > © x, o v- © > fi</td><td> K £ tt © 9 £</td><td> < © > © x © ·· ©</td><td> > tt X rx 5 ></td><td> > © X © © ></td><td> s « J δ ></td><td> ce £ © ER © £</td>

WO 94/28920

PCT/US94/05739

WO 94/28920 2164898

PCT/US94/05739

<td> |PVQL2 CVBLY</td><td> 2 0 > Ο 3 ο > ©</td><td> 2 δ CM -Λ σ > ©</td><td> δ > ο CM «J Ο δ</td><td> CM CM X δ CM -Λ O > ©</td><td> « 2 > U 3 O > ©</td><td> 0 < S > O CM © > ©</td><td> X n 2 > U CM -J © δ</td><td> tt © © > O CM © > ©</td><td> D © © > U «M -J © > ©</td><td> © CC © > O CM © > ©</td><td> 2 K © > u CM -J σ δ</td><td> > 0 0 CM © δ</td><td> > © © CM © > ©</td><td> © > S CM •Λ © > ©</td><td> 0 > 9 CM u © > ©</td><td> CM O > 0 CM «J © δ</td><td> tt > 9 3 © > ©</td><td> 2 > 0 CM © > ©</td><td> <td> £ § X 0 © δ</td><td> > © x o1 .J © > ©</td><td> © > tt X, 0 .J © δ</td><td> tt > 0 X 0 •J © > ©</td><td> © > 0 X 3 © > ©</td><td> © CM > © X 0 U o > ©</td><td> X CM > 0 X 0 © > ©</td><td> © CM > 0 X 0 © > ©</td><td> o © > © X, 0 *1 © > ©</td><td> S > 0 X. 0 © > ©</td><td> CM 0 > © X 0 © > ©</td><td> u 0 > 0 X 0 U © > ©</td><td> 0 > © X 0 -J © > ©</td><td> tu > 0 X o -j © > ©</td><td> < 0 > © Xi 0 © > ©</td><td> © w > 0 X o -1 © > ©</td><td> •J 0 > © X 0 -t © > a</td><td> Q 2 > 0 X, O _» © > a</td><td> « © > © X 0 -J © > ©</td><td> © u 2 3 © > 0</td><td> © > s © 0 © ></td><td> Q 0 -J © ></td><td> > © X Q © ></td><td> tt > © X U -Λ © ></td><td> CM > © X Q -j © ></td><td> en CM > tt X O © ></td><td> o a > © x Q -j © ></td>

-40WO 94/28920

PCT/US94/05739

SS © cô ο © ..

b © cm

g η © ©ο «μι J5 ο > Q.

δδ

WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

PCT/US94/05739

WO 94/28920

-44WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

TABLE VI

Search Results Summary for PCTLZEP, P1CTLZIP, and P2CTLZIP Motifs

-46WO 94/28920

PCT/US94/05739

<td> £ 1 £</td><td> Ul £ È 5 n</td><td> fi £ CO è Ul £</td><td> f; £ e > Z Ul £</td><td> < 2 > 2 Ul £</td><td> n w *· > z > 2 Ul £</td><td> < 2 > z > 2 Ul £</td><td> £ 2 > z > 2 Ul £</td><td> z CC > z > z Ul £</td><td> »“ fi > Z > z Ul £</td><td> O fi > z > z Ul £</td><td> 0 N > Z > 2 Ul £</td><td> fi N > X > 2 Ul £</td><td> x N > X > Z UJ £</td><td> Ul fi 0 > z > 2 Ul £</td><td> r~ O 0 > z > z Ul £</td><td> Ό 0 > Z > Z Ul £</td><td> N Z 0 > Z > z Ul £</td><td> o CC 0 > I > z Ul £</td><td> O fi 0 > X > z Ul £</td><td> H fi 0 > X > z Ul £</td><td> fi > z Ul £</td><td> t o 2 > 2 IU £</td><td> S £ O 2 > Z Ul £</td><td> 1 2 > 2 IU £</td><td> a § 2 > 2 Ul £</td><td> O 5 •1 2 > Z £</td><td> o 2 3 2 > Z Ul £</td><td> g 3 s > z IU a.</td><td> a 3 2 > z Ul £</td><td> fi 2 > Z IU £</td><td> 1 2 > z a</td><td> E fi > z IU £</td><td> •1 0 fc «0 > z Ul £</td><td> m o > fi > z Ul £</td><td> * 2 > S > z IU £</td><td> -J 2 > a> > z UJ £</td><td> ft co > S > z Ul £</td><td> £ fi > > Z Ul £</td><td> o > o U ft1 2 Ul X £</td><td> PHEMA CVBLY |</td><td> 2 a > u < 2 Ul X £</td><td> g δ < 2 Ul X £</td><td> PHEMA CVHOC |</td><td> IO < Σ δ <' 2 IU X £</td><td> fi 2 > u << 2 IU Ι- α</td><td> O < < < 2</td>

<td> Ipctlzip</td><td> Ul _j £ È 5 O U</td><td> > < O £ > Z Ul £</td><td> « S > Z > 2 Ul £</td><td> £ Σ > I > z Ul £</td><td> £ > X > z s</td><td> O fi > X. > 2 Ul £</td><td> 0 N > Z > Z Ul £</td><td> I N > Z > Z Ul £</td><td> Ul fi 0 > Z. > 2 Ul £</td><td> W O 0 > z > z UJ £</td><td> □ 0 > X > z Ul £</td><td> N 2 0 > X > 2 Ul £</td><td> O (C 0 > X > z Ul £</td><td> fi fi 0 > X > Z Ul £</td><td> H fi 0 > Z > Z Ul £</td><td> > a. fi 0 > z Ul £</td><td> CD f 2 2 > z Ul £</td><td> o t s Σ > z UJ £</td><td> W 2 > co > 2 lu £</td><td> _l 2 > «o > Z Ul £</td><td> 3 O δ < 2 Ul X £</td><td> 2 ea δ î UJ X £</td><td> O a δ ί Ul X £</td><td> ΙΡΗΕΜΑ CVHOC 1</td><td> fi < 2 > U < 2 Ul X £</td><td> 0 2 δ < 2 Ul X £</td><td> ΙΡΗΕΜΑ IN8AA 1</td><td> Ul a o z ί Ul X £</td><td> O CO OQ Z « 2 Ul Z £</td><td> z Ul oo z < 2 IU X £</td><td> a a 2 « 2 Ul Z £</td><td> -j Ό fi Z < 2 UJ X £</td><td> ΙΡΗΕΜΑ INBHK 1</td><td> fi s z < 2 Ul X £</td><td> O a Z < 2 IU X £</td><td> IU -1 00 z Ul X £</td><td> □ 2 o z « 2 Ul Z £</td><td> Ul 2 00 z i lu X £</td><td> < Z o z < 2 Ul X £</td><td> CC o co z < 2 Ul I £</td><td> fi O z i Ul I £</td><td> ”> fi 00 Z <' 2 Ul X £</td><td> fi □ m z Ul X £</td><td> > 00 z < 2 IU X £</td><td> 1 s 2 IU I o.</td><td> oo è z < 2 UJ X £</td>

WO 94/28920

PCT/US94/05739

<td> IPHEMA CVHOC</td><td> a « < « 2 Ul X 0.</td><td> z < ffi < < 5 Ul X x</td><td> o P CD < « 2 Ul X X</td><td> 2 o 3 < 2 Ul X x</td><td> o * o « « 2 Ul X CL</td><td> X tt o < < 2 UJ £</td><td> a X u < « 2 UJ X CL</td><td> ffi X o < < 2 UJ £</td><td> > tt u « < 2 Ul £</td><td> < o < < 2 Ul X CL</td><td> co < o < « 2 Ul £</td><td> 8 a < < s Ul £</td><td> X Û < « 2 Ul X CL</td><td> © X o < < 2 Ul X CL</td><td> CO X o < < 2 IU X CL</td><td> X o < < 2 Ul X CL</td><td> © X O < « 2 Ul X CL</td><td> © X a < 2 UJ £</td><td> © 2 o < « 2 Ul X CL</td><td> N Z O < <' 2 UJ X CL</td><td> ffi □ o < 2 ut X CL</td><td> ffi z UJ < < 2 Ul X CL</td><td> © Z IU « < 2 UJ £</td><td> Œ & < < s IU X O.</td><td> lu (C O « « 2 Ul X CL</td><td> © ffi < < 2 Ul X CL</td><td> < 3 σ S « s Ul £</td><td> < X $ < 2 UJ X CL</td><td> ffi o X « < 2 Ul X X</td><td> r*» O X < < 2 UJ X x</td><td> û O X < < 2 tu £</td><td> UJ O X < < 2 UJ X X</td><td> o X x < < 2 IU X X</td><td> ffi i£ X < < 2 UJ X X</td><td> P» L* X < « 2 UJ X X</td><td> IU —1 X < < 2 tu X X</td><td> o j X < « 2 Ul X a</td><td> 2 X < < 2 Ul X A</td><td> 2 Z X < « 2 tu X 0</td><td> z z X < < 2 IU X n</td><td> c X X < < 2 IU X n</td><td> O ce X < < 2 IU X</td><td> « CO X « « 2 IU f</td><td> x «o X < < 2 lu X</td><td> 5 (0 X < S Ul f</td><td> £ X < < 2 UJ X</td>

<td> 2 < ffi < « 2 0 X x</td><td> O D tt < « 2 Ul X a.</td><td> < X o < < 2 Ul X X</td><td> σ * o « « 2 Ul X CL</td><td> > o < < 2 UJ 5</td><td> 5 o « < 2 Ul X CL</td><td> co < Q < « 2 Ul X CL</td><td> 8 Q < « 2 Ul X IL</td><td> X a < 2 Ul X x</td><td> © X Û 5 < 2 Ul X flu</td><td> «0 X o < < 2 UJ X CL</td><td> M X Q « « 2 Ul X CL</td><td> 10 X a < < 2 UJ £</td><td> CD X o < « 2 Ul X CL</td><td> © X o < < 2 Ul X CL</td><td> © 2 Q « S Ul X CL</td><td> N Z o < < 2 UJ X CL</td><td> © Z Ul < « 2 Ul X CL</td><td> © Z UJ < < 2 UJ £</td><td> c CL IL « < 2 Ul X CL</td><td> _i < x < < 2 UJ X CL</td><td> (C « x < 2 Ul X CL</td><td> ffi o X < < 2 Ul X CL</td><td> P* U X < « 2 ut X CL</td><td> o o X < < 2 UJ X CL</td><td> Ul Û X < « 2 IU X &.</td><td> o IL X < < 2 UJ X a.</td><td> ffi X < « 2 Ul X Q.</td><td> r* X < < 2 Ul x CL</td><td> Ul X « < 2 tu X X</td><td> o .J X < < 2 UJ X X</td><td> 2 x « 2 IU X X</td><td> PHEMAJAHNM |</td><td> o te X « < 2 Ul X x</td><td> < ffi X < < 2 IU X X</td><td> X CO X « <' 2 lu X X</td><td> PHEMAJAHSW |</td><td> P X < < 2 Ul X a.</td><td> g X < <' 2 UJ X a</td><td> C 3 X « <' 2 Ul x D</td><td> UJ X < <' 2 Ul X n</td><td> z IU < < 2 Ul X X</td><td> < < 2 < < 2 UJ X</td><td> 9 2 « < 2 Ul X</td><td> O < 2 < <' 2 UJ X</td><td> Ul 2 « <' 2 Ul X'</td><td> © 0 2 < < 2 ω x</td>

WO 94/28920

2164698 PCT/US94/05739

<td> Iphema iameo</td><td> Z 2 3 < 2 Ul I fl.</td><td> ffi F Z < < 2 Ul X CL</td><td> r*. □ 0 < < 2 Ul X (L</td><td> Û Œ < < 2 Ul £</td><td> CT UJ © « « 2 © x IL</td><td> CT X © < < 2 © x CL</td><td> < F 10 « < 2 © x Q.</td><td> £ < < 2 © x CL</td><td> 2 Ê « « 2 © x CL</td><td> O ÈÉ < < 2 © x ft</td><td> (C P « « 2 © x (L</td><td> < < 2 © x CL</td><td> O O D < 2 w x CL</td><td> 0 0 3 < < 2 © X CL</td><td> CT > < < 2 © x IL</td><td> < X < < 2 © X CL</td><td> O U N < 2 u £</td><td> CT X N < < 2 © x IL</td><td> © X N < < 2 © x 0.</td><td> X O N < < 2 © x CL</td><td> 5 0 Z 2 © x OL</td><td> © ffi ffi z < 2 © x CL</td><td> o 0 0 Z « 2 w X fi.</td><td> Z © ffi z < 2 © X CL</td><td> □ u. 0 Z 2 © x CL</td><td> © ffi Z < 2 © x CL</td><td> X X 0 Z < 2 © x 0</td><td> co co z < 2 © x o.</td><td> Û 0 Z < 2 © x IL</td><td> © -J ffi Z < 2 © x CL</td><td> Û 2 0 Z < 2 © x a.</td><td> © 2 m z < 2 © x CL</td><td> < z 0 Z < S © x a.</td><td> £ O ffi Z < 2 © x CL</td><td> 0 0 Z < 2 © X fi.</td><td> 0 ffi Z < 2 © x a.</td><td> 0 3 O Z < 2 © X ft.</td><td> > ffi z < 2 © x a.</td><td> * > 0 Z < 2 © x 0.</td><td> oo > m z < 2 © x cl</td><td> 2 CL 2 3 2 < 2 © x o.</td><td> £ ft 2 3 2. <' 2 © x a.</td><td> 0 a. 2 3 2 « 2 © x CL</td><td> X ft <' 2 © x</td><td> x CT ft 2 ω x η,</td><td> F X CT ft < 2 © ?</td>

WO 94/28920

PCT/US94/05739

<td> > 0 < S tu Z o.</td><td> 0 > 0 < Z ω £</td><td> s o 0 > 0 <' S 0 Z Cl.</td><td> a. u 0 > 0 < Z 0 z tu</td><td> z -j 0 > 0 <' Z 0 £</td><td> U u u § 0 £ £</td><td> 0 O o < 0 £ £</td><td> > u o 2 0 O U. > a.</td><td> O O o 2 © 2 £</td><td> > o u < > © £ £</td><td> < © > © z P* 0 © > 0</td><td> > 0 X o' 0 © > CL</td><td> ! z © © © > CL</td><td> > 0 X W M· © £</td><td> > 0 X 0 © © > O.</td><td> > 0 Z, 0 0 © > CL</td><td> n £ 0 © £</td><td> © i 0 © £</td><td> > 0 I m «u § 0</td><td> Ul > 0 X, m .j © £</td><td> 0 I © .j © > 0</td><td> m u > 0 Z a' -a © £</td><td> 0 > 0 X © © > 0</td><td> « 5 0 § 0</td><td> 0 g © —a Ό £</td><td> ! m .J © £</td><td> 0 > Œ 0 O -A © > 0</td><td> Q > 5, Ul u © > 0</td><td> 0 > 0 0 © > 0</td><td> PVOLHHCMVA |</td><td> PVOLH HCMVT |</td><td> > 0 X z' -a © £</td><td> ω > © Z z' Ό > 0</td><td> > 0 z □ © £</td><td> Ps Z O fi, Z .j © > 0</td><td> I 0 Z D Si S _J © > 0</td><td> Z Z 3 O 0 S -a © > 0</td><td> 0 z D □ 0 S .J © £</td><td> £ £ 5 o > 0</td><td> g > c s' .A © £</td><td> © © 0 5 ή Ό > O,</td><td> n 0 0 5 5 © £</td><td> 2 O 5 δ © £</td><td> U i îï © £</td><td> ÎÜ 0 O Z 5 © ></td><td> 5 s X Z £</td><td> _l > O Ul cc z £</td>

WO 94/28920

PCT/US94/05739

51WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

<td> IPVMT2 IAFPR</td><td> 5 CL U. < CM 1- 2 δ</td><td> 0 —J < 04 1- 2 > a.</td><td> CM 0 U < CM f- 2 > CL</td><td> z 2 a.</td><td> 0 3 CL < CM t- 2 > CL</td><td> z <n a.</td><td> |PVMT2 IAUDO</td><td> _j £ < CM H 2 > a.</td><td> -J > X > 2 a H 2 > a.</td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td>

WO 94/28920

PCT/US94/05739

Search Results Summary for P3CTLZIP, P4CTLZIP,

P5CTLZIP, and P6CTLZIP Motifs

TABLE VII

-54WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

-57WO 94/28920

PCT/US94/05739

<td> 5 m 0. X < TO Σ > o.</td><td> z z « < μ H 5 > CL</td><td> 2 < CD < μ ς > CL</td><td> 5 Ο IL a.</td><td> α. cl U. < £ Σ > Ο.</td><td> © < £ £ > (L</td><td> ω < £ £ £</td><td> μ UI « μ Η Σ > IL</td><td> |PVMT2 IAMAN</td><td> UI □ (L « μ Κ Σ > IL</td><td> Ζ TO < μ Η Σ > ο.</td><td> Ο Û 3 £ £ > CL</td><td> £ < £ > Q-</td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td>

-58WO 94/28920

PCT/US94/05739

TABLE VIII

Search Results Summary for P7CTLZIP, P8CTLZIP, and P9CTLZIP Motifs

-59PCT/US94/05739

WO 94/28920

WO 94/28920

PCT/US94/05739

PCT/US94/05739

WO 94/28920

<td> •μ- Ul > © Z z —J © > Ol</td><td> m Ul > (0 z z © > CL</td><td> < > 2 ο X 3 © > CL</td><td> > & s «J © > IL</td><td> > Ul © CL —I © > CL</td><td> © <0 CO 3 >; © > CL</td><td> © © 3 > -J 9 > CL</td><td> UJ CL o 2 £ © > CL</td><td> > m IU CM CL © > O.</td><td> > co © « CL © > CL</td><td> o > o © cc 2 > CL</td><td> u > O © © 2 > CL</td><td> Q > O © CC © 2 £</td><td> tPVMAT PI1HC</td><td> H X CM CL H < 2 > CL</td><td> IL □ Z Ul o »- « 2 > CL</td><td> X o z ω © »- < 2 > CL</td><td> N O z © © 2 £</td><td> £ 2 > CL</td><td> £ ω 2 Ul 2 > CL</td><td> > CC Ul O CL 2 > CL</td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td><td></td>

-62WO 94/28920

PCT/US94/05739

TABLE IX

Search Results Summary for P12CTLZIP Motif

-63WO 94/28920

PCT/US94/05739

“64-

PCT/US94/05739 > 94/28920

WO 94/28920

PCT/US94/05739

<td> IPHEMA CVBÛ</td><td> υ ο X > u « 2 m X α.</td><td> © < 2 δ < 2 ω X ff</td><td> CO 2 > u « 2 0 x α.</td><td> o 3 < 2 ω x CL</td><td> 2 < m < < 2 0 £</td><td> Q 3 m < 2 0 x CL</td><td> « X u < < 2 0 £</td><td> o o < < 2 0 X o.</td><td> CL U < « 2 0 x ff</td><td> PHEMA IACKQ</td><td> © u < < 2 w x CL</td><td> > Q < < 2 0 X CL</td><td> < Q < 0 X CL</td><td> © < O < < 2 ω x CL</td><td> © < o < « 2 w X IL</td><td> © O a < < 2 0 x CL</td><td> 0 Û < < 2 w X ff</td><td> X o < < 2 0 X CL</td><td> © X Q < < 2 w x CL</td><td> « X o < 2 0 X CL</td><td> X Û « « 2 w X CL</td><td> © X o < < 2 0 X CL</td><td> © X o < < 2 0 X CL</td><td> r* x O < < 2 0 x CL</td><td> © 2 û « 2 0 x CL</td><td> IPHEMA IADMA 1</td><td> N Z O < < 2 w x CL</td><td> © 3 Û < < 2 0 x CL</td><td> © z 0 < < 2 0 X CL</td><td> ts z 0 < < 2 0 X CL</td><td> c CL IL < < 2 0 x CL</td><td> 0 Œ O < < 2 0 x CL</td><td> © 3 σ « < 2 © x IL</td><td> < 3 © < < 2 0 X ff</td><td> < X < « 2 0 x o.</td><td> a. < x < < 2 0 x ff</td><td> o u X < < 2 0 X ff</td><td> rs o X < < 2 0 X ff</td><td> IPHEMAJAHCD |</td><td> 0 o X < <' 2 0 X ff</td><td> o IL X < < 2 w x o.</td><td> a x x < <' 2 0 x œ</td><td> rs iC X « <' 2 w X ff</td><td> 0 x < < 2 0 X ff</td><td> O u X < « 2 0 X ff</td><td> 2 x < < 2 0 X o.</td>

Ό 94/28920

PCT/US94/05739

<td> Σ ζ X < < Σ © X a.</td><td> Ζ Ζ X < < Σ ω £</td><td> χ a. X < < Σ ω X α.</td><td> Ο C X < < Σ © X (L</td><td> < m χ < <' Σ ω X ο.</td><td> a. to X < < Σ © χ α.</td><td> 5 © X < < Σ © X a.</td><td> £ X < < Σ © X Û.</td><td> Ο »- X < < Σ © X α.</td><td> X 3 X < « Σ © X ο.</td><td> ο. < < < Σ © X a.</td><td> < < Σ < « Σ © X α.</td><td> IPHEMAJAMAB</td><td> Ο « Σ < < Σ ω X 0.</td><td> © Σ < < Σ © X α.</td><td> μ ω Σ « « Σ © X α.</td><td> © © Σ < < Σ © X 0.</td><td> Ζ Σ « < Σ © X ο»</td><td> © Η Ζ < < Σ © X 0.</td><td> -j α. < < Σ © X ο.</td><td> μ 3 σ < < Σ © X a.</td><td> Ο 3 0C < < Σ ω X α.</td><td> μ ω μ < < Σ ω X 0.</td><td> μ X μ < Σ © X 0.</td><td> g μ < < Σ © X ο.</td><td> g < « Σ © X 0.</td><td> g < < £ © X ο.</td><td> (Ε 1 < Σ ω X 0.</td><td> g < < £ © X 0.</td><td> Ο Ο 3 < < Σ © X ο.</td><td> μ > < < Σ © X ο.</td><td> « χ < < Σ © X α.</td><td> Ο U Ν < < Σ ω X 0.</td><td> μ X Ν < < Σ © X α.</td><td> μ χ μ < < Σ © χ ο.</td><td> χ □ Ν < < Σ © X α.</td><td> < < © ζ < Σ © χ °-</td><td> ω © α ζ « Σ © X 0.</td><td> Ο © 0 Ζ < Σ © X 0.</td><td> Ζ ω © Ζ « Σ © X 0.</td><td> 3 u_ © Ζ < Σ © χ 0.</td><td> •j σ © ζ « Σ ω X 0.</td><td> χ X 0 Ζ < Σ © χ ο.</td><td> ο m ζ < Σ © χ 0.</td><td> Ο © Ζ < Σ © X α.</td><td> a © ζ < Σ © χ 0.</td><td> i © ζ © £</td>

WO 94/28920

PCT/US94/05739

Ί 94/28920

PCT/US94/05739

<td> Ο ζ Λ < 2 UI X α.</td><td> Q Ζ κ < 2 111 X a.</td><td> to Ο ζ lu © < 2 lu X £</td><td> £ O Z Ul 10 < 2 Ul X £</td><td> X o z Ul © < 2 IU X £</td><td> ”> Q Z Ul © « 2 Ul X £</td><td> N O z lu © < 2 Ul X £</td><td> * > © < 2 © X £</td><td> © > © < 2 IU X £</td><td> 2 O © > © « 2 © x £</td><td> £ O © > © < 2 © x £</td><td> Z _J © > © « 2 © X £</td><td> IPHEMA VACCC</td><td> u o < > « 2 © x £</td><td> b o < > < 2 © X £</td><td> δ u « > < 2 © X £</td><td> > UJ ffl > Z © > £</td><td> > X Q > Z © > £</td><td> > < © > Z © > £</td><td> 3 © -t > z © δ</td><td> > u 2 > Z % £</td><td> 0 > u 2 > z © > £</td><td> > O o P > z © > £</td><td> o u u < > © 2 δ</td><td> £ O o < > © £ δ</td><td> > U o < > © ε £</td><td> o o o < > © ε > £</td><td> > U U < > © ε > £</td><td> O o Q < > £ > £</td><td> O o u < > © £ > £</td><td> £ O Q < > © £ > £</td><td> > £ 5 o £ £ £ > £</td><td> > £ 5 o £ 0 6 £</td><td> w > £ « U b £ £ > £</td><td> > £ £ O £ b £ £ > £</td><td> W > £ £</td><td> N Z £ OC O © 2 δ</td><td> © o u « > © 2 > «-</td><td> © © > © X δ Ό > £</td><td> > © X δ σ > £</td><td> O O Q < > δ CT > £</td><td> > O u < > o CT > £</td><td> > cc < >, g δ</td><td> O > 5 δ o δ</td><td> o o Q < > 0 O CT > £</td><td> δ $ 0 o CT > £</td><td> O o o < > s CT > £</td>

WO 94/28920

PCT/US94/05739

94/28920

PCT/US94/05739

<td> 1 HSVI1</td><td> HSVSA</td><td> > « X</td><td> « © > © X</td><td> te > 0 ©</td><td> © > S</td><td> l HCMVA</td><td> 0 © > o</td><td> © © > O</td><td> >- ~a CO > U</td><td> Z © > o</td><td> σ O > u</td><td> > CO > O</td><td> CVH22</td><td> Z > ü</td><td> CVMA5</td><td> X -> z > Q</td><td> w 0 0 > u</td><td> z> 0 0 > 0</td><td> © C 0 > O</td><td> Z s 0 δ</td><td> £ 0</td><td> © > fi</td><td> a > fi</td><td> 0 O > fi</td><td> © o i</td><td> X > fi</td><td> Z > fi</td><td> «- > fi</td><td> 0 D > m</td><td> © o > S.</td><td> > © w</td><td> < > Z 0 x</td><td> £ Σ 0 X</td><td> > © X</td><td> 0 > <0 X</td><td> x > © X</td><td> 0 > © X</td><td> © 0 > « x</td><td> x 0 > © X</td><td> © 0 > © x</td><td> © > © X</td><td> © > © X</td><td> 0 a > © x</td><td> © > © x</td><td> Ul > © X</td><td> UJ > « I</td>

WO 94/28920

PCT/US94/05739

<td> IPVQLB HSVEA</td><td> a 111 > ω X co _i σ > 0</td><td> .□ 0 > <0 X 0 _l σ > a.</td><td> o 2 > to X 0 -i σ > 0</td><td> Ipvqlb hsvsa</td><td> © δ J 0 -Λ σ > 0</td><td> « δ 0 σ > a.</td><td> J m -j σ > a.</td><td> Ipvqlb mcmvs</td><td> u. > CC 0. CD _J σ > CL</td><td> o > N > 0 Ό > CL</td><td> ·— > 0 X u _J σ > CL</td><td> > © X o tO > CL</td><td> © > « X u •J © > a.</td><td> Λ © > © X Q -J Ό > CL</td><td> U 0 > to X u «J to > CL</td><td> 0 > © X o Ό > CL</td><td> © UJ > 10 X o σ > CL</td><td> PVQLC H8VMB</td><td> to 2 > © X o u σ > a.</td><td> 2 2 > © X o Ό > CL</td><td> IL > X ft. u J σ > o.</td><td> o > 5 o σ > a.</td><td> m > 5 o -Λ © > CL</td><td> T“ > © X o -J tO > CL</td><td> © > to X Q j σ δ</td><td> > © X 0 o > ft.</td><td> □ > 0 «J σ > cl</td><td> < > © cc 0 0 _J Ό > CL</td><td> o > © x 0 IL -J σ > cl</td><td> CC > © cc 0 u. σ > cl</td><td> o > o o IL -t Ό > a.</td><td> > © cc X IL -Λ to > ft.</td><td> 5 © X X ή σ £</td><td> «j > © Œ X IL Ό > A.</td><td> X > © X X IL _J σ > CL</td><td> 0 © <td> S < w 2 IL -J O > CL</td><td> > © < 0 2 IL to > û_</td><td> 2 cl 2 □ 2 IL -t © δ</td><td> x o. 2 3 2. IL © > ft.</td><td> Cfi CL 2 3 2 u .j © > IL</td><td> < > o z, 0 -J © > ft.</td><td> » > o z 0 © > 0</td><td> 2 > û z 0 © > CL</td><td> g o z, 0 «J © > 0</td><td> © £ o z 0 © > 0</td>

94/28920

PCT/US94/05739

PCT/US94/05739

WO 94/28920

<td> IPVQLM PTPV</td><td> X 2 3 3 © 2 -J © > ©</td><td> tt 2 3 3 © 2 © > ©</td><td> δ i Σ © > ©</td><td> 2 > CC 2 -j © > ©</td><td> CC 3 O UI 0 2 © > ©</td><td> tt 3 O 0 tt 2 _1 © > ©</td><td> tt 3 3 2 -Λ Ό > ©</td><td> > 0 m © Ό > ©</td><td> c > c © X -J © > ©</td><td> z z 3 > © > ©</td><td> © ω co « > .j © > ©</td><td> © 0 0 < h © > ©</td><td> < > u > © > ©</td><td> o > —t > -Λ O > ©</td><td> w © o 2 > © > ©</td><td> > Œ < © h © > ©</td><td> δ ? i, © > ©</td><td> 0 > o < H i © > ©</td><td> r* > U « H > —t © > ©</td><td> o 3 ù © > ©</td><td> > 2 © u n z © > ©</td><td> > 2 © tt 2 z © > ©</td><td> > 2 © u 2 z © > ©</td><td> > m 0 CM © © > ©</td><td> > a u « © © > ©</td><td> > CD 0 tt © © > ©</td><td> o u u < > o 2 > a.</td><td> > o o < > δ 2 > ©</td><td> O > o 0 oe 2 > ©</td><td> > O 0 a 2 > ©</td><td> o > o UI © CM 2 > ©</td><td> Û > O 0 © PM CM 2 > ©</td><td> ”1 > O UI © PM 2 > ©</td><td> —t > o 0 a CM 2 > ©</td><td> O > o 0 © © 2 > ©</td><td> < > © ec. m H < 2 > ©</td><td> o > û u k « 2 > ©</td><td> < > © © x K < 2 > ©</td><td> > 2 © -t < 2 > ©</td><td> 0 © < 0 2 H < 2 > ©</td><td> x CO < 0 2 K < 2 > ©</td><td> «o < 0 2 < 2 > ©</td><td> 3 CO « 0 2 1- « 2 δ</td><td> © © 2 3 2 l·- < 2 > ©</td><td> § O z « 2 > ©</td><td> O > O z 1- < 2 > ©</td>

-747 94/28920

PCT/US94/05739

PCT/US94/05739

WO 94/28920

2164608

76WO 94/28920

PCT/US94/05739

2164898

TABLE X

Search Results Summary for P23CTLZIP Motif

-77WO 94/28920

PCT/US94/05739

<td> IP23LZIPC</td><td> lu «J 0 fc s □</td><td> 3 tt > < > Z Ul 0</td><td> £ > Ul « tt © 0</td><td> tt m > s 0</td><td> F F > tt > Z © 0</td><td> σ > tu < ü > Z © 0</td><td> > « S > z u 0</td><td> F > < ut > Z © 0</td><td> tt > « © > Z © 0</td><td> W > < © > Z © 0</td><td> tt > < © > z © 0</td><td> O > < © > Z Ul 0</td><td> « © > Z © 0</td><td> © > Z © 0</td><td> © 0 > 0 > Z © 0</td><td> fc 0 > z © 0</td><td> -J o > 0 > z © 0</td><td> © -J > «J 0 > Z © 0</td><td> « (0 > •Λ 0 > 2 0</td><td> O 0 > z © 0</td><td> a 0 © c 0 > z w 0</td><td> < S 2 > z © 0</td><td> tt o > o 0 > Z © 0</td><td> 2 > tt 0 > Z © 0</td><td> F 5 tt 0 > Z © 0</td><td> < <9 > Z © 0</td><td> F < > X > z © 0</td><td> S > x > z © 0</td><td> O tt > X > z © 0</td><td> Z 0 > X > Z © 0</td><td> K tt > X > z w 0</td><td> 3 > X > z © 0</td><td> -J © > X > z © 0</td><td> F X > X > z © 0</td><td> tt X > X > z © 0</td><td> tt tt > X, > Z © 0</td><td> C tt > X Z © 0</td><td> CD y > x, > z © 0</td><td> < 2 > X > z © 0</td><td> 0 2 > X > 2 0</td><td> Z 2 > X > z © 0</td><td> O Z > X > z © 0</td><td> o fc X y z S</td><td> > 0 > X > z © 0</td><td> X CC > X > z © 0</td><td> O CD > X Z © 0</td>

-78WO 94/28920

PCT/US94/05739

<td> δ > x >' z 8!</td><td> © g > X > Z Ul X</td><td> © N > X > Z £</td><td> CO N > X > z Ul X</td><td> ffi N > X > Z 0 X</td><td> o N > X > Z 0 X</td><td> 0 m © > X > z 0 X</td><td> 5 © > X > z Ul X</td><td> δ © > x > z 0 X</td><td> N Z © > X >' z 0 X</td><td> a «> © > X > z 0 X</td><td> > ce CO “9 > z 0 X</td><td> o Ê s s > z Ul o</td><td> o 1 2 > Z 0 X</td><td> X > ffi ce > z 0 x</td><td> 2 (0 > z 0 X</td><td> ffi 2 ffi > z 0 X</td><td> c > ffi > z 0 X</td><td> ffi ffi > ffi > z 0 x</td><td> 2 > CO > z 0 x</td><td> tt 2 > ffi > Z 0 X</td><td> 2 > ffi > Z 0 x</td><td> ffi > ffi > Z 0 X</td><td> X ffi > ffi > Z 0 X</td><td> o > o o < 2 0 X x</td><td> o □ n « < 2 0 X X</td><td> 2 O < < 2 0 X x</td><td> > tt O « < 2 0 x x</td><td> < û < < 2 0 x x</td><td> 8 O s ί 0 X x</td><td> Iphema iadhb t</td><td> w z Q < < 2 0 x x</td><td> ce X X < < 2 0 x X</td><td> 0 ce ffi S < S £</td><td> 2 s < < s Ul £</td><td> Iphema JAMAB |</td><td> Iphema iarud |</td><td> © 0 ffi < < 2 0 X X</td><td> 1 ffi < < 2 0 x x</td><td> 2 x 2 3 2 < 2 ω x x</td><td> s X 2 z> 2 < 2 0 X x</td><td> CO X 2 3 2 < 2 0 x x</td><td> £ o Z < 2 0 X X</td><td> ffi > o z < 2 0 X x</td><td> Q > O Z < 2 0 x x</td><td> 5 O z < 2 0 X x</td><td> > o z < 2 0 x x</td>

WO 94/28920

PCT/US94/05739

<td> 2 > Ω Ζ <' 2 © X 0</td><td> Ο > Ω Ζ. 2 © X 0</td><td> ? Ω Ζ <' 2 © X 0</td><td> 3 > Ο Ζ <' 2 © X 0</td><td> 5 X 0 < 2 ω X 0</td><td> X CM 0 <' 2 ω X 0</td><td> κ X CM 0 <' 2 © X 0</td><td> CO 2 0 < 2 © x 0</td><td> φ x 2 0 < 2 © X 0</td><td> < x S 0 « 2 © X a.</td><td> »- x <9 0 <' 2 © x 0</td><td> 3 X £2 0 < 2 © X 0</td><td> > x « 0 < 2 © X 0</td><td> x <9 0 < 2 © x 0</td><td> X δ 0 <' 2 © X 0</td><td> « 5 0 < 2 © X 0</td><td> 8 δ < 2 © X 0</td><td> _l Q Z C < 2 © x 0</td><td> © Ω Z © CO < 2 © X 0</td><td> 0 Û Z w CO « 2 © X 0</td><td> x Ω Z © CO < 2 © X 0</td><td> o g CO < 2 w X 0</td><td> M Ω Z © CO <' 2 © X 0</td><td> J <0 < 2 © X 0</td><td> © g © X 0</td><td> 2 o © > CO w x 0</td><td> 0 o © > CO <' 2 © X 0</td><td> z ? <0 2 © X 0</td><td> |PHEMA VACCC |</td><td> G o < > « 2 © X 0</td><td> |PHEMA VACCT |</td><td> 8 O < 2 © X 0</td><td> > © © > z © > 0</td><td> > X O > z © £</td><td> 8 s > z © > 0</td><td> «M > U 2 > Z © > 0</td><td> O O o < > > z © > 0</td><td> G u < > > z © > 0</td><td> 0 O Q < > > z 2 0</td><td> 8 U 5 z 2</td><td> o o o < > C9 i</td><td> 8 U 5 A £ £</td><td> £ s o 0 fc > o.</td><td> £ 5 o 0 ? > 0</td><td> 0 < O r> t > 0</td><td> o o u < > rt £ £</td><td> IPVFUS VACCV |:</td>

WO 94/28920

PCT/US94/05739

<td> > © X Ο ο > £</td><td> α UJ > © X 01 ο σ > £</td><td> > Ο Ο $ 0 ο ο > £</td><td> > c < > 0 ο ο > £</td><td> > © X 01 ο ο > £</td><td> > © X ο © > £</td><td> ο ο ο < > © ο <9 > £</td><td> > oc < > © ο σ > £</td><td> υ ο ο < > b ο ο > £</td><td> δ 2 b Ο σ > £</td><td> |pVG09 VACCC</td><td> |PVG09 VACCV</td><td> > α < > © ο σ > £</td><td> > © X δ > £</td><td> > © X 01 δ > £</td><td> < © > © X 0 δ > £</td><td> X δ © δ > £</td><td> > © X 0 0 Ο > £</td><td> > © X 0 0 ο > £</td><td> > © X © 0 σ > £</td><td> < m > © X b 0 ο > £</td><td> > © X © 0 ο > £</td><td> < © X © 0 ο > £</td><td> δ ω 2 < X 0 Ο δ</td><td> Μφ δ © 0 Ο > £</td><td> > © X © 0 Ο > £</td><td> < © > © X © 0 ο > £</td><td> > © X © 0 Ο > £</td><td> < © > © X g σ > £</td><td> > © X 5 σ > £</td><td> > © X 0 Μ ο > £</td><td> > © X 0 •Φ σ > £</td><td> > © x © m· o > £</td><td> < © > © X © Mt σ > £</td><td> < © > © X ο © ο > £</td><td> > © X © σ > £</td><td> > © X 0 © £</td><td> > © X © © σ δ</td><td> > © X © © ο > £</td><td> > © X © © σ > £</td><td> < © > © X © © ο > £</td><td> > © X » © σ > £</td><td> > © X © ο > £</td><td> > © X 3 σ > £</td><td> X © © Ό > £</td><td> > © X b © σ δ</td><td> X > £ « © Ο > £</td>

WO 94/28920

PCT/US94/05739

<td> < μ > μ x, Τ' μ Ο > 0</td><td> ! X μ μ Ο > 0</td><td> > μ χ 10 μ <9 > 0</td><td> > μ χ, μ μ σ £</td><td> CC > ο. μ μ' Ο > 0</td><td> α > μ 0 Ο > 0</td><td> § Σ Ο X μ1 χ ο > 0</td><td> 0 μ > υ μ _j σ > 0</td><td> © —1 00 > Ο <Μ -Λ Ό > 0</td><td> ϊ; μ > υ μ —1 σ > 0</td><td> Σ m > Ο μ _ι σ > 0</td><td> Ο μ > Ο μ «j Ό > 0</td><td> > μ > ο μ _Ι Ο > 0</td><td> μ μ X > Ο μ Ό > 0</td><td> Μ* Σ δ μ σ > 0</td><td> μ « Σ > Ο μ -Λ σ > 0</td><td> X > ο μ -t Ό > 0</td><td> ω © 0 δ μ -1 σ > 0</td><td> 3 0 0 δ μ •j σ > 0</td><td> μ ce 0 δ μ _ι σ £</td><td> Σ α 0 δ μ «j ο > 0</td><td> £ 0 μ u σ £</td><td> μ > fi μ —Λ Ό £</td><td> IPVQLB HCMVA 1</td><td> 1 ο X α I</td><td> 3 μ > μ X μ «j σ £</td><td> α > © X μ -j ο £</td><td> μ μ > μ X μ u ο > 0</td><td> ο 5 μ X μ mJ Ο > 0</td><td> μ 5 μ σ > 0</td><td> » £ _ι © Ο > 0</td><td> ί> μ -i ο £</td><td> μ > Σ ο Σ α _ι Ο > 0</td><td> > μ X ο U Ο > 0</td><td> > © X ο «J ο > 0</td><td> μ > μ X ο «J ο £</td><td> μ μ > μ χ ο Ό > CL</td><td> Ο a > μ χ ϋ u Ο > 0</td><td> ο > μ > Ο _ι Ο > 0</td><td> μ > 5 υ -J μ > 0</td><td> i > μ χ α -J Ό > 0</td><td> μ © > μ χ ο -J σ > 0</td><td> © > μ χ ο -J σ > 0</td><td> Μ ω > μ χ 3 ο > 0</td><td> μ ω > μ χ © Ό > 0</td><td> «j S μ χ 3 σ > 0</td><td> ε > CC 0 © mJ Ό > 0</td>

WO 94/28920

PCT/ÜS94/05739

-83WO 94/28920

PCT/US94/05739

2164638

WO 94/28920

PCT/US94/05739

CA 02164698 2004-07-30

5.3. SYNTHESIS OF PEPTIDES

The peptides of the invention may be synthesized or prepared by techniques well known in the art. See, for example, Creighton, 1983, Proteins: Structures and Molecular Principles, W.H. Freeman and Co.. NY.

Short peptides, for example, can be synthesized on a solid support or in solution. Longer peptides amy be made using recombinant DNA techniques. Here, the nucleotide sequences encoding the peptides of the invention may be synthesized, and/or cloned, and expressed according to techniques well known to those of ordinary skill in the art. See, for example, Sambrook, et al.. 1989, Molecular Cloning, A

Laboratory Manual, Vols. 1-3, Cold Spring Harbor Press, NY.

The peptides of the invention may alternatively be synthesized such that one or more of the bonds which link the amino acid residues of the peptides are non-peptide bonds. These alternative non-peptide bonds may be formed by utilizing reactions well known to those in the art, and may include, but are not limited to imino, ester, hydrazide, semicarbazide, and azo bonds, to name but a few. In yet another embodiment of the invention, peptides comprising the sequences described above may be synthesized with additional chemical groups present at their amino and/or carboxy termini, such that, for example, the stability, bioavailability, and/or inhibitory activity of the peptides is enhanced. For example, hydrophobic groups such as carbobenzoxyl, dansyl, or tbutyloxycarbonyl groups, maybe added to the peptides' amino termini. Likewise, an acetyl group or a 9fluorenylmethoxy-carbonyl group may be placed at the peptides' amino termini. (See X in Tables I to IV, above.) Additionally, the hydrophobic group, t86

WO 94/28920

PCT/US94/05739

2164898 buty1oxycarbony1, or an amido group may be added to the peptides' carboxy termini. (See Z in Tables I to IV, above.) Further, the peptides of the invention may be synthesized such that their steric configuration is altered. For example, the D-isomer of one or more of the amino acid residues of the peptide may be used, rather than the usual L-isomer. Still further, at least one of the amino acid residues of the peptides of the invention may be substituted by one of the well known non-naturally occurring amino acid residues. Alterations such as these may serve to increase the stability, bioavailability and/or inhibitory action of the peptides of the invention.

Any of the peptides described above may, additionally, have a non-peptide macromolecular carrier group covalently attached to their amino and/or carboxy termini. Such macromolecular carrier groups may include, for example, lipid-fatty acid conjugates, polyethylene glycol, or carbohydrates.

”X, in Tables I to IV, above, may therefore additionally represent any of the above macromolecular carrier groups covalently attached to the amino terminus of a peptide. Likewise, Z, in Tables I to IV, may additionally represent any of the macromolecular carrier groups described above.

5.4. ASSAYS FOR ANTIVIRAL ACTIVITY The antiviral activity exhibited by the peptides of the invention may be measured, for example, by easily performed in vitro assays, such as those described below, which can test the peptides' ability to inhibit syncytia formation, or their ability to inhibit infection by cell-free virus. Using these assays, such parameters as the relative antiviral activity of the peptides, exhibit against a given strain of virus and/or the strain specific inhibitory

CA 02164698 2004-07-30 activity of the peptide can be determined. A cell fusion assay may be utilized to test the peptides' ability to inhibit HIV-induced syncytia formation in vitro. Such an assay may comprise culturing uninfected ¢0-4+ cells (such as Molt or CEM cells, for example) in the presence of chronically HIV-infected cells and a peptide to be assayed. For each peptide, a range of peptide concentrations may be tested. This range should include a control culture wherein no peptide has been added. Standard conditions for culturing, well known to those of ordinary skill in the art, are used. After incubation for an appropriate period (24 hours at 37°C, for example) the culture is examined microscopically for the presence of multinucleated giant cells, which are indicative of cell fusion and syncytia formation.

A reverse transcriptase (RT) assay may be utilized to test the peptides' ability to inhibit infection of CD-4+ cells by cell-free HIV. Such an assay may comprise culturing an appropriate concentration (i.e.. TCID50) of virus and CD-4+ cells in the presence of the peptide to be tested. Culture conditions well known to those in the art are used.

As above, a range of peptide concentrations may be used, in addition to a control culture wherein no peptide has been added. After incubation for an appropriate period (e.g.. 7 days) of culturing, a cell-free supernatant is prepared, using standard procedures, and tested for the present of RT activity as a measure of successful infection. The RT activity may be tested using standard techniques such as those described by, for example, Goff et al. (Goff, S. e£ al.. 1981, J. Virol. 28:239-248) and/or Willey et al. (Willey, R. et al.. 1988, J. Virol. 62:139-147).

CA 02164698 2004-07-30

Standard methods which are well-known to those of skill in the art may be utilized for assaying nonretroviral activity. See, for example, Pringle et al. (Pringle, C.R. et al., 1985, J. Medical Virology 12:377-386) for a discussion of respiratory syncytial 5 virus and parainfluenza virus activity assay techniques. Further, see, for example, Zinsser Microbiology, 1988, Joklik, W.K. et al., eds., Appleton & Lange, Norwalk, CT, 19th ed., for a general review of such techniques.

5.5. USES OF THE PEPTIDES OF THE INVENTION The DP-178 (SEQ ID:1) peptides of the invention, and DP-178 fragments, analogs, and homologs, exhibit 15 potent antiviral activity. The DP-107-like and DP178-like peptides of the invention preferably exhibit antiviral activity. As such, the peptides may be used as inhibitors of human and non-human viral and retroviral, especially HIV, transmission to uninfected 20 cells.

The human retroviruses whose transmission may be inhibited by the peptides of the invention include, but are not limited to all strains of HIV-1 and HIV-2 and the human T-lymphocyte viruses (HTLV-I and II).

The non-human retroviruses whose transmission may be inhibited by the peptides of the invention include, but are not limited to bovine leukosis virus, feline sarcoma and leukemia viruses, simian immunodeficiency, sarcoma and leukemia viruses, and sheep progress .

pneumonia viruses.

Non retroviral viruses whose transmission may be inhibited by the peptides of the invention include, but are not limited to human respiratory syncytial virus, canine distemper virus, newcastle disease 35 virus, human parainfluenza virus, and influenza

WO 94/28920

PCT/US94/05739 viruses. Further, any virus or retrovirus containing peptides listed in Tables V through X above, may be inhibited by the peptides of the invention.

As discussed more fully, below, in Section 5.5.1 and in the Example presented, below, in Section 8, DP5 107 and DP-178, and DP-107-like and DP-178-like peptides form non-covalent protein-protein interactions which are required for normal activity of the virus. Thus, the peptides of the invention may also be utilized as components in assays for the 10 identification of compounds that interfere with such protein-protein interactions and may, therefore, act as antiviral agents. These assays are discussed, below, in Section 5.5.1.

15 5.5.1. ANTIVIRAL COMPOUND SCREENING SCREENING

ASSAYS FOR COMPOUNDS THAT INTERACT WITH THE PKD1 GENE PRODUCT

As demonstrated in the Example presented in Section 8, below, DP-107 and DP-178 portions of the TM 2Q protein gp41 form non-covalent protein-protein intereactions. As also demonstrated, the maintenance of such interactions is necessary for normal viral infectivity. Thus, compounds which bind DP-107, bind DP-178, and/or act to disrupt normal DP-107/DP-178 25 protein-protein interactions may act as patent antiviral agents. Described below are assays for the identification of such compounds. Note that, while, for case and clarity of discussion, DP-107 and DP-178 peptides will be used as components of the assays 3Q described, but it is to be understood that any of the DP-107-like or DP-178-like peptides described, above, in Sections 5.1 and 5.2 may also be utilized as part of these screens for antiviral compounds.

Compounds which may be tested for an ability to 35 bind DP-107, DP-178, and/or disrupt DP-107/DP-178 interactions, and which therefore, potentially

WO 94/28920

2164898

PCT/US94/05739 represent antiviral compounds, include, but are not limited to, peptides made of D- and/or L-configuration amino acids (in, for example, the form of random peptide libraries; see Lam, K.S. et al.. 1991, Nature 354:82—841. phosphopeptides (in, for example, the form 5 of random or partially degenerate, directed phosphopeptide libraries; see, for example, Songyang, Z. et al.. 1993, Cell 22:767-778), antibodies, and small organic or inorganic molecules. Synthetic compounds, natural products, and other sources of 10 potentially effective materials may be screened in a variety of ways, as described in this Section. The compounds, antibodies, or other molecules identified may be tested for an ability to inhibit viral activity, utilizing, for example, viral assays such as 15 those described, above, in Section 5.4.

Among the peptides which may be tested are soluble peptides comprising DP-107 and/or DP-178 domains, and peptides comprising DP-107 and/or DP-178 domains having one or more mutations within one or both of the domains, such as the M41-P peptide described, below, in the Example presented in Section 8, which contains a isoleucine to proline mutation within the DP-178 seguence.

In one embodiment of such screening methods is a method for identifying a compound to be tested for antiviral ability comprising:

(a) exposing at least one compound to a peptide comprising a DP-107 peptide for a time sufficient to allow binding of the compound to the DP30 107 peptide;

(b) removing non-bound compounds; and (c) determining the presence of the compound bound to the DP-107 peptide, thereby identifying an agent to be tested for antiviral ability.

WO 94/28920

PCT/US94/05739

In a second embodiment of such screening methods is a method for identifying a compound to be tested for antiviral ability comprising:

(a) exposing at least one compound to a peptide comprising a DP-178 peptide for a time 5 sufficient to allow binding of the compound to the DP178 peptide;

(b) removing non-bound compounds; and (c) determining the presence of the compound bound to the DP-178 peptide, 10 thereby identifying an agent to be tested for antiviral ability.

One method utilizing these types of approaches that may be pursued in the isolation of such DP-107binding or DP-178-binding compounds is an assay which 15 would include the attachment of either the DP-107 or the DP-178 peptide to a solid matrix, such as, for example, agarose or plastic beads, microtiter plate wells, petri dishes, or membranes composed of, for example, nylon or nitrocellulose. In such an assay system, either the DP-107 or DP-178 protein may be anchored onto a solid surface, and the compound, or test substance, which is not anchored, is labeled, either directly or indirectly. In practice, microtiter plates are conveniently utilized. The anchored component may be immobilized by non-covalent or covalent attachments. Non-covalent attachment may be accomplished simply by coating the solid surface with a solution of the protein and drying.

Alternatively, an immobilized antibody, preferably a monoclonal antibody, specific for the protein may be used to anchor the protein to the solid surface. The surfaces may be prepared in advance and stored.

In order to conduct the assay, the labeled compound is added to the coated surface containing the anchored DP-107 or DP-178 peptide. After the reaction

WO 94/28920

PCT/US94/05739 is complete, unreacted components are removed (e.g.. by washing) under conditions such that any complexes formed will remain immobilized on the solid surface. The detection of complexes anchored on the solid surface can be accomplished in a number of ways.

Where the compound is pre-labeled, the detection of label immobilized on the surface indicates that complexes were formed. Where the labeled component is not pre-labeled, an indirect label can he used to detect complexes anchored on the surface; e.g.. using a labeled antibody specific for the compound (the antibody, in turn, may be directly labeled or indirectly labeled with a labeled anti-Ig antibody).

Alternatively, such an assay can be conducted in a liquid phase, the reaction products separated from unreacted components, and complexes detected; e.g.. using an immobilized antibody specific for DP-107 or DP-178, whichever is appropriate for the given assay, or ah antibody specific for the compound, i.e.. the test substance, in order to anchor any complexes formed in solution, and a labeled antibody specific for the other member of the complex to detect anchored complexes.

By utilizing procedures such as this, large numbers of types of molecules may be simultaneously screened for DP-107 or DP-178-binding capability, and thus potential antiviral activity.

Further, compounds may be screened for an ability to inhibit the formation of or, alternatively, disrupt DP-107/DP-178 complexes. Such compounds may then be tested for antiviral capability. For ease of description, DP-107 and DP-178 will be referred to as •’binding partners. Compounds that disrupt such interactions may exhibit antiviral activity. Such compounds may include, but are not limited to

WO 94/28920 2164698

PCT/US94/05739 molecules such as antibodies, peptides, and the like described above.

The basic principle of the assay systems used to identify compounds that interfere with the interaction between the DP-107 and DP-178 peptides involves preparing a reaction mixture containing peptides under conditions and for a time sufficient to allow the two peptides to interact and bind, thus forming a complex. In order to test a compound for disruptive activity, the reaction is conducted in the presence and absence of the test compound, i.e.. the test compound may be initially included in the reaction mixture, or added at a time subsequent to the addition of one of the binding partners; controls are incubated without the test compound or with a placebo. The formation of any complexes between the binding partners is then detected. The formation of a complex in the control reaction, but not in the reaction mixture containing the test compound indicates that the compound interferes with the interaction of the DP-107 and DP-178 peptides.

The assay for compounds that interfere with the interaction of the binding partners can be conducted in a heterogeneous or homogeneous format.

Heterogeneous assays involve anchoring one of the binding partners onto a solid phase and detecting complexes anchored on the solid phase at the end of the reaction. In homogeneous assays, the entire reaction is carried out in a liquid phase. In either approach, the order of addition of reactants can be varied to obtain different information about the compounds being tested. For example, test compounds that interfere with the interaction between the binding partners, e.g.. by competition, can be identified by conducting the reaction in the presence of the test substance; i.e.. by adding the test

WO 94/28920

PCT/US94/05739 substance to the reaction mixture prior to or simultaneously with the binding partners. On the other hand, test compounds that disrupt preformed complexes, e.g. compounds with higher binding constants that displace one of the binding partners from the complex, can be tested by adding the test compound to the reaction mixture after complexes have been formed. The various formats are described briefly below.

In a heterogeneous assay system, one binding partner, e.g.. either the DP-107 or DP-178 peptide, is anchored onto a solid surface, and its binding partner, which is not anchored, is labeled, either directly or indirectly. In practice, microtiter plates are conveniently utilized. The anchored species may be immobilized by non-covalent or covalent attachments. Non-covalent attachment may be accomplished simply by coating the solid surface with a solution of the protein and drying. Alternatively, an immobilized antibody specific for the protein may be used to anchor the protein to the solid surface.

The surfaces may be prepared in advance and stored.

In order to conduct the assay, the binding partner of the immobilized species is added to the coated surface with or without the test compound.

After the reaction is complete, unreacted components are removed (e.g.. by washing) and any complexes formed will remain immobilized on the solid surface. The detection of complexes anchored on the solid surface can be accomplished in a number of ways.

Where the binding partner was pre-labeled, the detection of label immobilized on the surface indicates that complexes were formed. Where the binding partner is not pre-labeled, an indirect label can be used to detect complexes anchored on the surface; e.g.. using a labeled antibody specific for

WO 94/28920

PCT/US94/05739 the binding partner (the antibody, in turn, may be directly labeled or indirectly labeled with a labeled anti-Ig antibody). Depending upon the order of addition of reaction components, test compounds which inhibit complex formation or which disrupt preformed 5 complexes can be detected.

Alternatively, the reaction can be conducted in a liquid phase in the presence or absence of the test compound, the reaction products separated from unreacted components, and complexes detected; e.g..

10 using an immobilized antibody specific for one binding partner to anchor any complexes formed in solution, and a labeled antibody specific for the other binding partner to detect anchored complexes. Again, depending upon the order of addition of reactants to the liquid phase, test compounds which inhibit complex or which disrupt preformed complexes can be identified.

In an alternate embodiment of the invention, a homogeneous assay can be used. In this approach, a preformed complex of the DP-107 and DP-178 peptides is prepared in which one of the binding partners is labeled, but the signal generated by the label is quenched due to complex formation (see, e.g.. U.S.

Patent No. 4,109,496 by Rubenstein which utilizes this approach for immunoassays). The addition of a test substance that competes with and displaces one of the binding partners from the preformed complex will result in the generation of a signal above background. In this way, test substances which disrupt DP-107/ 30 DP-178 protein-protein interaction can be identified.

5.5 PHARMACEUTICAL FORMULATIONS, DOSAGES AND MODES OF ADMINISTRATION

With respect to HIV, the peptides of the invention may be used as a therapeutic in the

WO 94/28920

PCT/US94/05739 treatment of AIDS. The peptides of the invention may be administered using techniques well known to those in the art. Preferably, agents are formulated and administered systemically. Techniques for formulation and administration may be found in Remington's Pharmaceutical Sciences, 18th ed., 1990, Mack Publishing Co., Easton, PA. Suitable routes may include oral, rectal, transmucosal, or intestinal administration; parenteral delivery, including intramuscular, subcutaneous, intramedullary injections, as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections, just to name a few. Most preferably, administration is intravenous. For injection, the agents of the invention may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer. For such transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.

In addition, the peptides may be used as a prophylactic measure in previously uninfected individuals after acute exposure to an HIV virus. Examples of such prophylactic use of the peptides may include, but are not limited to, prevention of virus transmission from mother to infant and other settings where the likelihood of HIV transmission exists, such as, for example, accidents in health care settings wherein workers are exposed to HIV-containing blood products. The peptides of the invention in such cases may serve the role of a prophylactic vaccine, wherein the host raises antibodies against the peptides of the invention, which then serve to neutralize HIV viruses by, for example, inhibiting further HIV infection.

WO 94/28920

PCT/US94/05739

Administration of the peptides of the invention as a prophylactic vaccine, therefore, would comprise administering to a host a concentration of peptides effective in raising an immune response which is sufficient to neutralize HIV, by, for example, inhibiting HIV ability to infect cells. The exact concentration will depend upon the specific peptide to be administered, but may be determined by using standard techniques for assaying the development of an immune response which are well known to those of ordinary skill in the art. The peptides to be used as vaccines are usually administered intramuscularly.

The peptides may be formulated with a suitable adjuvant in order to enhance the immunological response. Such adjuvants may include, but are not limited to mineral gels such as aluminum hydroxide; surface active substances such as lysolecithin, pluronic polyols, polyanions; other peptides; oil emulsions; and potentially useful human adjuvants such as BCG and Corynebacterium parvum. Many methods may be used to introduce the vaccine formulations described here. These methods include but are not limited to oral, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, and intranasal routes.

Alternatively, an effective concentration of polyclonal or monoclonal antibodies raised against the peptides of the invention may be administered to a host so that no uninfected cells become infected by HIV. The exact concentration of such antibodies will vary according to each specific antibody preparation, but may be determined using standard techniques well known to those of ordinary skill in the art.

Administration of the antibodies may be accomplished using a variety of techniques, including, but not limited to those described in this section.

WO 94/28920

PCT/US94/05739

Effective dosages of the peptides of the invention to be administered may be determined through procedures well known to those in the art which address such parameters as biological half-life, bioavailability, and toxicity. Given the data presented below in Section 6, DP-178, for example, may prove efficacious in vivo at doses required achieve circulating levels of long per ml of peptide.

A therapeutically effective dose refers to that amount of the compound sufficient to result in amelioration of symptoms or a prolongation of survival in a patient. Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g.. for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. Compounds which exhibit large therapeutic indices are preferred. The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e.. the concentration of the test compound which achieves a half-maximal disruption of the PTK/adaptor

WO 94/28920

PCT/US94/05739 protein complex, or a half-maximal inhibition of the cellular level and/or activity of a complex component) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography (HPLC).

The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See e.g. Fingl 10 et al., 1975, in The Pharmacological Basis of Therapeutics, Ch. 1 pi).

It should be noted that the attending physician would know how to and when to terminate, interrupt, or adjust administration due to toxicity, or to organ 15 dysfunctions. Conversely, the attending physician would also know to adjust treatment to higher levels if the clinical response were not adequate (precluding toxicity). The magnitude of an administrated dose in the management of the oncogenic disorder of interest .

will vary with the severity of the condition to be treated and to the route of administration. The dose and perhaps dose frequency, will also vary according to the age, body weight, and response of the individual patient. A program comparable to that discussed above may be used m veterinary medicine.

As demonstrated in the Example presented below in

Section 6, the antiviral activity of the peptides of the invention may show a pronounced type and subtype specificity, i.e.. specific peptides may be effective in inhibiting the activity of only specific viruses. This feature of the invention presents many advantages. One such advantage, for example, lies in the field of diagnostics, wherein one can use the antiviral specificity of the peptide of the invention

...

to ascertain the identity of a viral isolate. With

100

WO 94/28920

2161698

PCT/US94/05739 respect to HIV, one may easily determine whether a viral isolate consists of an HIV-1 or HIV-2 strain.

For example, uninfected CD-4+ cells may be co-infected with an isolate which has been identified as containing HIV the DP-178 (SEQ ID:1) peptide, after which the retroviral activity of cell supernatents may be assayed, using, for example, the techniques described above in Section 5.2. Those isolates whose retroviral activity is completely or nearly completely inhibited contain HIV-1. Those isolates whose viral activity is unchanged or only reduced by a small amount, may be considered to not contain HIV-1. Such an isolate may then be treated with one or more of the other DP-178 peptides of the invention, and subsequently be tested for its viral activity in order to determine the identify of the viral isolate.

Use of pharmaceutically acceptable carriers to formulate the compounds herein disclosed for the practice of the invention into dosages suitable for systemic administration is within the scope of the invention. With proper choice of carrier and suitable manufacturing practice, the compositions of the present invention, in particular, those formulated as solutions, may be administered parenterally, such as by intravenous injection. The compounds can be formulated readily using pharmaceutically acceptable carriers well known in the art into dosages suitable for oral administration. Such carriers enable the compounds of the invention to be formulated as tablets, pills, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a patient to be treated.

Pharmaceutical compositions suitable for use in the present invention include compositions wherein the active ingredients are contained in an effective amount to achieve its intended purpose. Determination

101

WO 94/28920

PCT/US94/05739 of the effective amounts is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein.

In addition to the active ingredients, these pharmaceutical compositions may contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries which facilitate processing of the active compounds into preparations which can be used pharmaceutically. The preparations formulated for oral administration may be in the fora of tablets, dragees, capsules, or solutions.

The pharmaceutical compositions of the present invention may be manufactured in a manner that is itself known, e.g.. by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.

Pharmaceutical formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble fora. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.

Pharmaceutical preparations for oral use can be obtained by combining the active compounds with solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding

102

WO 94/28920

PCT/US94/05739 suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethy1-cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.

Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.

Pharmaceutical preparations which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added.

103

CA 02164698 2004-07-30

6. EXAMPLE: DP-178 (SEQ ID:1) IS A POTENT

INHIBITOR OF HIV-1 INFECTION

In this example, DP-178 (SEQ ID:1) is shown to be a potent inhibitor of HIV-1 mediated CD-4+ cell-cell fusion and infection by cell free virus. In the fusion assay, this peptide completely blocks virus induced syncytia formation at concentrations of from

1-10 ng/ml. In the infectivity assay the inhibitory concentration is somewhat higher, blocking infection at 90ng/ml. It is further shown that DP-178 (SEQ ID:1) shows that the antiviral activity of DP-178 (SEQ ID:1) is highly specific for HIV-l. Additionally, a synthetic peptide, DP-185 (SEQ ID:3), representing a HIV-l-derived DP-178 homolog is also found to block HIV-l-mediated syncytia formation.

6.1. MATERIALS AND METHODS

6.1.1. PEPTIDE SYNTHESIS

Peptides were synthesized using Fast Moc chemistry on an Applied Biosystems™ Model 431A peptide synthesizer. Amidated peptides were prepared using Rink resin (Advanced Chemtech) while peptides containing free carboxy termini were synthesized on Wang (p-alkoxy-benzyl-alcohol) resin (Bachem). First residues were double coupled to the appropriate resin and subsequent residues were single coupled. Each coupling step was followed by acetic anhydride capping. Peptides were cleaved from the resin by treatment with trifluoracetic acid (TFA) (10ml), H2O (0.5ml), thioanisole (0.5ml), ethanedithiol (0.25ml), and crystalline phenol (0.75g). Purification was carried out by reverse phase HPLC. Approximately 50mg samples of crude peptide were chromatographed on a Waters Delta Pak™ C18 column (19mm x 30cm, 15μ spherical) with a linear gradient; H2O/acetonitrile

104

WO 94/28920

PCT/US94/05739

0.1% TFA. Lyophilized peptides were stored desiccated and peptide solutions were made in water at about lmg/ml. Electrospray mass spectrometry yielded the following results: DP-178 (SEQ ID:1):4491.87 (calculated 4491.94); DP-180 (SEQ ID:2):4491.45 5 (calculated 4491.94); DP-185 (SEQ ID:3):not done (calculated 4546.97).

6.1.2. VIRUS

The HIV-1^ virus was obtained from R. Gallo (Popovic, M. et al.. 1984, Science 224:497-508) and propagated in CEM cells cultured in RPMI 1640 containing 10% fetal calf serum. Supernatant from the infected CEM cells was passed through a 0.2μπι filter and the infectious titer estimated in a microinfectivity assay using the AA5 cell line to support virus replication. For this purpose, 25μ1 of serial diluted virus was added to 75μ1 AA5 cells at a concentration of 2 x 10s/ml in a 96-well microtitre plate. Each virus dilution was tested in triplicate. Cells were cultured for eight days by addition of fresh medium every other day. On day 8 post infection, supernatant samples were tested for virus replication as evidenced by reverse transcriptase activity released to the supernatant. The TCID50 was calculated according to the Reed and Muench formula (Reed, L.J. et al.. 1938, Am. J. Hyg. 27:493-497).

The titer of the HIV-1^, and HIV-stocks used for these studies, as measured on the AA5 cell line, was approximately 1.4 x 106 and 3.8 x 104 TCID50/ml, respectively.

6.1.3. CELL FUSION ASSAY

Approximately 7 x 104 Molt cells were incubated with 1 x 104 CEM cells chronically infected with the HIV-Ilaj virus in 96-well plates (one-half area cluster plates; Costar, Cambridge, MA) in a final volume of

105

CA 02164698 2004-07-30

ΙΟΟμΙ culture medium as previously described (Matthews, T.J. et al.. 1987, Proc. Natl. Acad. Sci. USA 41: 5424-5428). Peptide inhibitors were added in a volume of 10μ1 and the cell mixtures were incubated for 24 hr. at 37°C. At that time, multinucleated giant cells were estimated by microscopic examination at a 40x magnification which allowed visualization of the entire well in a single field.

6.1.4. CELL FREE VIRUS INFECTION ASSAY Synthetic peptides were incubated at 37°C with either 247 TCIDy, (for experiment depicted in FIG. 2), or 62 TCIDjo (for experiment depicted in FIG.3) units of HIV-Ijju virus or 25 TCIDso units of HIV-2,^ and CEM CD4+ cells at peptide concentrations of 0, 0.04, 0.4, 4.0, and 40μg/ml for 7 days. The resulting reverse transcriptase (RT) activity in counts per minute was determined using the assay described, below, in Section 6.1.5. See, Reed, L.J. et al.. 1938, Am. J. Hyg. 22.: 493-497 for an explanation of TCID^ calculations.

6.1.5. REVERSE TRANSCRIPTASE ASSAY The micro-reverse transcriptase (RT) assay was adapted from Goff et al. (Goff, S. et al.. 1981, J. Virol. 38:239-248) and Willey et al. (Willey, R. et al.. 1988, J. Virol. 42.:139-147). Supertanants from virus/cell cultures are adjusted to 1% Triton-XlOO”1. A 10μ1 sample of supernatant was added to 50μ1 of RT cocktail in a 96-well U-bottom microtitre plate and the samples incubated at 37°C for 90 min. The RT cocktail contained 75mM KC1, 2mM dithiothreitol, 5mM MgCl2, 5μg/ml poly A (Pharmacia, cat. No. 27-4110-01), 0.25 units/ml oligo dT (Pharmacia, cat. No. 27-785801), 0.05% NP40, 50mM Tris-HCl, pH 7.8, 0.5μΜ non106

CA 02164698 2004-07-30 radioactive dTTP, and 10μϋΐ/®1 32P-dTTP (Amersham, cat. No. PB.10167).

After the incubation period, 40μ1 of reaction mixture was applied to a Schleicher and Schuell (S+S) NA45 membrane (or DE81 paper) saturated in 2 x SSC buffer (0.3M NaCl and 0.003M sodium citrate) held in a S+S Minifold over one sheet of GB003 (S+S) filter paper, with partial vacuum applied. Each well of the minifold was washed four times with 200μ1 2xSSC, under full vacuum. The membrane was removed from the minifold and washed 2 more times in a pyrex dish with an excess of 2xSSC. Finally, the membrane was drained on absorbent paper, placed on Whatman #3 paper, covered with Saran wrap™, and exposed to film overnight at -70*C.

6.2. RESULTS

6.2.1. PEPTIDE INHIBITION OF INFECTED CELLINDUCED SYNCYTIA FORMATION

The initial screen for antiviral activity assayed peptides' ability to block syncytium formation induced by overnight co-cultivation of uninfected Molt4 cells with chronically HIV-1 infected CEM cells. The results of several such experiments are presented herein. In the first of these experiments, serial DP178 (SEQ ID:1) peptide concentrations between ΙΟμς/ηιΙ and 12.5ng/ml were tested for blockade of the cell fusion process. For these experiments, CEM cells chronically infected with either HIV-1^, HIV-1,^, HIVIrf, or HIV-1SF2 virus were cocultivated overnight with uninfected Molt 4 cells. The results (FIG. 4A) show that DP-178 (SEQ ID:1) afforded complete protection against each of the HIV-1 isolates down to the lowest concentration of DP-178 (SEQ ID:1) used. For HIV^ inhibition, the lowest concentration tested was

107

CA 02164698 2004-07-30

12.5ng/ml; for all other HIV-l viruses, the lowest concentration of DP-178 (SEQ ID:1) used in this study was 100ng/ml. A second peptide, DP-180 (SEQ ID:2), containing the same amino acid residues as DP-178 (SEQ ID:1) but arranged in a random order exhibited no evidence of anti-fusogenic activity even at the high concentration of 40/xg/ml (FIG. 4A) . These observations indicate that the inhibitory effect of DP-178 (SEQ ID:1) is primary sequence-specific and not related to non-specific peptide/protein interactions. The actual endpoint (i.e.. the lowest effective inhibitory concentration) of DP-178 inhibitory action is within the range of 1-10 ng/ml.

The next series of experiments involved the preparation and testing of a DP-178 (SEQ ID:1) homolog for its ability to inhibit HIV-l-induced syncytia formation. As shown in FIG. 1, the sequence of DP-185 (SEQ ID:3) is slightly different from DP-178 (SEQ ID:1) in that its primary sequence is taken from the HIV-Isr isolate and contains several amino acid differences relative to DP-178 (SEQ ID:1) near the N terminus. As shown in FIG. 4A, DP-185 (SEQ ID:3), exhibits inhibitory activity even at 312.5ng/ml, the lowest concentration tested.

The next series of experiments involved a comparison of DP-178 (SEQ ID:1) HIV-l and HIV-2 inhibitory activity. As shown in FIG. 5, DP-178 (SEQ ID:1) blocked HIV-l-mediated syncytia formation at peptide concentrations below lng/ml. DP-178 (SEQ ID:1) failed, however, to block HIV-2 mediated syncytia formation at concentrations as high as 10/ig/ml. This striking 4 log selectivity of DP-178 (SEQ ID:1) as an inhibitor of HIV-l-mediated cell fusion demonstrates an unexpected HIV-l specificity in the action of DP-178 (SEQ ID:1). DP-178 (SEQ ID:1) inhibition of HIV-l-mediated cell fusion, but the

108

WO 94/28920

PCT/US94/05739 peptide's inability to inhibit HIV-2 medicated cell fusion in the same cell type at the concentrations tested provides further evidence for the high degree of selectivity associated with the antiviral action of

DP-178 (SEQ ID:1).

6.2.2. PEPTIDE INHIBITION OF INFECTION BY CELL-FREE VIRUS

DP-178 (SEQ ID:1) was next tested for its ability to block CD-4+ CEM cell infection by cell free HIV-1 virus. The results, shown in FIG. 2, are from an experiment in which DP-178 (SEQ ID:1) was assayed for its ability to block infection of CEM cells by an HIV-Ila! isolate. Included in the experiment were three control peptides, DP-116 (SEQ ID:9), DP-125 (SEQ

ID:8), and DP-118 (SEQ ID:10). DP-116 (SEQ ID:9) represents a peptide previously shown to be inactive using this assay, and DP-125 (SEQ ID:8; Wild, C. et al.. 1992, Proc. Natl. Acad, Sci. USA 89:10.537) and DP-118 (SEQ ID:10) are peptides which have previously been shown to be active in this assay. Each concentration (0, 0.04, 0.4, 4, and 40gg/ml) of peptide was incubated with 247 TCID50 units of HIV-1^, virus and CEM cells. After 7 days of culture, cellfree supernatant was tested for the presence of RT activity as a measure of successful infection. The results, shown in FIG. 2, demonstrate that DP-178 (SEQ ID:1) inhibited the de novo infection process mediated by the HIV-1 viral isolate at concentrations as low as 90ng/ml (IC50=90ng/ml). In contrast, the two positive control peptides, DP-125 (SEQ: ID:8) and DP-118 (SEQ ID:10), had over 60-fold higher IC50 concentrations of approximately 5/*g/ml.

In a separate experiment, the HIV-1 and HIV-2 inhibitory action of DP-178 (SEQ ID:1) was tested with

CEM cells and either HIV-or HIV-2,^. 62 TCID50

109

WO 94/28920

PCT/US94/05739

HIV-1^, or 25 GCIDjo HIV—2JJJJJ2 were used in these experiments, and were incubated for 7 days. As may be seen in FIG. 3, DP-178 (SEQ ID:1) inhibited HIV-1 infection with an IC50 of about 31ng/ml. In contrast, DP-178 (SEQ ID:1) exhibited a much higher IC50 for 5 HIV-2nihz, thus making DP-178 (SEQ ID:1) two logs more potent as a HIV-1 inhibitor than a HIV-2 inhibitor. This finding is consistent with the results of the fusion inhibition assays described, above, in Section

6.2.1, and further supports a significant level of 10 selectivity (i.e., for HIV-1 over HIV-2).

7. EXAMPLE: THE HIV-1 INHIBITOR,

DP-178 (SEP ID:1) IS NON-CYTOXIC

In this Example, the 36 amino acid synthetic peptide inhibitor DP-178 (SEQ ID:1) is shown to be non-cytotoxic to cells in culture, even at the highest peptide concentrations (40/ig/ml) tested.

7.1. MATERIALS AND METHODS

Cell proliferation and toxicity assay:

Approximately 3.8xl05 CEM cells for each peptide concentration were incubated for 3 days at 37°C in T25 flasks. Peptides tested were DP-178 (SEQ ID:1) and DP-116 (SEQ ID:9), as described in FIG. 1. The concentrations of each peptide used were 0, 2.5, 10, and 40/tg/ml. Cell counts were taken at incubation times of 0, 24, 48, and 72 hours.

7.2. RESULTS

Whether the potent HIV-1 inhibitor DP-178 (SEQ

ID:1) exhibited any cytotoxic effects was assessed by assaying the peptide’s effects on the proliferation and viability of cells in culture. CEM cells were incubated in the presence of varying concentrations of

DP-178 (SEQ ID:1), and DP-116 (SEQ ID:9), a peptide

110

WO 94/28920

PCT/US94/05739 previously shown to be ineffective as a HIV inhibitor (Wild, C. et al.. 1992, Proc. Natl. Acad. Sci. USA

89:10,537-10,541). Additionally, cells were incubated in the absence of either peptide.

The results of the cytoxicity study demonstrate that DP-178 (SEQ ID:1) exhibits no cytotoxic effects on cells in culture. As can be seen, below, in Table XI, even the proliferation and viability characteristics of cells cultured for 3 days in the presence of the highest concentration of DP-178 (SEQ ID:1) tested (40/tg/ml) do not significantly differ from the DP-116 (SEQ ID:9) or the no-peptide controls. The cell proliferation data is also represented in graphic form in FIG. 6. As was demonstrated in the Working Example presented above in Section 6, DP-178 (SEQ ID:1) completely inhibits HIV-1 mediated syncytia formation at peptide concentrations between 1 and 10ng/ml, and completely inhibits cell-free viral infection at concentrations of at least 90ng/ml.

Thus, this study demonstrates that even at peptide concentrations greater than 3 log higher than the HIV inhibitory dose, DP-178 (SEQ ID:1) exhibits no cytoxic effects.

TABLE XI % Viability at time (hours)

Peptide

<td> PeDtide</td><td> Concentration ucr/ml</td><td> 0</td><td> 24</td><td> 48</td><td> 72</td>

111

WO 94/28920

PCT/US94/05739

Peptide 10 8. EXAMPLE; THE INTERACTION OF DP178 AND DP107

Soluble recombinant forms of gp41 used in the example described below provide evidence that the DP178 peptide associates with a distal site on gp41 whose interactive structure is influenced by the DP107 15 leucine zipper motif. A single mutation disrupting the coiled-coil structure of the leucine zipper domain transformed the soluble recombinant gp41 protein from an inactive to an active inhibitor of HIV-l fusion. This transformation may result from liberation of the 20 potent DP178 domain from a molecular clasp with the leucine zipper, DP107, determinant. The results also indicate that the anti-HIV activity of various gp41 derivatives (peptides and recombinant proteins) may be due to their ability to form complexes with viral gp41 25 and interfere with its fusogenic process.

8.1. MATERIALS AND METHODS

8.1.1. CONSTRUCTION OF FUSION PROTEINS AND GP41 MUTANTS_ 30 Construction of fusion proteins and mutants shown in FIG. 7 was accomplished as follows; the DNA sequence corresponding to the extracellular domain of gp41 (540-686) was cloned into the Xmn I site of the expression vector pMal-p2 (New England Biolab) to give

M41. The gp41 sequence was amplified from pgtat

112

WO 94/28920

PCT/US94/05739 (Malim et al., 1988, Nature 355: 181-183) by using polymerase chain reaction (PCR) with upstream primer

5'-ATGACGCTGACGGTACAGGCC-3' (primer A) and downstream primer 5'-TGACTAAGCTTAATACCACAGCCAATTTGTTAT-3' (primer

B). M41-P was constructed by using the T7-Gen 5 in vitro mutagenesis kit from United States Biochemicals (USB) following the supplier's instructions. The mutagenic primer (5'GGAGCTGCTTGGGGCCCCAGAC-3') introduces an lie to Pro mutation in M41 at position 578. Μ41Δ107 was made using a deletion mutagenic primer 5'CCAAATCCCCAGGAGCTGCTCGAGCTGCACTATACCAGAC-3' (primer C) following the USB T7-Gen mutagenesis protocol.

Μ41Δ178 was made by cloning the DNA fragment corresponding to gp41 amino acids 540-642 into the Xmn 15 I site of pMal-p2. Primer A and 5'ATAGCTTCTAGATTAATTGTTAATTTCTCTGTCCC-3' (primer D) were used in the PCR with the template pgtat to generate the inserted DNA fragments. M41-P was used as the template with primer A and D in PCR to generate M4120

ΡΔ178. All inserted sequences and mutated residues were checked by restriction enzyme analysis and confirmed by DNA sequencing.

8.1.2. PURIFICATION AND CHARACTERIZATION

OF FUSION PROTEINS_

The fusion proteins were purified according to the protocol described in the manufacturer's brochure of protein fusion and purification systems from New England Biolabs (NEB). Fusion proteins (10 ng) were analyzed by electrophoresis on 8% SDS polyacrylamide gels. Western blotting analysis was performed as described by Sambrook et al, 1989, Molecular Cloning:

A Laboratory Manual, 2d Ed, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, Ch. 18, pp. 64-75. An HIV-l positive serum diluted 1000-fold,

113

WO 94/28920

PCT/US94/05739 or a human Fab derived from repertoire cloning was used to react with the fusion proteins. The second antibody was HRP-conjugated goat antihuman Fab. An

ECL Western blotting detection system (Amersham) was used to detect the bound antibody. A detailed 5 protocol for this detection system was provided by the manufacturer. Rainbow molecular weight marker (Amersham) were used to estimate the size of fusion proteins.

10 8.1.3. CELL FUSION ASSAYS FOR ANTI-HIV ACTIVITY

Cell fusion assays were performed as previously described (Matthews et al., 1987, Proc. Natl. Acad. Sci. USA 84: 5424-5481). CEM cells (7 X 104) were incubated with HIV-lnn, chronically infected CEM cells (104) in 96-well flat-bottomed half-area plates (Costar) in 100 μΐ culture medium. Peptide and fusion proteins at various concentrations in 10 μΐ culture medium were incubated with the cell mixtures at 37°C for 24 hours. Multinucleated syncytia were estimated . .

with microscopic examination. Both M41 and M41-P did not show cytotoxicity at the concentrations tested and shown in FIG. 8.

Inhibition of HIV-l induced cell-cell fusion activity was carried out in the presence of 10 nM

DP178 and various concentrations of Μ41Δ178 or M41ΡΔ178 as indicated in FIG. 9. There was no observable syncytia in the presence of 10 nM DP178. No peptide or fusion protein was added in the control samples.

30 8.1.4. ELISA ANALYSIS OF DP178 BINDING

TO THE LEUCINE ZIPPER MOTIF OF GP41

The amino acid sequence of DP178 used is: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF. For enzyme linked immunoassay (ELISA), Μ41Δ178 or Μ41-ΡΔ178 (5 μ9/ιη1) in 0.1M NaHCO3, pH 8.6, were coated on 96 wells

114

CA 02164698 2004-07-30

Linbro™ ELISA plates (Flow Lab, Inc.) overnight. Each well was washed three times with distilled water then blocked with 3% bovine serum albumin (BSA) for 2 hours. After blocking, peptides with 0.5% BSA in TBST (40 mM Tris-HCl pH7.5, 150 mM NaCl, 0.05% Tween 20™) were added to the ELISA plates and incubated at room temperature for 1 hour. After washing three times with TBST, Fab-d was added at a concentration of 10 ng/ml with 0.5% BSA in TBST. The plates were washed three times with TBST after incubation at room temperature for 1 hour. Horse radish peroxidase (HRP) conjugated goat antihuman Fab antiserum at a 2000 fold dilution in TBST with 0.5% BSA was added to each well and incubated at room temperature for 45 minutes. The plates were then washed four times with TBST. The peroxidase substrate o-phenylene diamine (2.5 mg/ml) and 0.15% H2O2 were added to develop the color. The reaction was stopped with an equal volume of 4.5 N H2SO4 after incubation at room temperature for 10 minutes. The optical density of the stopped reaction mixture was measured with a micro plate reader (Molecular Design) at 490 nm. Results are shown in FIG. 10.

8.2. RESULTS

8.2.1. THE EXPRESSION AND CHARACTERIZATION of THE. EÇTOPOMAIN QF cpu

As a step toward understanding the roles of the two helical regions in gp41 structure and function, the ectodomain of gp41 was expressed as a maltose binding fusion protein (M41) (Fig. 7). The fusogenic peptide sequence at the N-terminal of gp41 was omitted from this recombinant protein and its derivatives to improve solubility. The maltose binding protein facilitated purification of the fusion proteins under relatively mild, non-denaturing conditions. Because

115

WO 94/28920

PCT/US94/05739 the M41 soluble recombinant gp41 was not glycosylated, lacked several regions of the transmembrane protein (i.e.. the fusion peptide, the membrane spanning, and the cytoplasmic domains), and was expressed in the absence of gpl20, it was not expected to precisely reflect the structure of native gp41 on HIV-1 virions. Nevertheless, purified M41 folded in a manner that preserved certain discontinuous epitopes as evidenced by reactivity with human monoclonal antibodies, 98-6, 126-6, and 50-69, previously shown to bind 10 conformational epitopes on native gp41 expressed in eukaryotic cells (Xu et al., 1991, J. Virol. 65: 48324838; Chen, 1994, J. Virol. 68:2002-2010). Thus, at least certain regions of native gp41 defined by these antibodies appear to be reproduced in the recombinant 15 fusion protein M41. Furthermore, M41 reacted with a human recombinant Fab (Fab-d) that recognizes a conformational epitope on gp41 and binds HIV-1 virions as well as HIV-1 infected cells but not uninfected cells as analyzed by FACS. Deletion of either helix motif, i.e.. DP107 or DP178, of the M41 fusion protein eliminated reactivity with Fab-d. These results indicate that both helical regions, separated by 60 amino acids in the primary sequence, are required to maintain the Fab-d epitope.

8.2.2. ANTI-HIV ACTIVITY OF THE

RECOMBINANT ECTODOMAIN OF GP41

The wild type M41 fusion protein was tested for anti-HIV-1 activity. As explained, supra. synthetic peptides corresponding to the leucine zipper (DP107) and the C-terminal putative helix (DP178) show potent anti-HIV activity. Despite inclusion of both these regions, the recombinant M41 protein did not affect

116

WO 94/28920

PCT/US94/05739

HIV-1 induced membrane fusion at concentrations as high as 50 μΜ (Table XII, below).

TABLE XII

<td> 5</td><td colspan="2"> DISRUPTION OF THE GP41 FREES THE</td><td> LEUCINE ! ANTI-HIV</td><td> ZIPPER MOTIF</td><td> OF</td>

<td> Cell fusion σο»)</td><td> 1 μΜ</td><td> 1 nM</td><td> >50 μΜ</td><td> 83 nM</td><td> >50 μΜ</td>

<td>10 Fab-D binding (kD)</td><td> -</td><td> -</td><td> 3.5x10·’</td><td> 2.5x10'</td><td> 8</td>

<td> HIV infectivity (IC»)</td><td> 1 μΜ</td><td> 80 nM</td><td> > 16 μΜ</td><td> 66 nM</td><td> >8 μΜ</td>

The affinity constants of Fab-d binding to the fusion proteins were determined using a protocol described by B. Friguet et al., 1985, J. Immunol. Method. 77:305-319.

- = No detectable binding of Fab-d to the fusion proteins.

Antiviral Infectivity Assays. 20 μΐ of serially diluted virus stock was incubated for 60 minutes at ambient temperature with 20 μΐ of the indicated concentration of purified recombinant fusion protein in RPMI 1640 containing 10% fetal bovine serum and antibiotics in a 96-well microtiter plate. 20 μΐ of CEM4 cells at 6 x 10s cells/ml were added to each well, and cultures were incubated at 37°C in a humidified CO2 incubator. Cells were cultured for 9 days by the addition of fresh medium every 2 to 30 days. On days 5, 7, and 9 postinfection, supernatant samples were assayed for reverse transcriptase (RT) activity, as described below, to monitor viral replication. The 50% tissue culture infectious dose (TCID») was calculated for each condition according to the formula of Reed & Muench, 1937, Am. J. Hyg. 27:493-497. RT activity was determined by a modification of the published methods of Goff et al., 1981, J. Virol. 38:239-248 and Willey et al., 1988, J. Virol. 62:139-147 as described in Chen et al., 1993, AIDS Res. Human Retroviruses 9:1079-1086.

Surprisingly, a single amino acid substitution, proline in place of isoleucine in the middle of the 35 leucine zipper motif, yielded a fusion protein (M41-P)

117

PCT/US94/05739

WO 94/28920 which did exhibit antiviral activity (Table XII and Fig. 8). As seen in Table XII, M41-P blocked syncytia formation by 90% at approximately 85 nM and neutralized HIV-infection by 90% at approximately 70 nM concentrations. The anti-HIV-1 activity of M41P appeared to be mediated by the C-terminal helical sequence since deletion of that region from M41-P yielded an inactive fusion protein, Μ41-ΡΔ178 (Table XII). That interpretation was reinforced by experiments demonstrating that a truncated fusion protein lacking the DP178 sequence, Μ41Δ178, abrogated the potent anti-fusion activity of the DP178 peptide in a concentration-dependent manner (FIG. 9). The same truncated fusion protein containing the proline mutation disrupting the leucine zipper, Μ41-ΡΔ178, was not active in similar competition experiments (FIG.

9). The results indicate that the DP178 peptide associates with a second site on gp41 whose interactive structure is dependent on a wild type leucine zipper sequence. A similar interaction may occur within the wild type fusion protein, M41, and act to form an intramolecular clasp which sequesters the DP178 region, making it unavailable for anti-viral activity.

A specific association between these two domains is also indicated by other human monoclonal Fab-d studies. For example, Fab-d failed to bind either the DP178 peptide or the fusion protein Μ41Δ178, but its epitope was reconstituted by simply mixing these two reagents together (FIG. 10). Again, the proline mutation in the leucine zipper domain of the fusion protein, Μ41-ΡΔ178, failed to reconstitute the epitope in similar mixing experiments.

118

WO 94/28920

2184893 pCT/US94/05739

9. EXAMPLE; METHOD FOR COMPUTER-ASSISTED

IDENTIFICATION OF DP-107-LIKE

AND DP-178-LIKE SEQUENCES

A number of known coiled-coil sequences have been well described in the literature and contain heptad repeat positioning for each amino acid. Coiled-coil nomenclature labels each of seven amino acids of a heptad repeat A through G, with amino acids A and D tending to be hydrophobic positions. Amino acids E and G tend to be charged. These four positions (A, D,

E, and G) form the amphipathic backbone structure of a monomeric alpha-helix. The backbones of two or more amphipathic helices interact with each other to form di-, tri-, tetrameric, etc., coiled-coil structures.

In order to begin to design computer search motifs, a series of well characterized coiled coils were chosen including yeast transcription factor GCN4, Influenza Virus hemagglutinin loop 36, and human proto-oncogenes c-Myc, c-Fos, and c-Jun. For each peptide sequence, a strict homology for the A and D positions, and a list of the amino acids which could be excluded for the B, C, E, F, and G positions (because they are not observed in these positions) was determined. Motifs were tailored to the DP-107 and DP-178 sequences by deducing the most likely possibilities for heptad positioning of the amino acids of HIV-l Bru DP-107, which is known to have coiled-coil structure, and HIV1 Bru DP-178, which is still structurally undefined. The analysis of each of the sequences is contained in FIG. 12. For example, the motif for GCN4 was designed as follows:

1. The only amino acids (using standard single letter amino acid codes) found in the A or D positions of GCN4 were [LMNV].

2. All amino acids were found at B, C, E, F, and G positions except {CFGIMPTW}.

119

WO 94/28920

PCT/US94/05739

3. The PESEARCH motif would, therefore, be written as follows:

[LMNV]-{CFGIMPTW}(2)-[LMNV]-{CFGIMPTW}(3)[LMNV]-{CFGIMPTW}(2) -[LMNV]-{CFGIMPTW}(3)[LMNV]-{CFGIMPTW}(2)-[LMNV]-{CFGIMPTW}(3)[LMNV]-{CFGIMPTW}(2)-[LMNV]-{CFGIMPTW}(3)

Translating or reading the motif: at the first A position either L, Μ, N, or V must occur; at positions B and C (the next two positions) accept everything except C, F, G, I, M, P, T, or W; at the D position either L, Μ, N, or V must occur; at positions E, F, and G (the next 3 positions) accept everything except C, F, G, I, M, P, T, or W. This statement is contained four times in a 28-mer motif and five times in a 35-mer motif. The basic motif key then would be: [LMNV]-{CFGIMPTW}. The motif keys for the remaining well described coiled-coil sequences are summarized in FIG. 12.

The motif design for DP-107 and DP-178 was slightly different than the 28-mer model sequences described above due to the fact that heptad repeat positions are not defined and the peptides are both longer than 28 residues. FIG. 13 illustrates several possible sequence alignments for both DP-107 and DP178 and also includes motif designs based on 28'mcr, 35·*“, and full-length peptides. Notice that only slight differences occur in the motifs as the peptides are lengthened. Generally, lengthening the base peptide results in a less stringent motif. This is very useful in broadening the possibilities for identifying DP-107-or DP-178-like primary amino acid sequences referred to in this document as hits.

In addition to making highly specific motifs for each type peptide sequence to be searched, it is also possible to make hybrid motifs. These motifs are

120

WO 94/28920

PCT/US94/05739 made by crossing two or more very stringent motifs to make a new search algorithm which will find not only both parent motif sequences but also any peptide sequences which have similarities to one, the other, or both parents. For example, in Table 3 the parent sequence of GCN4 is crossed with each of the possible parent motifs of DP-107. Now the hybrid motif must contain all of the amino acids found in the A and D positions of both parents, and exclude all of the amino acids not found in either parent at the other positions. The resulting hybrid from crossing GCN4 or [LMNV]{CFGIMPTW} and DP-107 (28-mer with the first L in the D position) or [ILQT]{CDFIMPST}, is [ILMNQTV]{CFIMPT}. Notice that now only two basic hybrid motifs exist which cover both framing possibilities, as well as all peptide lengths of the parent DP-107 molecule. FIG. 15 represents the hybridizations of GCN4 with DP-178. FIG. 16 represents the hybridizations of DP-107 and DP-178.

It is important to keep in mind that the represented motifs, both parent and hybrid, are motif keys and not the depiction of the full-length motif needed to actually do the computer search.

Hybridizations can be performed on any combination of two or more motifs. Table 5 summarizes several three-motif hybridizations including GCN4, DP-107 (both frames), and DP-178 (also both frames). Notice that the resulting motifs are now becoming much more similar to each other. In fact, the first and third hybrid motifs are actually subsets of the second and fourth hybrid motifs respectively. This means that the first and third hybrid motifs are slightly more stringent than the second and fourth. It should also be noted that with only minor changes in these four motifs, or by hybridizing them, a single motif could be obtained

121

PCT/US94/05739

WO 94/28920 which would find all of the sequences. However, it should be remembered that stringency is also reduced. Finally, the most broad-spectra and least-stringent hybrid motif is described in FIG. 18 which summarizes the hybridization of GCN4, DP-107 (both frames), DP178 (both frames), c-Fos, c-Jun, c-Myc, and Flu loop 36.

A special set of motifs was designed based on the fact that DP-178 is located only approximately ten amino acids upstream of the transmembrane spanning region of gp41 and just C-terminal to a proline which separates DP-107 and DP-178. It has postulated that DP-178 may be an amphipathic helix when membrane associated, and that the proline might aid in the initiation of the helix formation. The same arrangement was observed in Respiratory Syncytial Virus; however, the DP-178-like region in this virus also had a leucine zipper just C-terminal to the proline. Therefore, designed N-terminal prolineleucine zipper motifs were designed to analyze whether any other viruses might contain this same pattern.

The motifs are summarized in FIG. 19.

The PC/Gene protein database contains 5879 viral amino acid sequences (library file PVIRUSES; CD-ROM release 11.0). Of these, 1092 are viral envelope or glycoprotein sequences (library file PVIRUSE1).

Tables V through X contain lists of protein sequence names and motif hit locations for all the motifs searched.

10. EXAMPLE: COMPUTER-ASSISTED IDENTIFICATION

OF DP-107 AND DP-178-LIKE SEQUENCES IN HUMAN IMMUNODEFICIENCY VIRUS

FIG. 20 represents search results for HIV-l BRU isolate gp41 (PC/Gene protein sequence PENV_HV1BR).

Notice that the hybrid motif which crosses DP-107 and

122

WO 94/28920

PCT/US94/05739

DP-178 (named 107x178x4; the same motif as found in FIG. 16 found three hits including amino acids 550599, 636-688, and 796-823. These areas include DP-107 plus eight N-terminal and four C-terminal amino acids; DP-178 plus seven N-terminal and ten C-terminal amino acids; and an area inside the transmembrane region (cytoplasmic). FIG. 20 also contains the results obtained from searching with the motif named ALLMOTI5, for which the key is found in FIG. 17 ({CDGHP} {CFP}x5). This motif also found three hits including DP-107 (amino acids 510-599), DP-178 (615-717), and a cytoplasmic region (772-841). These hits overlap the hits found by the motif 107x178x4 with considerable additional sequences on both the amino and carboxy termini. This is not surprising in that 107x178x4 is a subset of the ALLMOTI5 hybrid motif. Importantly, even though the stringency of ALLM0TI5 is considerably less than 107x178x4, it still selectively identifies the DP-107 and DP-178 regions of gp41 shown to contain sequences for inhibitory peptides of HIV-1. The results of these two motif searches are summarized in Table V under the PC/Gene protein sequence name PENV HV1BR. The proline-leucine zipper motifs also gave several hits in HIV-1 BRU including 503-525 which is at the very C-terminus of gpl2O, just upstream of the cleavage site (P7LZIPC and P12LZIPC); and 735-768 in the cytoplasmic domain of gp41 (P23LZIPC). These results are found in Tables VIII, IX, and X under the same sequence name as mentioned above. Notice that the only area of HIV-1 BRU which is predicted by the Lupas algorithm to contain a coiled-coil region, is from amino acids 635-670. This begins eight amino acids N-terminal to the start and ends eight amino acids N-terminal to the end of DP-178. DP-107, despite the fact that it is a known coiled coil, is

123

WO 94/28920

PCT/US94/05739 not predicted to contain a coiled-coil region using the Lupas method.

11. EXAMPLE: COMPUTER-ASSISTED IDENTIFICATION

OF DP-107-LIKE AND DP-178-LIKE SEQUENCES IN HUMAN RESPIRATORY 5 SYNCYTIAL VIRUS_

FIG. 21 represents search results for Human Respiratory Syncytial Virus (RSV; Strain A2) fusion glycoprotein Fl (PC/Gene protein sequence name PVGLF_ 10 HRSVA). Motif 107x178x4 finds three hits including amino acids 152-202, 213-243, and 488-515. The arrangement of these hits is similar to what is found in HIV-1 except that the motif finds two regions with similarities to DP-178, one just downstream of what 15 would be called the DP-107 region or amino acids 213243, and one just upstream of the transmembrane region (also similar to DP-178) or amino acids 488-515.

Motif ALLMOTI5 also finds three areas including amino acids 116-202, 267-302, and 506-549. The proline2Q leucine zipper motifs also gave several hits including amino acids 205-221 and 265-287 (P1LZIPC 265-280, P12LZIPC), and 484-513 (P7LZIPC and P12LZIPC 484-506, P23LZIPC). Notice that the PLZIP motifs also identify regions which share location similarities with DP-178 of HIV-1.

12. EXAMPLE: COMPUTER-ASSISTED IDENTIFICATION OF

DP-107-LIKE AND DP-178-LIKE SEQUENCES IN SIMIAN IMMUNODEFICIENCY VIRUS

Motif hits for Simian immunodeficiency Virus gp41 30 (AGM3 isolate; PC/Gene protein sequence name

PENV_SIVAG) are shown in FIG. 22. Motif 107x178x4 finds three hits including amino acids 566-593, 597624, and 703-730. The first two hits only have three amino acids between them and could probably be . .

combined into one hit from 566-624 which would

124

WO 94/28920

2164898 PCT/US94/05739 represent a DP-107-like hit. Amino acids 703 to 730 would then represent a DP-178-like hit. ALLMOTI5 also finds three hits including amino acids 556-628 (DP107-like), 651-699 (DP-178-like), and 808-852 which represents the transmembrane spanning region. SIV 5 also has one region from 655-692 with a high propensity to form a coiled coil as predicted by the Lupas algorithm. Both 107x178x4 and ALLMOTI5 motifs find the same region. SIV does not have any PLZIP motif hits in gp4l.

13. EXAMPLE: COMPUTER-ASSISTED IDENTIFICATION OF

DP-107-LIKE AND DP-178 LIKE SEQUENCES IN CANINE DISTEMPER VIRUS

Canine Distemper Virus (strain Onderstepoort) fusion glycoprotein FI (PC/Gene Protein sequence name

PVGLF_CDVO) has regions similar to Human RSV which are predicted to be DP-107-like and DP-178-like (FIG. 23). Motif 107x178x4 highlights one area just C-terminal to the fusion peptide at amino acids 252-293. Amino acids 252-286 are also predicted to be coiled coil using the Lupas algorithm. Almost 100 amino acids Cterminal to the first region is a DP-178-like area at residues 340-367. ALLMOTI5 highlights three areas of interest including: amino acids 228-297, which completely overlaps both the Lupas prediction and the DP-107-like 107x178x4 hit; residues 340-381, which overlaps the second 107x178x4 hit; and amino acids 568-602, which is DP178-like in that it is located just N-terminal to the transmembrane region. It also overlaps another region (residues 570-602) predicted by the Lupas method to have a high propensity to form a coiled coil. Several PLZIP motifs successfully identified areas of interest including P6 and P12LZIPC which highlight residues 336-357 and 336-361 respectively; Pl and P12LZIPC which find residues 398125

PCT/US94/05739

414; and P12 and P23LZIPC which find residues 562-589 and 562-592 respectively.

WO 94/28920

14. EXAMPLE: COMPUTER-ASSISTED IDENTIFICATION OF

DP-107-LIKE AND DP-178-LIKE SEQUENCES IN NEWCASTLE DISEASE VIRUS

FIG. 24 shows the motif hits found in Newcastle Disease Virus (strain Australia-Victoria/32; PC Gene protein seguence name PVGLF_NDVA). Motif 107x178x4 finds two areas including a DP-107-like hit at amino acids 151-178 and a DP-178-like hit at residues 426512. ALLMOTI5 finds three areas including residues 117-182, 231-272, and 426-512. The hits from 426-512 include a region which is predicted by the Lupas method to have a high coiled-coil propensity (46015 503). The PLZIP motifs identify only one region of interest at amino acids 273-289 (Pl and 12LZIPC).

15. EXAMPLE: COMPUTER-ASSISTED IDENTIFICATION

OF DP-107-LIKE AND DP-178-LIKE SEQUENCES IN HUMAN PARAINFLUENZA VIRUS

Both motifs 107x178x4 and ALLMOTI5 exhibit DP107-like hits in the same region, 115-182 and 117-182 respectively, of Human Parainfluenza Virus (strain NIH 47885; PC/Gene protein seguence name PVGLF_pl3H4;

25 (FIG. 25). In addition, the two motifs have a DP-178like hit just slightly C-terminal at amino acids 207241. Both motifs also have DP-178-like hits nearer the transmembrane region including amino acids 457-497 and 462-512 respectively. Several PLZIP motif hits 3Q are also observed including 283-303 (P5LZIPC), 283-310 (P12LZIPC), 453-474 (P6LZIPC), and 453-481 (P23LZIPC). The Lupas algorithm predicts that amino acids 122-176 have a propensity to form a coiled-coil.

126

CA 02164698 2004-07-30

16. EXAMPLE: COMPUTER-ASSISTED IDENTIFICATION OF

DP-107-LIKE AND DP-178-LIKE SEQUENCES OF

INFLUENZA A YIRUg

FIG. 26 illustrates the Lupas prediction for a coiled coil in Influenza A Virus (strain A/Aichi/2/68) at residues 379-436, as well as the motif hits for 107x178x4 at amino acids 387-453, and for ALLMOTI5 at residues 380-456. Residues 383-471 (38-125 of HA2) were shown by Carr and Kim to be an extended coiled coil when under acidic pH (Carr and Kim, 1993, Cell 73: 823-832). The Lupas algorithyan predicts a coiled-coil at residues 379-436. All three methods successfully predicted the region shown to actually have coiled-coil structure; however, ALLMOTI5 predicted the greatest portion of the 88 residue stretch.

17. EXAMPLE: RSV ANTIVIRAL COMPOUNDS In the Example presented herein, respiratory syncytial virus (RSV) peptide sequences identified by utilizing the computer-assisted coiled-coil peptide sequence searches described in Example 9, above, are shown to encode peptide domains that exhibit structural similarity to actual, known coiled-coil peptides, and are, additionally found to exhibit antiviral activity.

17.1 MATERIALS,,ARP METHQPS

Structural analyses consisted of circular dichroism (CD) studies, which were conducted according to the methods described in the Applicants' U.S.

Patent No. 5,464,933 issued on November 7, 1995.

Anti-RSV antiviral activity was assayed as described in Pringle, C.R. et al., 1985, J. Medical Vir. 12:377-386.

127

WO 94/28920

PCT/US94/05739

A 48 amino acid RSV F2 peptide and a 53 amino acid RSV T67 peptide are utilized which span sequences that were identified via the computer assisted peptide sequence search strategies described in Example 9, above. See FIG. 21 for the exact position of these sequences and for the motifs utilized.

17.2 RESULTS

35-mer oligopeptides were synthesized which constituted portions of the 48 amino acid RSV F2 peptide sequence (FIG. 27) and portions of the 53 amino acid RSV T67 peptide sequence (FIG. 28). The oligopeptides were assayed, via CD analysis, for structural similarity to known coiled-coil structures, and for anti-RSV activity. As shown in FIGS. 27 and 28, a number of these oligopeptides exhibited substantial coiled-coil structural similarity and/or antiviral activity.

Thus, the computer assisted searches described, herein, in Example 9, for example, successfully identified viral peptide domains that represent highly promising anti-RSV antiviral compounds.

18. EXAMPLE: HPF3 ANTIVIRAL COMPOUNDS In the Example presented herein, human parainfluenza virus 3 (HPF3) peptide sequences identified by utilizing the computer-assisted coiledcoil peptide sequence searches described in Example 9, above, are shown to encode peptide domains that exhibit structural similarity to actual, known coiledcoil peptides, and are, additionally found to exhibit antiviral activity.

18.1 MATERIALS AND METHODS Structural analyses consisted of circular dichroism (CD) studies, which were conducted according

128

CA 02164698 2004-07-30 to the methods described in the Applicants' U.S.

Patent No. 5,464,933 issued on November 7, 1995.

Anti-HPF3 antiviral activity was assayed as described in Pringle, C.R. et al., 1985, J. Medical Vir. 17:377-386.

A 56 amino acid and 70 amino acid HPF3 peptide are utilized which span sequences that were identified via the computer assisted peptide sequence search strategies described in Example 9, above. See FIG. 25 for the exact positions of these sequences and for the motifs utilized.

18.2 RESULTS

35-mer oligopeptides were synthesized which constituted portions of the 56 amino acid HPF3 peptide sequence (FIG. 29) and portions of the 70 amino acid HPF3 peptide sequence (FIG. 30). The oligopeptides were assayed, via CD analysis, for structural similarity to known coiled-coil structures, and for anti-HPF3 activity. As shown in FIGS. 29 and 30, a number of these oligopeptides exhibited substantial coiled-coil structural similarity and/or antiviral activity.

Thus, the computer assisted searches described, herein, in Example 9, for example, successfully identified viral peptide domains that represent highly promising anti-HPF3 antiviral compounds.

The present invention is not to be limited in scope by the specific embodiments described which are intended as single illustrations of individual aspects of the invention, and functionally equivalent methods and components are within the scope of the invention. Indeed, various modifications of the invention, in addition to those shown and described herein will become apparent to those skilled in the art from the

129

WO 94/28920

PCT/US94/05739

foregoing description and accompanying drawings. Such modifications are intended to fall within the scope of the appended claims.

130

Contents302

41 sheets

Sheet 1
Sheet 2
Sheet 3
Sheet 4
Sheet 5
Sheet 6
Sheet 7
Sheet 8
Sheet 9
Sheet 10
Sheet 11
Sheet 12
Sheet 13
Sheet 14
Sheet 15
Sheet 16
Sheet 17
Sheet 18
Sheet 19
Sheet 20
Sheet 21
Sheet 22
Sheet 23
Sheet 24
Sheet 25
Sheet 26
Sheet 27
Sheet 28
Sheet 29
Sheet 30
Sheet 31
Sheet 32
Sheet 33
Sheet 34
Sheet 35
Sheet 36
Sheet 37
Sheet 38
Sheet 39
Sheet 40
Sheet 41

80 members in 16 offices

This recordMember, by publication datePriority claim6 more offices are in the list below

Priority claims9

Priority claims
Document	Office	Kind	Date
073028	United States of America	–	1993-06-07
7302893	United States of America	A	1993-06-07
7302893	United States of America	A	1993-06-07
9405739	United States of America	W	1994-06-07
9405739	United States of America	W	1994-06-07
073028	–	–	–
PCTUS1994005739	–	–	–
US19930073028	–	–	–
WO1994US05739	–	–	–

Members80

Family members, oldest first
Document	Office	Kind
CA2164698A1	Canada	A1	1994-12-22
WO9428920A1	World Intellectual Property Organization (WIPO)	A1	1994-12-22
AU7042694A	Australia	A	1995-01-03
US5464933A	United States of America	A	1995-11-07
KR960702753A	Republic of Korea	A	1996-05-23
CA2208420A1	Canada	A1	1996-06-27
WO9619495A1	World Intellectual Property Organization (WIPO)	A1	1996-06-27
AU4473496A	Australia	A	1996-07-10
JPH08511525A	Japan	A	1996-12-03
EP0774971A1	European Patent Office (EPO)	A1	1997-05-28
EP0793675A1	European Patent Office (EPO)	A1	1997-09-10
KR987000333A	Republic of Korea	A	1998-03-30
EP0774971A4	European Patent Office (EPO)	A4	1998-06-10
AU692777B2	Australia	B2	1998-06-18
EP0793675A4	European Patent Office (EPO)	A4	1998-08-19
NZ267803A	New Zealand	A	1999-03-29
AU714695B2	Australia	B2	2000-01-06
US6013263A	United States of America	A	2000-01-11
US6017536A	United States of America	A	2000-01-25
NZ300002A	New Zealand	A	2000-02-28
US6054265A	United States of America	A	2000-04-25
US6060065A	United States of America	A	2000-05-09
NZ329775A	New Zealand	A	2000-05-26
US6068973A	United States of America	A	2000-05-30
US6093794A	United States of America	A	2000-07-25
US6133418A	United States of America	A	2000-10-17
US6228983B1	United States of America	B1	2001-05-08
JP2001523082A	Japan	A	2001-11-20
US6333395B1	United States of America	B1	2001-12-25
NZ501727A	New Zealand	A	2002-07-26
US6440656B1	United States of America	B1	2002-08-27
US6479055B1	United States of America	B1	2002-11-12
KR100355407B1	Republic of Korea	B1	2003-02-07
US6518013B1	United States of America	B1	2003-02-11
US2004033235A1	United States of America	A1	2004-02-19
US2004052820A1	United States of America	A1	2004-03-18
US6824783B1	United States of America	B1	2004-11-30
EP0774971B1	European Patent Office (EPO)	B1	2005-04-13
AT293127T	Austria	T	2005-04-15
ATE293127T1	Austria	T1	2005-04-15
DE69434335D1	Germany	D1	2005-05-19
CL2004001413A1	Chile	A1	2005-05-20
LU91166I2	Luxembourg	I2	2005-06-20
NL300192I1	Netherlands (Kingdom of the)	I1	2005-07-01
PT774971E	Portugal	E	2005-07-29
NL300192I2	Netherlands (Kingdom of the)	I2	2005-08-01
DE122005000025I1	Germany	I1	2005-08-04
DK0774971T3	Denmark	T3	2005-08-22
ES2238674T3	Spain	T3	2005-09-01
US6951717B1	United States of America	B1	2005-10-04
EP0793675B1	European Patent Office (EPO)	B1	2005-11-02
AT308558T	Austria	T	2005-11-15
ATE308558T1	Austria	T1	2005-11-15
EP1595890A2	European Patent Office (EPO)	A2	2005-11-16
DE69534569D1	Germany	D1	2005-12-08
DE122005000025I2	Germany	I2	2006-02-09
DE69434335T2	Germany	T2	2006-02-16
ES2252747T3	Spain	T3	2006-05-16
JP2006176529A	Japan	A	2006-07-06
DE69534569T2	Germany	T2	2006-08-10
US7122190B2	United States of America	B2	2006-10-17
EP1714974A2	European Patent Office (EPO)	A2	2006-10-25
KR100558087B1	Republic of Korea	B1	2007-01-31
US2007037141A1	United States of America	A1	2007-02-15
EP1595890A3	European Patent Office (EPO)	A3	2007-03-21
EP1714974A3	European Patent Office (EPO)	A3	2007-03-21
EP0793675B9	European Patent Office (EPO)	B9	2007-05-09
US2007202123A1	United States of America	A1	2007-08-30
US2007202127A1	United States of America	A1	2007-08-30
US7273614B2	United States of America	B2	2007-09-25
JP4205159B2	Japan	B2	2009-01-07
US7514397B1	United States of America	B1	2009-04-07
JP2009213475A	Japan	A	2009-09-24
CL2009002139A1	Chile	A1	2010-05-07
US7794725B1	United States of America	B1	2010-09-14
CA2208420C	Canada	C	2010-11-09
US2010291680A1	United States of America	A1	2010-11-18
US7988974B2	United States of America	B2	2011-08-02
US2011275146A1	United States of America	A1	2011-11-10
CA2164698CThis record	Canada	C	2012-10-09

3 legal events, as the office reported them to INPADOC

Over the term

Point at a mark for the event

Events

Legal events, newest first
	Event	Code
2023-05-26	ExpiryMKEX	MKEX
2014-08-11	ExpiryMKEX	MKEX
2001-03-20	Examination requestEEER	EEER

Numbers

Publication: 2164698
Publication, DOCDB: 2164698
Publication, EPODOC: CA2164698
Application: 2164698
Application, DOCDB: 2164698
Application, EPODOC: CA19942164698

Titles2

English: SYNTHETIC PEPTIDE INHIBITORS OF HIV TRANSMISSION
French: PEPTIDES SYNTHETIQUES, INHIBITEURS DE LA TRANSMISSION DU VIH

Classification

CPC, 35: A61K38/00
C07K14/005
A61K39/00
A61K2039/525
C07K5/0806
C07K5/0808
C07K5/0812
C07K5/0815
C07K5/0817
C07K5/0819
C07K5/1008
C07K5/101
C07K5/1013
C07K5/1016
C07K5/1021
C07K5/1024
C07K14/21
C07K14/22
C07K14/285
C07K14/31
C12N2710/16222
C12N2730/10122
C12N2740/15022
C12N2740/16122
C12N2740/16222
C12N2760/16122
C12N2760/18022
C12N2760/18122
C12N2760/18422
C12N2760/18522
Y10S435/974
Y10S530/826
A61P31/12
C07K14/16
A61K38/12
Filled: the office’s first classification
IPC, 46: C12Q1 70
A61K38 00
A61K39 155
A61K39 21
A61K39 42
C07K5 08
C07K5 083
C07K5 087
C07K5 09
C07K5 093
C07K5 10
C07K5 103
C07K5 107
C07K5 113
C07K5 117
C07K7 06
C07K7 08
C07K14 005
C07K14 02
C07K14 05
C07K14 11
C07K14 115
C07K14 12
C07K14 125
C07K14 13
C07K14 135
C07K14 15
C07K14 155
C07K14 16
C07K14 21
C07K14 22
C07K14 285
C07K14 31
A61K39 00
G01N33 566
A61K38 16
A61K39 12
A61P31 12
C07K17 08
C07K17 10
C12N15 11
C12N15 62
C12N15 63
C12Q1 00
G01N33 53
G01N33 569

Abstract

Term

WO 94/28920

PCT/US94/05739

SYNTHETIC PEPTIDE INHIBITORS OF HIV TRANSMISSION

1. INTRODUCTION

WO 94/28920

PCT/US94/05739

2. BACKGROUND OF THE INVENTION

2.1. THE HUMAN IMMUNODEFICIENCY VIRUS

WO 94/28920

2.2. HIV TREATMENT

WO 94/28920

WO 94/28920

216463S

WO 94/28920

WO 94/28920

3.1. DEFINITIONS

WO 94/28920

PCT/US94/05739

4. BRIEF DESCRIPTION OF THE FIGURES

WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

WO 94/28920

WO 94/28920

PCT/US94/05739

5.1. DP-178 AND DP-178-LIKE PEPTIDES

WO 94/28920

WO 94/28920

PCT/US94/05739

TABLE I

X-YTS-Z

X-YTSL-Z

X-YTSLI-Z

X-YTSLIH-Z

WO 94/28920

PCT/US94/05739

2164S58,

TABLE II

X-NWFX-WNWFX-LWNWF—

X-ELLELDKWASLWNWF-Z

X-QELLELDKWASLWNWF-Z X-EQELLELDKWASLWNWF-Z

X-NEQELLELDKWASLWNWF-Z X-KNEQELLELDKWASLWNWF-Z

X-EKNEQELLELDKWASLWNWF-Z X-QEKNEQELLELDKWASLWNWF-Z

X-QQEKNEQELLELDKWASLWNWF-Z

X-NQQEKNEQELLELDKWASLWNWF-Z

X-QNQQEKNEQELLELDKWASLWNWF-Z X-SQNQQEKNEQELLELDKWASLWNWF-Z

X-ESQNQQEKNEQELLELDKWASLWNWF-Z X-EESQNQQEKNEQELLELDKWASLWNWF-Z

X-SLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-HSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-IHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-LIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-SLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

X-TSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-Z

WO 94/28920

PCT/US94/05739

WO 94/28920

WO 94/28920

PCT/US94/05739

WO 94/28920

PCT/US94/05739

TABLE III

X-LEA-Z

X-LEAN-Z

X-LEANI-Z

X-LEANIS-Z

WO 94/28920

TABLE IV

X-NWLX-TNWLX-FTNWLX-VFTNWL5 X-DVFTNWL-Z

X-WDVFTNWL-Z

X-SWDVFTNWL-Z

X-NSWDVFTNWL-Z